F438449

General Info

Members Datasets Scaffolds Average Seq Length
414 341 828 353

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2728368998|2728752167
Length 396
Sequence WRPRLITRRWLENVAVDWIGKVVETPLLCGGSTPEASEGSSMSQSFTYQVSPMRVVFGVGTIADLADELERLNITRALVLASRRQHAELGDLAALTGGRMAGLFEGAVVHTPVAVTEQAMQVVRDLKPDGVVAIGAGAATGLSKAIALRTDLPQLILPTSYAGSEMTPVLGETVDGVKTTQSSPKILPEAVIYDVNLTVSMPAQFSAISGLNAIAHAAEALYARDGNPITSLMAEEAIAKLASSLPEVMARPRDLEVRSDALYGAWLCAVCLGTVGMALHHKLCHTVGALFDLPHAETHAVLLPHTIAYNTPAAPDAIGRAAKALGAPDAADGLFELSARLGAPRSLAEIGMPEDGIARAAELATRNPYWNPRPIEQAGIYDLLKRAWAGARPQAG

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
59 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
108 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
109 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
110 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
111 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
118 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
119 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
136 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
137 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
138 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
139 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
140 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
198 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
199 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
200 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
201 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
202 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
203 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
207 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
208 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
209 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
210 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
213 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
214 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
215 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
216 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
217 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
218 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
219 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
220 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
221 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
222 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
223 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
224 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
225 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
226 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
227 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
228 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
229 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
230 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
231 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
232 2643221582 Rhizobium sp. Root651 Isolate Unclassified
233 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
234 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
235 2643221693 Rhizobium sp. Root491 Isolate Unclassified
236 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
237 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
238 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
239 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
240 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
241 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
242 2791355256 Rhizobium sp. M10 Isolate Nodule
243 2791355262 Rhizobium sp. M1 Isolate Nodule
244 2791355263 Rhizobium chutanense C5 Isolate Nodule
245 2791355265 Rhizobium sp. H4 Isolate Nodule
246 2802429633 Rhizobium anhuiense J3 Isolate Nodule
247 2802429634 Rhizobium anhuiense S10 Isolate Nodule
248 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
249 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
250 2802429637 Rhizobium anhuiense C15 Isolate Nodule
251 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
252 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
253 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
254 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
255 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
256 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
257 2841760612 Bosea sp. Tri-49 Isolate Nodule
258 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
259 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
260 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
261 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
262 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
263 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
264 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
265 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
266 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
267 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
268 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
269 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
270 2844104063 Bosea sp. Tri-39 Isolate Nodule
271 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
272 2851246043 Bosea sp. Tri-54 Isolate Nodule
273 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
274 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
275 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
276 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
277 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
278 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
279 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
280 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
281 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
282 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
283 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
284 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
285 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
286 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
287 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
288 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
289 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
290 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
291 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
292 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
293 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
294 2906610324
295 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
296 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
297 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
298 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
299 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
300 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
301 2922425934
302 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
303 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
304 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
305 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
306 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
307 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
308 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
309 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
310 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
311 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
312 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
313 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
314 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
315 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
316 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
317 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
318 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
319 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
320 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
321 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
322 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
323 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
324 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
325 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
326 641522639 Methylobacterium sp. 4-46 Isolate Nodule
327 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
328 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
329 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
330 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
331 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
332 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
333 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
334 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
335 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
336 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
337 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
338 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
339 8056382006 Rhizobium croatiense 13T Isolate Nodule
340 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
341 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.13
Metatranscriptomes 0
Isolates 31.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.18
Nodule 24.15
Rhizoplane 2.17
Rhizosphere 43.24
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001384 3300003187 Bacteria 16731
2 JGI25406J46586_10001330 3300003203 Bacteria 11638
3 JGI25153J46596_10003474 3300003215 Bacteria 8818
4 JGI25153J46596_10005541 3300003215 Bacteria 6603
5 JGI25160J50197_1000656 3300003354 Bacteria 19238
6 JGI25161J50226_1001184 3300003374 Bacteria 8575
7 Ga0055529_1000806 3300003763 Bacteria 19128
8 Ga0055526_1000811 3300003771 Bacteria 23284
9 Ga0055524_1000659 3300003775 Bacteria 24377
10 Ga0055528_1000569 3300003790 Bacteria 27917
11 Ga0055528_1007979 3300003790 Bacteria 4606
12 Ga0055540_1020693 3300003792 Bacteria 1733
13 Ga0058692_1004597 3300003856 Bacteria 4069
14 Ga0055543_1000246 3300004625 Bacteria 41802
15 Ga0065714_10002201 3300005288 Bacteria 61466
16 Ga0070683_100318448 3300005329 Bacteria 1480
17 Ga0068868_100015481 3300005338 Bacteria 5642
18 Ga0070687_100027024 3300005343 Bacteria 2768
19 Ga0070687_100065133 3300005343 Bacteria 1938
20 Ga0070668_100039936 3300005347 Bacteria 3590
21 Ga0070668_100124326 3300005347 Bacteria 2065
22 Ga0070669_100005311 3300005353 Bacteria 9302
23 Ga0070675_100000097 3300005354 Bacteria 50764
24 Ga0070671_100148771 3300005355 Bacteria 1977
25 Ga0070705_100000116 3300005440 Bacteria 45853
26 Ga0070705_100042354 3300005440 Bacteria 2603
27 Ga0070700_100052827 3300005441 Bacteria 2535
28 Ga0070694_100001150 3300005444 Bacteria 15195
29 Ga0070694_100002924 3300005444 Bacteria 10153
30 Ga0068867_100026838 3300005459 Bacteria 4137
31 Ga0070707_100244945 3300005468 Unclassified 1744
32 Ga0070698_100005282 3300005471 Bacteria 14133
33 Ga0070699_100103295 3300005518 Bacteria 2499
34 Ga0070672_100039617 3300005543 Bacteria 3611
35 Ga0070672_100043534 3300005543 Bacteria 3463
36 Ga0070695_100000787 3300005545 Bacteria 17060
37 Ga0070695_100070017 3300005545 Bacteria 2293
38 Ga0070696_100009124 3300005546 Bacteria 6642
39 Ga0070665_100011413 3300005548 Bacteria 8981
40 Ga0070665_100135110 3300005548 Bacteria 2468
41 Ga0070704_100016155 3300005549 Bacteria 4711
42 Ga0070704_100127445 3300005549 Unclassified 1966
43 Ga0070664_100005824 3300005564 Bacteria 9941
44 Ga0070702_100013889 3300005615 Bacteria 4076
45 Ga0070702_100224885 3300005615 Bacteria 1257
46 Ga0068859_100007806 3300005617 Bacteria 10861
47 Ga0068864_100123088 3300005618 Bacteria 2322
48 Ga0068861_100014260 3300005719 Bacteria 5575
49 Ga0068870_10035010 3300005840 Bacteria 2574
50 Ga0068860_100000711 3300005843 Bacteria 38159
51 Ga0068860_100006527 3300005843 Bacteria 11712
52 Ga0068862_100023591 3300005844 Bacteria 5156
53 Ga0068862_100030566 3300005844 Bacteria 4540
54 Ga0081455_10010701 3300005937 Bacteria 9278
55 Ga0081455_10039117 3300005937 Bacteria 4195
56 Ga0081455_10141276 3300005937 Bacteria 1870
57 Ga0081540_1004785 3300005983 Bacteria 10207
58 Ga0081540_1018202 3300005983 Bacteria 4319
59 Ga0081540_1018680 3300005983 Bacteria 4243
60 Ga0081540_1020620 3300005983 Bacteria 3956
61 Ga0081539_10000199 3300005985 Bacteria 139305
62 Ga0081539_10028560 3300005985 Bacteria 3504
63 Ga0075365_10028883 3300006038 Bacteria 3540
64 Ga0075368_10015170 3300006042 Bacteria 2854
65 Ga0075363_100001628 3300006048 Bacteria 8653
66 Ga0070712_100038740 3300006175 Bacteria 3259
67 Ga0075362_10000310 3300006177 Bacteria 13838
68 Ga0075367_10000406 3300006178 Bacteria 15858
69 Ga0075367_10001789 3300006178 Bacteria 9463
70 Ga0075367_10003181 3300006178 Bacteria 7749
71 Ga0075367_10158506 3300006178 Bacteria 1407
72 Ga0075369_10046311 3300006186 Bacteria 1872
73 Ga0075366_10000482 3300006195 Bacteria 18457
74 Ga0097621_100326682 3300006237 Bacteria 1360
75 Ga0075370_10012610 3300006353 Bacteria 4473
76 Ga0075428_100237217 3300006844 Bacteria 1968
77 Ga0075433_10031088 3300006852 Bacteria 4561
78 Ga0075434_100001166 3300006871 Bacteria 21762
79 Ga0075434_100024235 3300006871 Bacteria 5931
80 Ga0075434_100041458 3300006871 Bacteria 4561
81 Ga0075434_100364774 3300006871 Bacteria 1465
82 Ga0097620_100001043 3300006931 Bacteria 28397
83 Ga0097620_100007806 3300006931 Bacteria 10861
84 Ga0099824_1010060 3300006942 Bacteria 11362
85 Ga0099822_1001406 3300006943 Bacteria 27885
86 Ga0099826_10013964 3300006948 Bacteria 6068
87 Ga0105247_10089551 3300009101 Bacteria 1951
88 Ga0114129_10027281 3300009147 Bacteria 8085
89 Ga0114129_10184071 3300009147 Bacteria 2840
90 Ga0114129_10387632 3300009147 Bacteria 1844
91 Ga0105243_10088132 3300009148 Bacteria 2549
92 Ga0105238_10114937 3300009551 Bacteria 2670
93 Ga0105249_10099514 3300009553 Bacteria 2733
94 Ga0157371_10000205 3300013102 Bacteria 86623
95 Ga0157370_10000752 3300013104 Bacteria 40508
96 Ga0157375_10437181 3300013308 Bacteria 1474
97 Ga0157380_10243104 3300014326 Bacteria 1624
98 Ga0182008_10012614 3300014497 Bacteria 4459
99 Ga0157376_10394895 3300014969 Unclassified 1336
100 Ga0182005_1028098 3300015265 Bacteria 1534
101 Ga0207425_1002430 3300025245 Bacteria 6557
102 Ga0209129_1000541 3300025258 Bacteria 26327
103 Ga0209565_1019919 3300025263 Bacteria 1425
104 Ga0209455_1002335 3300025272 Bacteria 7416
105 Ga0209673_1000105 3300025273 Bacteria 186267
106 Ga0209673_1002281 3300025273 Bacteria 13713
107 Ga0209675_1018380 3300025291 Bacteria 1958
108 Ga0209025_1000555 3300025294 Bacteria 69450
109 Ga0209564_1000642 3300025295 Bacteria 53019
110 Ga0209758_1000380 3300025297 Bacteria 77252
111 Ga0209256_1000755 3300025299 Bacteria 42078
112 Ga0209256_1005030 3300025299 Bacteria 7889
113 Ga0207426_1000350 3300025302 Bacteria 84510
114 Ga0209051_1003251 3300025303 Bacteria 10796
115 Ga0207710_10088484 3300025900 Bacteria 1446
116 Ga0207643_10002123 3300025908 Bacteria 10905
117 Ga0207663_10182740 3300025916 Bacteria 1499
118 Ga0207662_10007854 3300025918 Bacteria 5814
119 Ga0207662_10079769 3300025918 Bacteria 1995
120 Ga0207652_10060570 3300025921 Bacteria 3265
121 Ga0207646_10073126 3300025922 Bacteria 3062
122 Ga0207681_10015607 3300025923 Bacteria 4739
123 Ga0207659_10001600 3300025926 Bacteria 13441
124 Ga0207644_10030711 3300025931 Bacteria 3739
125 Ga0207670_10006857 3300025936 Bacteria 6338
126 Ga0207670_10009740 3300025936 Bacteria 5498
127 Ga0207669_10065145 3300025937 Bacteria 2259
128 Ga0207691_10035251 3300025940 Bacteria 4646
129 Ga0207661_10006055 3300025944 Bacteria 8545
130 Ga0207679_10141248 3300025945 Bacteria 1947
131 Ga0207712_10163625 3300025961 Bacteria 1732
132 Ga0207668_10015324 3300025972 Bacteria 4760
133 Ga0207668_10076031 3300025972 Bacteria 2416
134 Ga0207668_10134146 3300025972 Bacteria 1895
135 Ga0207708_10028941 3300026075 Bacteria 4195
136 Ga0207641_10045474 3300026088 Bacteria 3697
137 Ga0207648_10014716 3300026089 Bacteria 7221
138 Ga0207676_10056468 3300026095 Bacteria 3087
139 Ga0207675_100013728 3300026118 Bacteria 7556
140 Ga0209371_1000611 3300027312 Bacteria 31966
141 Ga0209589_1000007 3300027357 Bacteria 425699
142 Ga0209489_100008 3300027361 Bacteria 425699
143 Ga0209700_100009 3300027363 Bacteria 425699
144 Ga0209282_1052295 3300027666 Bacteria 2333
145 Ga0209588_1002879 3300027671 Bacteria 4724
146 Ga0268266_10010180 3300028379 Bacteria 8239
147 Ga0268266_10022780 3300028379 Bacteria 5333
148 Ga0268265_10001045 3300028380 Bacteria 24902
149 Ga0268264_10000065 3300028381 Bacteria 298403
150 Ga0307515_10000014 3300028794 Bacteria 562358
151 Ga0307515_10288157 3300028794 Bacteria 1341
152 Ga0265338_10011460 3300028800 Bacteria 10237
153 Ga0268256_1002167 3300030500 Bacteria 10421
154 Ga0268256_1029708 3300030500 Bacteria 1334
155 Ga0307511_10050089 3300030521 Bacteria 3368
156 Ga0316181_1030869 3300030744 Bacteria 9412
157 Ga0265340_10082280 3300031247 Bacteria 1514
158 Ga0265339_10003604 3300031249 Bacteria 10808
159 Ga0307508_10006236 3300031616 Bacteria 11235
160 Ga0265342_10168503 3300031712 Bacteria 1207
161 Ga0307516_10000405 3300031730 Bacteria 56495
162 Ga0307516_10092712 3300031730 Bacteria 2847
163 Ga0307409_100298109 3300031995 Bacteria 1498
164 Ga0307416_100079916 3300032002 Bacteria 2758
165 Ga0307414_10006617 3300032004 Bacteria 6475
166 Ga0307507_10018057 3300033179 Bacteria 8053
167 Ga0307510_10000011 3300033180 Bacteria 355464
168 Ga0315911_1000007 3300033442 Bacteria 413725
169 Ga0373935_0009470 3300035692 Bacteria 5827
170 Ga0373927_0014953 3300035695 Bacteria 5135
171 Ga0373947_0219155 3300035725 Bacteria 1250
172 Ga0373925_0151856 3300037068 Bacteria 1819
173 Ga0373925_0216666 3300037068 Bacteria 1527
174 Ga0439438_000266 3300041405 Bacteria 23469
175 Ga0439447_003094 3300041407 Bacteria 5942
176 Ga0451839_1151481 3300041496 Bacteria 4649
177 Ga0439432_005583 3300042006 Bacteria 4524
178 Ga0439452_006512 3300042010 Bacteria 3654
179 Ga0439452_007695 3300042010 Bacteria 3286
180 Ga0439456_000685 3300042013 Bacteria 6939
181 Ga0466972_0044444 3300044658 Bacteria 2154
182 Ga0466966_0131737 3300044684 Bacteria 1531
183 Ga0466970_0224556 3300044765 Bacteria 1049
184 Ga0466959_0117185 3300045049 Bacteria 1896
185 Ga0451576_0701172 3300045051 Bacteria 1064
186 Ga0495638_0027332 3300046460 Bacteria 3694
187 Ga0495606_0008034 3300046507 Bacteria 9265
188 Ga0495628_0006855 3300046516 Bacteria 9903
189 Ga0495631_0048589 3300046518 Bacteria 1860
190 Ga0495632_0020455 3300046519 Bacteria 3583
191 Ga0495632_0034090 3300046519 Bacteria 2608
192 Ga0495637_0003373 3300046520 Bacteria 8483
193 Ga0495643_0120642 3300046522 Bacteria 1325
194 Ga0495648_0002795 3300046524 Bacteria 15731
195 Ga0495648_0011528 3300046524 Bacteria 6649
196 Ga0495586_0157494 3300046535 Bacteria 1280
197 Ga0495645_0014262 3300046543 Bacteria 5635
198 Ga0495622_0080785 3300046557 Bacteria 1496
199 Ga0495633_0011129 3300046558 Bacteria 4875
200 Ga0495633_0016033 3300046558 Bacteria 3876
201 Ga0495668_0081294 3300046616 Bacteria 1778
202 Ga0495611_0015922 3300046648 Bacteria 3213
203 Ga0495625_0003541 3300046660 Bacteria 15441
204 Ga0495623_0138506 3300046679 Bacteria 1450
205 Ga0495647_0096642 3300046681 Bacteria 1218
206 Ga0495658_0004215 3300046683 Bacteria 7075
207 Ga0495674_0268649 3300047319 Bacteria 1400
208 Ga0495672_0018937 3300047320 Bacteria 4555
209 Ga0496101_0241074 3300048904 Bacteria 1407
210 Ga0496104_0092617 3300048907 Bacteria 2890
211 Ga0496106_0011662 3300048909 Bacteria 6494
212 Ga0496107_0232192 3300048910 Bacteria 1373
213 Ga0496116_0001390 3300048919 Bacteria 27229
214 Ga0496117_0000002 3300048920 Bacteria 2483758
215 Ga0496117_0037617 3300048920 Bacteria 3603
216 Ga0496117_0064641 3300048920 Bacteria 2493
217 Ga0496118_0000501 3300048921 Bacteria 64803
218 Ga0496118_0034135 3300048921 Bacteria 4158
219 Ga0496118_0046763 3300048921 Bacteria 3362
220 Ga0496119_0028983 3300048922 Bacteria 3764
221 Ga0496120_0000093 3300048923 Bacteria 146905
222 Ga0496121_0003152 3300048924 Bacteria 23785
223 Ga0496121_0041479 3300048924 Bacteria 4020
224 Ga0496121_0107223 3300048924 Bacteria 2140
225 Ga0496121_0225078 3300048924 Bacteria 1318
226 Ga0496122_0000004 3300048925 Bacteria 645283
227 Ga0496122_0031425 3300048925 Bacteria 4419
228 Ga0496123_0000007 3300048926 Bacteria 645283
229 Ga0496124_0004567 3300048927 Bacteria 16078
230 Ga0496124_0004749 3300048927 Bacteria 15657
231 Ga0496125_0008087 3300048928 Bacteria 11081
232 Ga0496125_0009015 3300048928 Bacteria 10334
233 Ga0496125_0035497 3300048928 Bacteria 4371
234 Ga0496125_0041755 3300048928 Bacteria 3917
235 Ga0496125_0047426 3300048928 Bacteria 3592
236 Ga0496126_0022723 3300048929 Bacteria 6092
237 Ga0496126_0038820 3300048929 Bacteria 4426
238 Ga0496126_0099899 3300048929 Bacteria 2541
239 Ga0501034_0110201 3300049571 Bacteria 2744
240 Ga0501076_0094216 3300049592 Bacteria 2411
241 Ga0501035_0239175 3300049822 Bacteria 1545
242 nmdc:mga03683_385_c2 3300050489 Bacteria 7727
243 nmdc:mga03683_738_c1 3300050489 Bacteria 9349
244 nmdc:mga03n38_2888_c1 3300050490 Bacteria 5417
245 nmdc:mga03n38_3701_c1 3300050490 Bacteria 4947
246 nmdc:mga00v17_105483_c1 3300050491 Bacteria 1783
247 nmdc:mga00v17_955_c1 3300050491 Bacteria 15496
248 nmdc:mga0yw44_20055_c1 3300050492 Bacteria 3702
249 nmdc:mga0yw44_4699_c1 3300050492 Bacteria 6314
250 nmdc:mga0k408_141604_c1 3300050493 Bacteria 1431
251 nmdc:mga0k408_1879_c1 3300050493 Bacteria 11260
252 nmdc:mga06z11_7671_c1 3300050494 Bacteria 4455
253 nmdc:mga07m45_1029_c1 3300050496 Bacteria 12372
254 nmdc:mga05p37_6931_c1 3300050507 Bacteria 13353
255 nmdc:mga08y16_23084_c1 3300050511 Bacteria 6569
256 nmdc:mga0n895_19465_c1 3300050512 Bacteria 6311
257 nmdc:mga0n895_258363_c1 3300050512 Bacteria 1768
258 nmdc:mga0n895_44517_c1 3300050512 Bacteria 4328
259 nmdc:mga0a205_108865_c1 3300050515 Bacteria 2669
260 nmdc:mga0a205_303353_c1 3300050515 Bacteria 1470
261 nmdc:mga0a205_82928_c1 3300050515 Bacteria 3097
262 nmdc:mga0sz30_328_c1 3300050516 Bacteria 10583
263 Ga0500578_0177740 3300053086 Bacteria 1313
264 Ga0500566_0000066 3300053094 Bacteria 50309
265 Ga0500640_045518 3300053095 Bacteria 1925
266 Ga0500641_0087009 3300053096 Bacteria 1331
267 Ga0500560_000224 3300053107 Bacteria 6884
268 Ga0500593_037355 3300053117 Bacteria 2176
269 Ga0500595_025803 3300053119 Unclassified 2032
270 Ga0500618_016097 3300053125 Bacteria 1877
271 Ga0500559_0000762 3300053136 Bacteria 21121
272 Ga0500568_0000103 3300053139 Bacteria 78174
273 Ga0500573_0076022 3300053140 Bacteria 1911
274 Ga0500604_0005621 3300053151 Bacteria 3308
275 Ga0500624_000931 3300053157 Bacteria 6144
276 Ga0500627_0013960 3300053158 Bacteria 3065
277 Ga0500636_0000001 3300053177 Bacteria 324086
278 Ga0500636_0015625 3300053177 Bacteria 4475
279 Ga0500636_0053667 3300053177 Bacteria 2365
280 Ga0466962_0015513 3300061719 Bacteria 3675
281 2728752167 2728368998 Bacteria 8720350
282 2510137093 2510065019 Bacteria 6903379
283 2513568191 2513237084 Bacteria 7231967
284 2513657775 2513237096 Bacteria 8722461
285 2513861543 2513237137 Bacteria 9558895
286 2513911813 2513237144 Bacteria 7530820
287 2513919774 2513237145 Bacteria 8979722
288 2514421286 2513237305 Bacteria 7293571
289 2517895215 2517572143 Bacteria 9484767
290 2526063834 2524614857 Bacteria 4146328
291 2537874024 2537561587 Bacteria 5425293
292 2545673209 2545555834 Bacteria 8130841
293 2554248669 2554235003 Bacteria 5877155
294 2559295757 2558860242 Bacteria 5568029
295 2585543438 2585427528 Bacteria 6842387
296 2585841946 2585427593 Bacteria 7141551
297 2599602080 2599185210 Bacteria 5624189
298 2601609668 2600255279 Bacteria 5605316
299 2601746443 2600255308 Bacteria 5611129
300 2603860150 2602042107 Bacteria 6226103
301 2643919924 2643221582 Bacteria 5804683
302 2644045606 2643221606 Bacteria 5588032
303 2644392768 2643221671 Bacteria 5496681
304 2644523276 2643221693 Bacteria 5513853
305 2671121761 2667528175 Bacteria 7532676
306 2723571675 2721755686 Bacteria 7343952
307 2739035385 2738541333 Bacteria 7106503
308 2740064318 2739367875 Bacteria 4157290
309 2776915020 2775507049 Bacteria 6284736
310 2793069165 2791355197 Bacteria 8420563
311 2793293893 2791355256 Bacteria 6798008
312 2793334988 2791355262 Bacteria 6774204
313 2793341941 2791355263 Bacteria 6872478
314 2793355442 2791355265 Bacteria 6539969
315 2806048307 2802429633 Bacteria 7341974
316 2806056092 2802429634 Bacteria 7083200
317 2806062909 2802429635 Bacteria 7650140
318 2806070513 2802429636 Bacteria 7597525
319 2806077424 2802429637 Bacteria 7067217
320 2808987508 2808606387 Bacteria 5697198
321 2838663870 2838661181 Bacteria 7385261
322 2838675349 2838675328 Bacteria 4909118
323 2838714230 2838714209 Bacteria 5525906
324 2838721968 2838719591 Bacteria 5523910
325 2838724991 2838724970 Bacteria 4908691
326 2841763114 2841760612 Bacteria 6454112
327 2841848947 2841846520 Bacteria 5345850
328 2841862616 2841859092 Bacteria 5436171
329 2842117212 2842110456 Bacteria 7656360
330 2842125022 2842124991 Bacteria 5346824
331 2842130244 2842130223 Bacteria 4909145
332 2842154586 2842152218 Bacteria 4908957
333 2842170473 2842170452 Bacteria 5525737
334 2842178206 2842175837 Bacteria 4908771
335 2842187339 2842187318 Bacteria 5524014
336 2842211650 2842211629 Bacteria 5523832
337 2842226730 2842224351 Bacteria 5524473
338 2842519400 2842515876 Bacteria 5436280
339 2844109016 2844104063 Bacteria 6440972
340 2847935700 2847930680 Bacteria 9342022
341 2851251123 2851246043 Bacteria 6439203
342 2854896450 2854896431 Bacteria 5869725
343 2856369302 2856364286 Bacteria 6939991
344 2857351294 2857349434 Bacteria 7926032
345 2857525143 2857524615 Bacteria 6615449
346 2869286625 2869285874 Bacteria 6901219
347 2871434779 2871429161 Bacteria 6547891
348 2874149982 2874146452 Bacteria 7533118
349 2874158240 2874155637 Bacteria 6724144
350 2876416444 2876413966 Bacteria 6831344
351 2878751912 2878745973 Bacteria 6867388
352 2881163841 2881161766 Bacteria 7127907
353 2885375640 2885374607 Bacteria 8927485
354 2888351560 2888350351 Bacteria 7372807
355 2893071548 2893066018 Bacteria 6158120
356 2899795701 2899792073 Bacteria 4926588
357 2899848952 2899845264 Bacteria 5672268
358 2903504857 2903492973 Bacteria 13473544
359 2903754287 2903748898 Bacteria 9972761
360 2903754632 2903748898 Bacteria 9972761
361 2904698266 2904690495 Bacteria 9412302
362 2906314309 2906308376 Bacteria 6841989
363 2906327475 2906321335 Bacteria 6579571
364 2906611882
365 2906635855 2906635258 Bacteria 8601019
366 2906665436 2906660503 Bacteria 8595048
367 2908740595 2908739725 Bacteria 8628932
368 2908741600 2908739725 Bacteria 8628932
369 2908762866 2908756301 Bacteria 8864324
370 2919079030 2919073203 Bacteria 6531949
371 2919114260 2919114240 Bacteria 5700270
372 2922427416
373 2922431538
374 2926755281 2926754445 Bacteria 5964435
375 2926762391 2926760298 Bacteria 5505990
376 2933009231 2933006813 Bacteria 4912075
377 2933014429 2933011516 Bacteria 5439334
378 2933596178 2933594066 Bacteria 5594265
379 2935636158 2935630451 Bacteria 8169952
380 2937815582 2937813078 Bacteria 7783518
381 2941512789 2941507105 Bacteria 8166816
382 2941520644 2941515067 Bacteria 8166720
383 2941528658 2941523033 Bacteria 8169134
384 2958051096 2958041894 Bacteria 13082850
385 2958099264 2958092219 Bacteria 6861151
386 2958103388 2958100919 Bacteria 6800575
387 2958131028 2958130278 Bacteria 6897202
388 2958174169 2958172287 Bacteria 6716688
389 2958184949 2958179912 Bacteria 6874908
390 2961083116 2961077736 Bacteria 7079850
391 2977845818 2977843712 Bacteria 6753583
392 2977870087 2977864932 Bacteria 7534097
393 2979711169 2979710463 Bacteria 6785254
394 2979749154 2979742915 Bacteria 7301278
395 2987638478 2987636660 Bacteria 8088555
396 3004205279 3004203850 Bacteria 7307914
397 3005477128 3005474847 Bacteria 9259049
398 641642192 641522639 Bacteria 7737025
399 650740969 650716007 Bacteria 5573770
400 8003572041 8003570095 Bacteria 5747666
401 8004393799 8004387939 Bacteria 7049250
402 8004720567 8004714634 Bacteria 6776161
403 8005250467 8005246636 Bacteria 4933972
404 8005571577 8005570704 Bacteria 6957481
405 8005662596 8005658619 Bacteria 4500593
406 8006938339 8006933436 Bacteria 10410654
407 8006978416 8006973647 Bacteria 10679141
408 8018154847 8018150411 Bacteria 5549903
409 8019570774 8019565922 Bacteria 9639779
410 8019575353 8019565922 Bacteria 9639779
411 8054559775 8054558443 Bacteria 5204801
412 8056387461 8056382006 Bacteria 6408074
413 8056677014 8056673599 Bacteria 7871253
414 8057535697 8057529695 Bacteria 6306553
415 JGI25151J46595_10001384
416 JGI25406J46586_10001330
417 JGI25153J46596_10003474
418 JGI25153J46596_10005541
419 JGI25160J50197_1000656
420 JGI25161J50226_1001184
421 Ga0055529_1000806
422 Ga0055526_1000811
423 Ga0055524_1000659
424 Ga0055528_1000569
425 Ga0055528_1007979
426 Ga0055540_1020693
427 Ga0058692_1004597
428 Ga0055543_1000246
429 Ga0065714_10002201
430 Ga0070683_100318448
431 Ga0068868_100015481
432 Ga0070687_100027024
433 Ga0070687_100065133
434 Ga0070668_100039936
435 Ga0070668_100124326
436 Ga0070669_100005311
437 Ga0070675_100000097
438 Ga0070671_100148771
439 Ga0070705_100000116
440 Ga0070705_100042354
441 Ga0070700_100052827
442 Ga0070694_100001150
443 Ga0070694_100002924
444 Ga0068867_100026838
445 Ga0070707_100244945
446 Ga0070698_100005282
447 Ga0070699_100103295
448 Ga0070672_100039617
449 Ga0070672_100043534
450 Ga0070695_100000787
451 Ga0070695_100070017
452 Ga0070696_100009124
453 Ga0070665_100011413
454 Ga0070665_100135110
455 Ga0070704_100016155
456 Ga0070704_100127445
457 Ga0070664_100005824
458 Ga0070702_100013889
459 Ga0070702_100224885
460 Ga0068859_100007806
461 Ga0068864_100123088
462 Ga0068861_100014260
463 Ga0068870_10035010
464 Ga0068860_100000711
465 Ga0068860_100006527
466 Ga0068862_100023591
467 Ga0068862_100030566
468 Ga0081455_10010701
469 Ga0081455_10039117
470 Ga0081455_10141276
471 Ga0081540_1004785
472 Ga0081540_1018202
473 Ga0081540_1018680
474 Ga0081540_1020620
475 Ga0081539_10000199
476 Ga0081539_10028560
477 Ga0075365_10028883
478 Ga0075368_10015170
479 Ga0075363_100001628
480 Ga0070712_100038740
481 Ga0075362_10000310
482 Ga0075367_10000406
483 Ga0075367_10001789
484 Ga0075367_10003181
485 Ga0075367_10158506
486 Ga0075369_10046311
487 Ga0075366_10000482
488 Ga0097621_100326682
489 Ga0075370_10012610
490 Ga0075428_100237217
491 Ga0075433_10031088
492 Ga0075434_100001166
493 Ga0075434_100024235
494 Ga0075434_100041458
495 Ga0075434_100364774
496 Ga0097620_100001043
497 Ga0097620_100007806
498 Ga0099824_1010060
499 Ga0099822_1001406
500 Ga0099826_10013964
501 Ga0105247_10089551
502 Ga0114129_10027281
503 Ga0114129_10184071
504 Ga0114129_10387632
505 Ga0105243_10088132
506 Ga0105238_10114937
507 Ga0105249_10099514
508 Ga0157371_10000205
509 Ga0157370_10000752
510 Ga0157375_10437181
511 Ga0157380_10243104
512 Ga0182008_10012614
513 Ga0157376_10394895
514 Ga0182005_1028098
515 Ga0207425_1002430
516 Ga0209129_1000541
517 Ga0209565_1019919
518 Ga0209455_1002335
519 Ga0209673_1000105
520 Ga0209673_1002281
521 Ga0209675_1018380
522 Ga0209025_1000555
523 Ga0209564_1000642
524 Ga0209758_1000380
525 Ga0209256_1000755
526 Ga0209256_1005030
527 Ga0207426_1000350
528 Ga0209051_1003251
529 Ga0207710_10088484
530 Ga0207643_10002123
531 Ga0207663_10182740
532 Ga0207662_10007854
533 Ga0207662_10079769
534 Ga0207652_10060570
535 Ga0207646_10073126
536 Ga0207681_10015607
537 Ga0207659_10001600
538 Ga0207644_10030711
539 Ga0207670_10006857
540 Ga0207670_10009740
541 Ga0207669_10065145
542 Ga0207691_10035251
543 Ga0207661_10006055
544 Ga0207679_10141248
545 Ga0207712_10163625
546 Ga0207668_10015324
547 Ga0207668_10076031
548 Ga0207668_10134146
549 Ga0207708_10028941
550 Ga0207641_10045474
551 Ga0207648_10014716
552 Ga0207676_10056468
553 Ga0207675_100013728
554 Ga0209371_1000611
555 Ga0209589_1000007
556 Ga0209489_100008
557 Ga0209700_100009
558 Ga0209282_1052295
559 Ga0209588_1002879
560 Ga0268266_10010180
561 Ga0268266_10022780
562 Ga0268265_10001045
563 Ga0268264_10000065
564 Ga0307515_10000014
565 Ga0307515_10288157
566 Ga0265338_10011460
567 Ga0268256_1002167
568 Ga0268256_1029708
569 Ga0307511_10050089
570 Ga0316181_1030869
571 Ga0265340_10082280
572 Ga0265339_10003604
573 Ga0307508_10006236
574 Ga0265342_10168503
575 Ga0307516_10000405
576 Ga0307516_10092712
577 Ga0307409_100298109
578 Ga0307416_100079916
579 Ga0307414_10006617
580 Ga0307507_10018057
581 Ga0307510_10000011
582 Ga0315911_1000007
583 Ga0373935_0009470
584 Ga0373927_0014953
585 Ga0373947_0219155
586 Ga0373925_0151856
587 Ga0373925_0216666
588 Ga0439438_000266
589 Ga0439447_003094
590 Ga0451839_1151481
591 Ga0439432_005583
592 Ga0439452_006512
593 Ga0439452_007695
594 Ga0439456_000685
595 Ga0466972_0044444
596 Ga0466966_0131737
597 Ga0466970_0224556
598 Ga0466959_0117185
599 Ga0451576_0701172
600 Ga0495638_0027332
601 Ga0495606_0008034
602 Ga0495628_0006855
603 Ga0495631_0048589
604 Ga0495632_0020455
605 Ga0495632_0034090
606 Ga0495637_0003373
607 Ga0495643_0120642
608 Ga0495648_0002795
609 Ga0495648_0011528
610 Ga0495586_0157494
611 Ga0495645_0014262
612 Ga0495622_0080785
613 Ga0495633_0011129
614 Ga0495633_0016033
615 Ga0495668_0081294
616 Ga0495611_0015922
617 Ga0495625_0003541
618 Ga0495623_0138506
619 Ga0495647_0096642
620 Ga0495658_0004215
621 Ga0495674_0268649
622 Ga0495672_0018937
623 Ga0496101_0241074
624 Ga0496104_0092617
625 Ga0496106_0011662
626 Ga0496107_0232192
627 Ga0496116_0001390
628 Ga0496117_0000002
629 Ga0496117_0037617
630 Ga0496117_0064641
631 Ga0496118_0000501
632 Ga0496118_0034135
633 Ga0496118_0046763
634 Ga0496119_0028983
635 Ga0496120_0000093
636 Ga0496121_0003152
637 Ga0496121_0041479
638 Ga0496121_0107223
639 Ga0496121_0225078
640 Ga0496122_0000004
641 Ga0496122_0031425
642 Ga0496123_0000007
643 Ga0496124_0004567
644 Ga0496124_0004749
645 Ga0496125_0008087
646 Ga0496125_0009015
647 Ga0496125_0035497
648 Ga0496125_0041755
649 Ga0496125_0047426
650 Ga0496126_0022723
651 Ga0496126_0038820
652 Ga0496126_0099899
653 Ga0501034_0110201
654 Ga0501076_0094216
655 Ga0501035_0239175
656 nmdc:mga03683_385_c2
657 nmdc:mga03683_738_c1
658 nmdc:mga03n38_2888_c1
659 nmdc:mga03n38_3701_c1
660 nmdc:mga00v17_105483_c1
661 nmdc:mga00v17_955_c1
662 nmdc:mga0yw44_20055_c1
663 nmdc:mga0yw44_4699_c1
664 nmdc:mga0k408_141604_c1
665 nmdc:mga0k408_1879_c1
666 nmdc:mga06z11_7671_c1
667 nmdc:mga07m45_1029_c1
668 nmdc:mga05p37_6931_c1
669 nmdc:mga08y16_23084_c1
670 nmdc:mga0n895_19465_c1
671 nmdc:mga0n895_258363_c1
672 nmdc:mga0n895_44517_c1
673 nmdc:mga0a205_108865_c1
674 nmdc:mga0a205_303353_c1
675 nmdc:mga0a205_82928_c1
676 nmdc:mga0sz30_328_c1
677 Ga0500578_0177740
678 Ga0500566_0000066
679 Ga0500640_045518
680 Ga0500641_0087009
681 Ga0500560_000224
682 Ga0500593_037355
683 Ga0500595_025803
684 Ga0500618_016097
685 Ga0500559_0000762
686 Ga0500568_0000103
687 Ga0500573_0076022
688 Ga0500604_0005621
689 Ga0500624_000931
690 Ga0500627_0013960
691 Ga0500636_0000001
692 Ga0500636_0015625
693 Ga0500636_0053667
694 Ga0466962_0015513
695 2728752167
696 2510137093
697 2513568191
698 2513657775
699 2513861543
700 2513911813
701 2513919774
702 2514421286
703 2517895215
704 2526063834
705 2537874024
706 2545673209
707 2554248669
708 2559295757
709 2585543438
710 2585841946
711 2599602080
712 2601609668
713 2601746443
714 2603860150
715 2643919924
716 2644045606
717 2644392768
718 2644523276
719 2671121761
720 2723571675
721 2739035385
722 2740064318
723 2776915020
724 2793069165
725 2793293893
726 2793334988
727 2793341941
728 2793355442
729 2806048307
730 2806056092
731 2806062909
732 2806070513
733 2806077424
734 2808987508
735 2838663870
736 2838675349
737 2838714230
738 2838721968
739 2838724991
740 2841763114
741 2841848947
742 2841862616
743 2842117212
744 2842125022
745 2842130244
746 2842154586
747 2842170473
748 2842178206
749 2842187339
750 2842211650
751 2842226730
752 2842519400
753 2844109016
754 2847935700
755 2851251123
756 2854896450
757 2856369302
758 2857351294
759 2857525143
760 2869286625
761 2871434779
762 2874149982
763 2874158240
764 2876416444
765 2878751912
766 2881163841
767 2885375640
768 2888351560
769 2893071548
770 2899795701
771 2899848952
772 2903504857
773 2903754287
774 2903754632
775 2904698266
776 2906314309
777 2906327475
778 2906611882
779 2906635855
780 2906665436
781 2908740595
782 2908741600
783 2908762866
784 2919079030
785 2919114260
786 2922427416
787 2922431538
788 2926755281
789 2926762391
790 2933009231
791 2933014429
792 2933596178
793 2935636158
794 2937815582
795 2941512789
796 2941520644
797 2941528658
798 2958051096
799 2958099264
800 2958103388
801 2958131028
802 2958174169
803 2958184949
804 2961083116
805 2977845818
806 2977870087
807 2979711169
808 2979749154
809 2987638478
810 3004205279
811 3005477128
812 641642192
813 650740969
814 8003572041
815 8004393799
816 8004720567
817 8005250467
818 8005571577
819 8005662596
820 8006938339
821 8006978416
822 8018154847
823 8019570774
824 8019575353
825 8054559775
826 8056387461
827 8056677014
828 8057535697

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00465

Fe-ADH

Iron-containing alcohol dehydrogenase

52

195

0.93

PF13685

Fe-ADH_2

Iron-containing alcohol dehydrogenase

56

202

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jzd-assembly2.cif.gz_C crystal structure of putative alcohol dehedrogenase (yp_298327.1) from ralstonia eutropha jmp134 at 2.10 a resolution 0.972 1 351
3jzd-assembly2.cif.gz_C crystal structure of putative alcohol dehedrogenase (yp_298327.1) from ralstonia eutropha jmp134 at 2.10 a resolution 0.9693 1 351
3owo-assembly2.cif.gz_D structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 with and without nad cofactor 0.9541 5 345
2bi4-assembly1.cif.gz_A lactaldehyde:1,2-propanediol oxidoreductase of escherichia coli 0.9418 4 345
3hl0-assembly1.cif.gz_B crystal structure of maleylacetate reductase from agrobacterium tumefaciens 0.9394 1 350
ID Description Score Start End Superfamily
3hl0B02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9753 164 350 1.20.1090.10
3hl0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9653 2 159 3.40.50.1970
3hl0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9593 2 159 3.40.50.1970
3hl0B02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9544 164 350 1.20.1090.10
3iv7B02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.9528 164 347 1.20.1090.10
ID Description Score Start End GO Terms
AF-A0A3S1NZM8-F1-model_v4 Iron-containing alcohol dehydrogenase 0.9939 66 226 GO:0004022
GO:0046872
AF-A0A3S1NZM8-F1-model_v4 Iron-containing alcohol dehydrogenase 0.9878 66 226 GO:0004022
GO:0046872
AF-A0A554GTY1-F1-model_v4 Maleylacetate reductase 0.9851 1 181 GO:0004022
GO:0046872
AF-A0A5E7IV23-F1-model_v4 deleted 0.9772 1 350
AF-A0A2V8M574-F1-model_v4 Maleylacetate reductase 0.9753 85 350 GO:0004022
GO:0018506
GO:0046872

Map