metagRoot

F438383

General Info

Members	Datasets	Scaffolds	Average Seq Length
414	233	391	406

Family's Representative Sequence

Representative Sequence	3300041410\|Ga0439461_0004658\|Ga0439461_0004658_613_1941
Length	442
Sequence	MRSPIRPESGGGGHGWKARLHNEEMTSVSEPAVLLGQALAPSNRVDPYPAYRALREHGPLQIPEISLTVLTSFADCDAAIRHPASSSDRMKSAIAQRQIAAGEEPRPFGLAGLVDKRRTPAFLFLDPPDHTRLRKLVAKAFAPRVINELRNEIVATVDGLLDTAEERGEFDAVSGLAYPVAVAVICRLLGVPVEDEPKFGHASTLLAQTVDPFLTATGDVPEGFTDRIEAGKWLRKYFRELISRRRSSPGDDLISAMIAVEESGDQLSEDEIISTCNLLLIAGHESTVSLMATSVLAMLRDRTQWTALGADPSRALRVIEETLRFDPPAQLLGRVAAQEMKLGDTVIPEGDTMIVLLAAAHRDPAANENPDVFDPDRANIRHLGFGHGAHFCLGAPLVRLEASIALSAVTRRFPHAQLGGDPRYKPNVTLRGMLSLPVSVSG

Samples

	Sample ID	Description	Type	Environment
1	2508501039	Frankia saprophytica CN3	Isolate	Nodule
2	2551306166	Nocardia tenerifensis NBRC 101015	Isolate	Rhizosphere
3	2558860112	Pseudonocardia acaciae DSM 45401	Isolate	Unclassified
4	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
5	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
6	2675903060	Nonomuraea wenchangensis CGMCC 4.5598	Isolate	Rhizosphere
7	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
8	2738541274	Mycobacterium sp. YR708	Isolate	Unclassified
9	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
10	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
11	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
12	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
13	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
14	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
15	2867302475	Micromonospora globbae WPS1-2	Isolate	Unclassified
16	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
17	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
18	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
19	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
20	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
21	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
22	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
23	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
24	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
25	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
26	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
27	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
28	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
29	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
30	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
31	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
32	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
33	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
36	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
37	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
38	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
39	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
40	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
41	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
42	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
43	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
44	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
45	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
46	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
47	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
48	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
49	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
50	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
51	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
52	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
53	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
54	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
55	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
56	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
57	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
58	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
59	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
60	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
61	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
62	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
63	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
64	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
66	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
68	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
69	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
70	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
71	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
72	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
73	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
74	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
75	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
76	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
77	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
78	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
79	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
80	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
81	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
82	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
83	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
84	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
85	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
86	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
87	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
88	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
115	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
119	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
120	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
121	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
122	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
123	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
124	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
125	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
126	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
127	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
128	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
129	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
130	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
131	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
132	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
133	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
134	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
135	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
136	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
137	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
138	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
139	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
140	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
141	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
142	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
143	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
144	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
145	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
146	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
147	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
148	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
149	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
150	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
151	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
152	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
153	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
154	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
155	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
156	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
157	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
158	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
159	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
160	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
161	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
162	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
163	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
164	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
165	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
166	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
167	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
168	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
169	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
170	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
171	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
172	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
173	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
174	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
175	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
176	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
177	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
178	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
179	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
180	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
181	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
182	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
183	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
184	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
185	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
186	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
187	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
188	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
189	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
190	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
191	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
192	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
193	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
194	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
195	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
196	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
197	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
198	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
199	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
200	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
201	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
202	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
203	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
204	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
205	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
206	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
207	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
208	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
210	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
211	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
212	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
213	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
214	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
215	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
216	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
217	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
218	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
219	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
220	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
221	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
222	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
223	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
224	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
225	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
226	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
227	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
228	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
229	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
230	3300059509	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
231	3300059654	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
232	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
233	8002775197	Frankia nepalensis CN7	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	91.79
Metatranscriptomes	2.66
Isolates	5.56

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.11
Nodule	0.72
Rhizoplane	10.39
Rhizosphere	63.77
Stem	0
Stem Tuber	0
Unclassified	14.01

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0055540_1000127	3300003792	Bacteria	77764
2	Ga0055540_1001599	3300003792	Bacteria	13206
3	Ga0055540_1002005	3300003792	Bacteria	11355
4	Ga0055540_1003957	3300003792	Bacteria	6914
5	Ga0070658_10000387	3300005327	Bacteria	38330
6	Ga0070658_10000889	3300005327	Bacteria	25567
7	Ga0070683_100038322	3300005329	Bacteria	4393
8	Ga0070666_10037735	3300005335	Bacteria	3214
9	Ga0070680_100021640	3300005336	Bacteria	5113
10	Ga0070680_100061754	3300005336	Bacteria	3068
11	Ga0070660_100103301	3300005339	Bacteria	2260
12	Ga0070668_100016137	3300005347	Bacteria	5589
13	Ga0070669_100026754	3300005353	Bacteria	4150
14	Ga0070674_100018676	3300005356	Bacteria	4390
15	Ga0070667_100000312	3300005367	Bacteria	54191
16	Ga0070667_100000389	3300005367	Bacteria	47514
17	Ga0070667_100005397	3300005367	Bacteria	10679
18	Ga0070667_100072914	3300005367	Bacteria	2927
19	Ga0070667_100280485	3300005367	Bacteria	1496
20	Ga0070710_10061711	3300005437	Bacteria	2136
21	Ga0070710_10066109	3300005437	Bacteria	2073
22	Ga0070711_100093680	3300005439	Bacteria	2170
23	Ga0070708_100025758	3300005445	Bacteria	5030
24	Ga0070681_10001795	3300005458	Bacteria	19278
25	Ga0070681_10008190	3300005458	Bacteria	10231
26	Ga0070681_10113088	3300005458	Bacteria	2655
27	Ga0070706_100001746	3300005467	Bacteria	22559
28	Ga0070707_100016484	3300005468	Bacteria	6933
29	Ga0070707_100267430	3300005468	Bacteria	1663
30	Ga0070698_100004096	3300005471	Bacteria	16013
31	Ga0070698_100005458	3300005471	Bacteria	13889
32	Ga0070698_100027178	3300005471	Bacteria	5952
33	Ga0070699_100078971	3300005518	Bacteria	2866
34	Ga0070699_100129162	3300005518	Unclassified	2227
35	Ga0070679_100002689	3300005530	Bacteria	16194
36	Ga0070679_100015574	3300005530	Bacteria	7307
37	Ga0070679_100096522	3300005530	Bacteria	2943
38	Ga0068853_100025692	3300005539	Bacteria	4943
39	Ga0070665_100043474	3300005548	Bacteria	4515
40	Ga0068855_100110380	3300005563	Bacteria	3158
41	Ga0070664_100085298	3300005564	Bacteria	2727
42	Ga0068856_100034196	3300005614	Bacteria	4978
43	Ga0068863_100005158	3300005841	Bacteria	12888
44	Ga0068858_100003994	3300005842	Bacteria	14553
45	Ga0068860_100000190	3300005843	Bacteria	97582
46	Ga0068862_100000791	3300005844	Bacteria	31357
47	Ga0081455_10001171	3300005937	Bacteria	32831
48	Ga0081455_10013771	3300005937	Bacteria	7960
49	Ga0081455_10016500	3300005937	Bacteria	7127
50	Ga0081455_10051388	3300005937	Bacteria	3536
51	Ga0081538_10001589	3300005981	Bacteria	23307
52	Ga0081538_10003218	3300005981	Bacteria	15517
53	Ga0081538_10058765	3300005981	Bacteria	2227
54	Ga0070717_10001853	3300006028	Bacteria	14767
55	Ga0070717_10121032	3300006028	Unclassified	2242
56	Ga0075365_10010877	3300006038	Bacteria	5326
57	Ga0075365_10095185	3300006038	Bacteria	2033
58	Ga0075363_100000122	3300006048	Bacteria	18266
59	Ga0075364_10000809	3300006051	Bacteria	16496
60	Ga0075364_10019460	3300006051	Bacteria	4261
61	Ga0075364_10021056	3300006051	Bacteria	4107
62	Ga0075364_10152204	3300006051	Bacteria	1559
63	Ga0075369_10002826	3300006186	Bacteria	6247
64	Ga0075369_10018973	3300006186	Bacteria	2804
65	Ga0075369_10038076	3300006186	Bacteria	2051
66	Ga0075370_10000565	3300006353	Bacteria	14196
67	Ga0075370_10053787	3300006353	Bacteria	2285
68	Ga0075370_10059793	3300006353	Bacteria	2169
69	Ga0075370_10063145	3300006353	Bacteria	2111
70	Ga0075428_100016311	3300006844	Bacteria	8210
71	Ga0075430_100065710	3300006846	Bacteria	3047
72	Ga0075431_100098853	3300006847	Bacteria	3012
73	Ga0075433_10068699	3300006852	Bacteria	3111
74	Ga0075434_100077468	3300006871	Bacteria	3320
75	Ga0075434_100200512	3300006871	Bacteria	2015
76	Ga0075435_100150060	3300007076	Bacteria	1959
77	Ga0105250_10032268	3300009092	Bacteria	2103
78	Ga0111539_10000608	3300009094	Bacteria	46341
79	Ga0105247_10000046	3300009101	Bacteria	151843
80	Ga0105247_10130916	3300009101	Bacteria	1635
81	Ga0114129_10129565	3300009147	Bacteria	3467
82	Ga0114129_10231701	3300009147	Bacteria	2487
83	Ga0105243_10038800	3300009148	Bacteria	3710
84	Ga0105242_10144456	3300009176	Bacteria	2068
85	Ga0105248_10001720	3300009177	Bacteria	24333
86	Ga0105248_10041820	3300009177	Bacteria	5139
87	Ga0105237_10004959	3300009545	Bacteria	15197
88	Ga0105237_10026672	3300009545	Bacteria	5904
89	Ga0105238_10045926	3300009551	Bacteria	4411
90	Ga0105249_10000333	3300009553	Bacteria	47704
91	Ga0105249_10296643	3300009553	Bacteria	1620
92	Ga0105239_10006617	3300010375	Bacteria	13417
93	Ga0105239_10041941	3300010375	Bacteria	5014
94	Ga0105239_10198455	3300010375	Bacteria	2248
95	Ga0157369_10290653	3300013105	Bacteria	1701
96	Ga0163162_10029018	3300013306	Bacteria	5475
97	Ga0163162_10167688	3300013306	Bacteria	2320
98	Ga0163162_10247813	3300013306	Bacteria	1913
99	Ga0157372_10268301	3300013307	Bacteria	1983
100	Ga0163163_10128551	3300014325	Bacteria	2572
101	Ga0157380_10168317	3300014326	Bacteria	1912
102	Ga0197907_11206539	3300020069	Bacteria	2470
103	Ga0206356_10029485	3300020070	Bacteria	1749
104	Ga0206356_10342573	3300020070	Bacteria	3679
105	Ga0206349_1147441	3300020075	Bacteria	1642
106	Ga0206351_10032121	3300020077	Bacteria	1336
107	Ga0206354_10223644	3300020081	Bacteria	11451
108	Ga0206354_11268747	3300020081	Bacteria	4468
109	Ga0206353_10617730	3300020082	Bacteria	25573
110	Ga0206353_10716727	3300020082	Bacteria	20969
111	Ga0213876_10001749	3300021384	Bacteria	13180
112	Ga0213876_10044381	3300021384	Bacteria	2349
113	Ga0213875_10012539	3300021388	Bacteria	4183
114	Ga0209051_1000014	3300025303	Bacteria	552732
115	Ga0209051_1000292	3300025303	Bacteria	80255
116	Ga0209051_1001531	3300025303	Bacteria	19251
117	Ga0209051_1006099	3300025303	Bacteria	6865
118	Ga0209051_1033408	3300025303	Bacteria	1946
119	Ga0207692_10038946	3300025898	Bacteria	2335
120	Ga0207692_10061904	3300025898	Bacteria	1941
121	Ga0207710_10000071	3300025900	Bacteria	151859
122	Ga0207680_10014516	3300025903	Bacteria	4081
123	Ga0207699_10129780	3300025906	Bacteria	1642
124	Ga0207705_10003007	3300025909	Bacteria	12865
125	Ga0207705_10032485	3300025909	Bacteria	3730
126	Ga0207684_10011042	3300025910	Bacteria	7911
127	Ga0207707_10001330	3300025912	Bacteria	22986
128	Ga0207707_10003033	3300025912	Bacteria	14929
129	Ga0207671_10014228	3300025914	Bacteria	6297
130	Ga0207671_10070987	3300025914	Bacteria	2597
131	Ga0207693_10005333	3300025915	Bacteria	10740
132	Ga0207663_10064326	3300025916	Bacteria	2340
133	Ga0207663_10179714	3300025916	Bacteria	1510
134	Ga0207660_10005146	3300025917	Bacteria	8505
135	Ga0207660_10026285	3300025917	Bacteria	3963
136	Ga0207649_10119569	3300025920	Bacteria	1774
137	Ga0207652_10001367	3300025921	Bacteria	21685
138	Ga0207652_10002000	3300025921	Bacteria	17611
139	Ga0207652_10011709	3300025921	Bacteria	7078
140	Ga0207646_10003678	3300025922	Bacteria	17125
141	Ga0207664_10040636	3300025929	Bacteria	3619
142	Ga0207664_10131779	3300025929	Bacteria	2105
143	Ga0207669_10154899	3300025937	Bacteria	1610
144	Ga0207711_10000106	3300025941	Bacteria	89143
145	Ga0207661_10096851	3300025944	Bacteria	2469
146	Ga0207712_10000289	3300025961	Bacteria	47458
147	Ga0207712_10145944	3300025961	Bacteria	1821
148	Ga0207668_10003860	3300025972	Bacteria	8830
149	Ga0207658_10000272	3300025986	Bacteria	54201
150	Ga0207658_10003748	3300025986	Bacteria	10703
151	Ga0207658_10017628	3300025986	Bacteria	4924
152	Ga0207658_10118602	3300025986	Bacteria	2105
153	Ga0207658_10180615	3300025986	Bacteria	1746
154	Ga0207703_10030178	3300026035	Bacteria	4283
155	Ga0207639_10021078	3300026041	Bacteria	4676
156	Ga0207641_10001289	3300026088	Bacteria	24912
157	Ga0207674_10063321	3300026116	Bacteria	3733
158	Ga0207698_10024893	3300026142	Bacteria	4207
159	Ga0207428_10003092	3300027907	Bacteria	16366
160	Ga0268266_10054018	3300028379	Bacteria	3452
161	Ga0268265_10000012	3300028380	Bacteria	343132
162	Ga0268265_10123368	3300028380	Bacteria	2139
163	Ga0268264_10000223	3300028381	Bacteria	110442
164	Ga0268264_10108088	3300028381	Bacteria	2431
165	Ga0265327_10001930	3300031251	Bacteria	23961
166	Ga0316576_10068610	3300031727	Bacteria	2613
167	Ga0307410_10073118	3300031852	Bacteria	2383
168	Ga0307406_10012419	3300031901	Bacteria	4858
169	Ga0307409_100004560	3300031995	Bacteria	7811
170	Ga0307409_100061210	3300031995	Bacteria	2941
171	Ga0307411_10136269	3300032005	Bacteria	1803
172	Ga0373956_0099355	3300035119	Unclassified	1349
173	Ga0373955_0002121	3300035172	Bacteria	8571
174	Ga0373937_0009908	3300036401	Bacteria	8308
175	Ga0395900_0002025	3300037418	Bacteria	22792
176	Ga0395900_0141221	3300037418	Bacteria	2466
177	Ga0395898_0002370	3300037466	Bacteria	22395
178	Ga0436364_0008660	3300037853	Bacteria	7257
179	Ga0436364_0755214	3300037853	Bacteria	11420
180	Ga0436364_1523495	3300037853	Bacteria	8373
181	Ga0395901_0002050	3300038443	Bacteria	20652
182	Ga0395901_0003499	3300038443	Bacteria	15834
183	Ga0395901_0313884	3300038443	Unclassified	1623
184	Ga0436365_0045146	3300039437	Bacteria	7839
185	Ga0436365_0483403	3300039437	Bacteria	15346
186	Ga0436365_0522719	3300039437	Bacteria	1479
187	Ga0436365_0528815	3300039437	Bacteria	2840
188	Ga0436365_0566691	3300039437	Bacteria	21089
189	Ga0436365_1069106	3300039437	Bacteria	13622
190	Ga0436365_1345306	3300039437	Bacteria	22437
191	Ga0436365_1850420	3300039437	Bacteria	3989
192	Ga0436362_0083984	3300039453	Bacteria	2989
193	Ga0436362_1283067	3300039453	Bacteria	3690
194	Ga0439461_0004658	3300041410	Bacteria	2301
195	Ga0439466_0001196	3300041411	Bacteria	10106
196	Ga0439466_0026249	3300041411	Bacteria	2027
197	Ga0439465_0016672	3300041413	Bacteria	2291
198	Ga0439431_0012703	3300041997	Bacteria	1938
199	Ga0439434_0007046	3300042435	Bacteria	3285
200	Ga0439434_0011960	3300042435	Bacteria	2565
201	Ga0466965_0000269	3300044683	Bacteria	17031
202	Ga0466965_0000685	3300044683	Bacteria	12514
203	Ga0466965_0016948	3300044683	Bacteria	3475
204	Ga0466965_0034553	3300044683	Bacteria	2473
205	Ga0466966_0009627	3300044684	Bacteria	6395
206	Ga0466961_0003580	3300044693	Bacteria	9688
207	Ga0466963_0036062	3300044694	Bacteria	3224
208	Ga0466963_0063922	3300044694	Bacteria	2464
209	Ga0466963_0065888	3300044694	Bacteria	2429
210	Ga0466963_0075333	3300044694	Bacteria	2277
211	Ga0466971_0001420	3300044719	Bacteria	10057
212	Ga0466968_0000928	3300044735	Bacteria	10322
213	Ga0466968_0004826	3300044735	Bacteria	5047
214	Ga0466970_0003014	3300044765	Bacteria	8163
215	Ga0466970_0011701	3300044765	Bacteria	4476
216	Ga0466970_0020769	3300044765	Bacteria	3415
217	Ga0466957_0003065	3300044842	Bacteria	9087
218	Ga0466957_0010030	3300044842	Bacteria	5420
219	Ga0466957_0012395	3300044842	Bacteria	4933
220	Ga0466957_0023912	3300044842	Bacteria	3615
221	Ga0466957_0041391	3300044842	Bacteria	2786
222	Ga0466960_0000317	3300044901	Bacteria	16516
223	Ga0466960_0000385	3300044901	Bacteria	15116
224	Ga0466960_0017588	3300044901	Bacteria	3119
225	Ga0466959_0001288	3300045049	Bacteria	15176
226	Ga0466959_0029525	3300045049	Bacteria	4062
227	Ga0466959_0153146	3300045049	Bacteria	1624
228	Ga0466967_0002876	3300045976	Bacteria	10953
229	Ga0466967_0003443	3300045976	Bacteria	10325
230	Ga0466967_0014438	3300045976	Bacteria	6153
231	Ga0466967_0048896	3300045976	Bacteria	3696
232	Ga0466967_0073701	3300045976	Bacteria	3064
233	Ga0466967_0232777	3300045976	Bacteria	1755
234	Ga0466967_0397248	3300045976	Bacteria	1341
235	Ga0495638_0005542	3300046460	Bacteria	9359
236	Ga0495638_0006320	3300046460	Bacteria	8635
237	Ga0495641_0103496	3300046461	Bacteria	1270
238	Ga0495648_0004470	3300046524	Bacteria	11940
239	Ga0495645_0004342	3300046543	Bacteria	9685
240	Ga0495668_0022486	3300046616	Bacteria	3604
241	Ga0495624_0077675	3300046690	Bacteria	2059
242	Ga0495649_0038314	3300046694	Bacteria	2631
243	Ga0495674_0089680	3300047319	Bacteria	2628
244	Ga0495672_0008696	3300047320	Bacteria	7451
245	Ga0495673_0001252	3300047469	Bacteria	20962
246	Ga0495686_0006819	3300047472	Bacteria	8668
247	Ga0495593_0015157	3300047673	Bacteria	4375
248	Ga0496100_0000039	3300048903	Bacteria	93702
249	Ga0496100_0000518	3300048903	Bacteria	18456
250	Ga0496100_0001158	3300048903	Bacteria	12821
251	Ga0496100_0018740	3300048903	Bacteria	4113
252	Ga0496100_0096550	3300048903	Bacteria	2028
253	Ga0496101_0000043	3300048904	Bacteria	161643
254	Ga0496101_0000319	3300048904	Bacteria	33249
255	Ga0496101_0007290	3300048904	Bacteria	7156
256	Ga0496101_0015251	3300048904	Bacteria	5173
257	Ga0496102_0000026	3300048905	Bacteria	227176
258	Ga0496102_0001182	3300048905	Bacteria	23751
259	Ga0496102_0007350	3300048905	Bacteria	9410
260	Ga0496102_0053715	3300048905	Bacteria	3672
261	Ga0496103_0000023	3300048906	Bacteria	227174
262	Ga0496103_0001400	3300048906	Bacteria	16221
263	Ga0496103_0001781	3300048906	Bacteria	14052
264	Ga0496104_0008283	3300048907	Bacteria	9232
265	Ga0496104_0036639	3300048907	Bacteria	4586
266	Ga0496105_0010680	3300048908	Bacteria	7224
267	Ga0496106_0001390	3300048909	Bacteria	18159
268	Ga0496106_0002723	3300048909	Bacteria	13097
269	Ga0496106_0026451	3300048909	Bacteria	4321
270	Ga0496107_0004780	3300048910	Bacteria	9202
271	Ga0496107_0050934	3300048910	Bacteria	2985
272	Ga0496108_0001472	3300048911	Bacteria	18588
273	Ga0496109_0000145	3300048912	Bacteria	70505
274	Ga0496109_0061366	3300048912	Bacteria	3437
275	Ga0496110_0020751	3300048913	Bacteria	5548
276	Ga0496110_0105635	3300048913	Bacteria	2527
277	Ga0496110_0159521	3300048913	Bacteria	2044
278	Ga0496111_0000273	3300048914	Bacteria	25076
279	Ga0496111_0033470	3300048914	Bacteria	3666
280	Ga0496112_0026070	3300048915	Bacteria	5620
281	Ga0496112_0038632	3300048915	Bacteria	4662
282	Ga0496112_0039728	3300048915	Bacteria	4599
283	Ga0496113_0014842	3300048916	Bacteria	5331
284	Ga0496114_0000114	3300048917	Bacteria	58128
285	Ga0496114_0000219	3300048917	Bacteria	41685
286	Ga0496114_0116184	3300048917	Bacteria	2297
287	Ga0496114_0141202	3300048917	Bacteria	2085
288	Ga0496115_0025646	3300048918	Bacteria	4592
289	Ga0496115_0027034	3300048918	Bacteria	4484
290	Ga0496115_0051030	3300048918	Bacteria	3316
291	Ga0496116_0000018	3300048919	Bacteria	545877
292	Ga0496116_0009239	3300048919	Bacteria	8435
293	Ga0496116_0027546	3300048919	Bacteria	4136
294	Ga0496117_0000015	3300048920	Bacteria	583316
295	Ga0496117_0002354	3300048920	Bacteria	24156
296	Ga0496118_0000012	3300048921	Bacteria	583316
297	Ga0496118_0002881	3300048921	Bacteria	22429
298	Ga0496118_0003906	3300048921	Bacteria	18249
299	Ga0496118_0033640	3300048921	Bacteria	4201
300	Ga0496119_0010103	3300048922	Bacteria	7976
301	Ga0496119_0019133	3300048922	Bacteria	5060
302	Ga0496119_0080623	3300048922	Bacteria	1876
303	Ga0496119_0094601	3300048922	Bacteria	1690
304	Ga0496120_0020922	3300048923	Bacteria	4144
305	Ga0496121_0000002	3300048924	Bacteria	1494588
306	Ga0496121_0000062	3300048924	Bacteria	274819
307	Ga0496121_0013799	3300048924	Bacteria	8647
308	Ga0496122_0001790	3300048925	Bacteria	32891
309	Ga0496122_0038512	3300048925	Bacteria	3829
310	Ga0496123_0017312	3300048926	Bacteria	5806
311	Ga0496123_0022653	3300048926	Bacteria	4833
312	Ga0496124_0000002	3300048927	Bacteria	1494588
313	Ga0496125_0000002	3300048928	Bacteria	1480920
314	Ga0496126_0000009	3300048929	Bacteria	750350
315	Ga0496126_0003993	3300048929	Bacteria	18021
316	Ga0496126_0005439	3300048929	Bacteria	14523
317	Ga0496126_0005673	3300048929	Bacteria	14165
318	Ga0496126_0009506	3300048929	Bacteria	10316
319	Ga0496126_0011753	3300048929	Bacteria	9017
320	Ga0496126_0065677	3300048929	Bacteria	3246
321	Ga0501032_0102516	3300049569	Bacteria	1896
322	Ga0501033_0028151	3300049570	Bacteria	4224
323	Ga0501033_0034309	3300049570	Bacteria	3807
324	Ga0501034_0000196	3300049571	Bacteria	114161
325	Ga0501034_0081225	3300049571	Bacteria	3244
326	Ga0501036_0023011	3300049572	Bacteria	5246
327	Ga0501037_0060294	3300049573	Bacteria	2767
328	Ga0501037_0156483	3300049573	Bacteria	1626
329	Ga0501038_0004421	3300049574	Bacteria	13081
330	Ga0501040_0004208	3300049576	Bacteria	9364
331	Ga0501043_0069568	3300049579	Bacteria	2765
332	Ga0501046_0000357	3300049580	Bacteria	46114
333	Ga0501046_0132648	3300049580	Bacteria	1889
334	Ga0501047_0060850	3300049581	Bacteria	3643
335	Ga0501047_0073693	3300049581	Bacteria	3287
336	Ga0501048_0030689	3300049582	Bacteria	3889
337	Ga0501048_0048494	3300049582	Bacteria	3029
338	Ga0501068_0000238	3300049584	Bacteria	26876
339	Ga0501068_0123803	3300049584	Bacteria	1614
340	Ga0501069_0001003	3300049585	Bacteria	13443
341	Ga0501069_0037906	3300049585	Bacteria	2660
342	Ga0501070_0021308	3300049586	Bacteria	5438
343	Ga0501071_0006463	3300049587	Bacteria	7605
344	Ga0501073_0004825	3300049589	Bacteria	10122
345	Ga0501074_0000511	3300049590	Bacteria	23803
346	Ga0501074_0002623	3300049590	Bacteria	12587
347	Ga0501075_0003532	3300049591	Bacteria	10459
348	Ga0501080_0001877	3300049742	Bacteria	18075
349	Ga0501081_0066200	3300049743	Bacteria	2512
350	Ga0501035_0001773	3300049822	Bacteria	21785
351	Ga0501035_0003349	3300049822	Bacteria	15363
352	Ga0501044_0001429	3300049823	Bacteria	28049
353	Ga0501044_0002085	3300049823	Bacteria	23017
354	Ga0501044_0014046	3300049823	Bacteria	8647
355	Ga0501044_0118972	3300049823	Bacteria	2644
356	nmdc:mga03n38_630_c1	3300050490	Bacteria	9040
357	nmdc:mga00v17_27881_c1	3300050491	Bacteria	3301
358	nmdc:mga00v17_27933_c1	3300050491	Bacteria	3299
359	nmdc:mga00v17_4726_c1	3300050491	Bacteria	7119
360	nmdc:mga00v17_62832_c1	3300050491	Bacteria	2286
361	nmdc:mga0yw44_206093_c1	3300050492	Bacteria	1300
362	nmdc:mga0yw44_56209_c1	3300050492	Bacteria	2396
363	nmdc:mga07m45_103510_c1	3300050496	Bacteria	1636
364	nmdc:mga05p37_137183_c1	3300050507	Bacteria	2999
365	nmdc:mga05p37_22322_c1	3300050507	Bacteria	7675
366	nmdc:mga0qj67_73058_c1	3300050509	Bacteria	2739
367	nmdc:mga08y16_5938_c1	3300050511	Bacteria	12800
368	nmdc:mga0n895_95973_c1	3300050512	Bacteria	2970
369	nmdc:mga0rr50_222362_c1	3300050513	Bacteria	1559
370	nmdc:mga0a205_222456_c1	3300050515	Bacteria	1773
371	nmdc:mga0a205_61269_c1	3300050515	Bacteria	3634
372	nmdc:mga0sz30_12256_c1	3300050516	Bacteria	3332
373	nmdc:mga0sz30_14177_c1	3300050516	Bacteria	3133
374	nmdc:mga0sz30_22505_c1	3300050516	Bacteria	2558
375	nmdc:mga0sz30_28446_c1	3300050516	Bacteria	2301
376	Ga0500610_0044027	3300053079	Bacteria	2314
377	Ga0500635_0000700	3300053080	Bacteria	8499
378	Ga0500643_002620	3300053087	Bacteria	9109
379	Ga0500643_027927	3300053087	Bacteria	1748
380	Ga0500556_0017042	3300053104	Bacteria	2270
381	Ga0500652_000651	3300053131	Bacteria	11825
382	Ga0500652_004272	3300053131	Bacteria	4409
383	Ga0500559_0007000	3300053136	Bacteria	5040
384	Ga0500616_0003593	3300053153	Bacteria	11690
385	Ga0500616_0015655	3300053153	Bacteria	4330
386	Ga0500645_000004	3300053730	Bacteria	305014
387	Ga0501084_0000919	3300054114	Bacteria	22744
388	Ga0587089_003751	3300059509	Bacteria	1642
389	Ga0587110_000488	3300059654	Bacteria	2361
390	Ga0501082_0009732	3300060353	Bacteria	8281
391	Ga0501082_0050160	3300060353	Bacteria	3599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300035119	Ga0373956_0099355	Ga0373956_0099355_14_997	317
2	3300035172	Ga0373955_0002121	Ga0373955_0002121_1068_2075	324
3	3300036401	Ga0373937_0009908	Ga0373937_0009908_6297_7304	324
4	3300038443	Ga0395901_0313884	Ga0395901_0313884_272_1279	324
5	3300048913	Ga0496110_0020751	Ga0496110_0020751_1587_2603	325
6	3300048914	Ga0496111_0000273	Ga0496111_0000273_12187_13203	325
7	3300049580	Ga0501046_0132648	Ga0501046_0132648_862_1866	332
8	3300046461	Ga0495641_0103496	Ga0495641_0103496_240_1253	335
9	3300049823	Ga0501044_0118972	Ga0501044_0118972_1601_2617	336
10	3300005981	Ga0081538_10001589	Ga0081538_100015894	340
11	3300039453	Ga0436362_1283067	Ga0436362_1283067_1975_3210	342
12	iso_pu_bacteria	2675903060	2676493782	342
13	3300044842	Ga0466957_0003065	Ga0466957_0003065_3841_5076	345
14	3300005981	Ga0081538_10003218	Ga0081538_100032188	348
15	3300031727	Ga0316576_10068610	Ga0316576_100686102	352
16	3300005471	Ga0070698_100005458	Ga0070698_10000545812	353
17	3300005518	Ga0070699_100078971	Ga0070699_1000789711	353
18	3300050513	nmdc:mga0rr50_222362_c1	nmdc:mga0rr50_222362_c1_65_1219	354
19	3300020069	Ga0197907_11206539	Ga0197907_112065393	358
20	3300048913	Ga0496110_0105635	Ga0496110_0105635_977_2215	360
21	3300005445	Ga0070708_100025758	Ga0070708_1000257581	362
22	3300005467	Ga0070706_100001746	Ga0070706_10000174617	362
23	3300005468	Ga0070707_100016484	Ga0070707_1000164843	362
24	3300005471	Ga0070698_100027178	Ga0070698_1000271783	362
25	3300005518	Ga0070699_100129162	Ga0070699_1001291622	362
26	3300006028	Ga0070717_10001853	Ga0070717_100018533	362
27	3300025910	Ga0207684_10011042	Ga0207684_100110423	362
28	3300025922	Ga0207646_10003678	Ga0207646_100036788	362
29	3300039437	Ga0436365_0528815	Ga0436365_0528815_894_2132	365
30	3300039453	Ga0436362_0083984	Ga0436362_0083984_925_2163	365
31	3300039437	Ga0436365_0045146	Ga0436365_0045146_2520_3779	366
32	3300005367	Ga0070667_100005397	Ga0070667_1000053975	371
33	3300025986	Ga0207658_10017628	Ga0207658_100176285	371
34	3300053153	Ga0500616_0003593	Ga0500616_0003593_4527_5750	371
35	3300060353	Ga0501082_0009732	Ga0501082_0009732_3582_4814	371
36	iso_pu_bacteria	2867302475	2867307300	372
37	iso_pu_bacteria	2551306166	2552106354	373
38	3300006038	Ga0075365_10095185	Ga0075365_100951852	375
39	3300048913	Ga0496110_0159521	Ga0496110_0159521_456_1673	375
40	3300048914	Ga0496111_0033470	Ga0496111_0033470_2056_3273	375
41	3300049570	Ga0501033_0034309	Ga0501033_0034309_1111_2295	375
42	3300049581	Ga0501047_0060850	Ga0501047_0060850_1885_3069	375
43	3300049823	Ga0501044_0014046	Ga0501044_0014046_845_2029	375
44	3300050492	nmdc:mga0yw44_206093_c1	nmdc:mga0yw44_206093_c1_34_1233	375
45	3300050492	nmdc:mga0yw44_56209_c1	nmdc:mga0yw44_56209_c1_903_2087	375
46	3300053153	Ga0500616_0015655	Ga0500616_0015655_1529_2752	375
47	3300005367	Ga0070667_100072914	Ga0070667_1000729142	377
48	3300006353	Ga0075370_10063145	Ga0075370_100631452	377
49	3300009101	Ga0105247_10130916	Ga0105247_101309162	377
50	3300025986	Ga0207658_10118602	Ga0207658_101186022	377
51	3300048912	Ga0496109_0061366	Ga0496109_0061366_2182_3405	377
52	3300048915	Ga0496112_0026070	Ga0496112_0026070_4301_5524	377
53	3300050496	nmdc:mga07m45_103510_c1	nmdc:mga07m45_103510_c1_272_1495	377
54	iso_pu_bacteria	2508501039	2508678555	377
55	iso_pu_bacteria	8002775197	8002778758	377
56	3300041413	Ga0439465_0016672	Ga0439465_0016672_881_2149	378
57	3300042435	Ga0439434_0007046	Ga0439434_0007046_1345_2613	378
58	3300049572	Ga0501036_0023011	Ga0501036_0023011_3950_5173	378
59	3300049574	Ga0501038_0004421	Ga0501038_0004421_457_1680	378
60	3300049576	Ga0501040_0004208	Ga0501040_0004208_7320_8543	378
61	3300049582	Ga0501048_0048494	Ga0501048_0048494_1166_2389	378
62	3300049587	Ga0501071_0006463	Ga0501071_0006463_5460_6683	378
63	3300049590	Ga0501074_0000511	Ga0501074_0000511_18393_19616	378
64	3300049591	Ga0501075_0003532	Ga0501075_0003532_457_1680	378
65	3300049743	Ga0501081_0066200	Ga0501081_0066200_659_1882	378
66	3300054114	Ga0501084_0000919	Ga0501084_0000919_5338_6561	378
67	3300060353	Ga0501082_0050160	Ga0501082_0050160_2258_3481	378
68	3300013306	Ga0163162_10029018	Ga0163162_100290185	379
69	iso_pu_bacteria	2558860112	2558906188	379
70	3300005329	Ga0070683_100038322	Ga0070683_1000383222	380
71	3300005564	Ga0070664_100085298	Ga0070664_1000852983	380
72	3300005614	Ga0068856_100034196	Ga0068856_1000341966	380
73	3300009551	Ga0105238_10045926	Ga0105238_100459262	380
74	3300010375	Ga0105239_10198455	Ga0105239_101984552	380
75	3300013105	Ga0157369_10290653	Ga0157369_102906532	380
76	3300013307	Ga0157372_10268301	Ga0157372_102683012	380
77	3300025920	Ga0207649_10119569	Ga0207649_101195692	380
78	3300025944	Ga0207661_10096851	Ga0207661_100968512	380
79	3300026142	Ga0207698_10024893	Ga0207698_100248933	380
80	3300031852	Ga0307410_10073118	Ga0307410_100731182	380
81	3300031995	Ga0307409_100004560	Ga0307409_1000045602	380
82	3300032005	Ga0307411_10136269	Ga0307411_101362692	380
83	3300037418	Ga0395900_0002025	Ga0395900_0002025_13135_14376	380
84	3300038443	Ga0395901_0002050	Ga0395901_0002050_6251_7492	380
85	3300045976	Ga0466967_0232777	Ga0466967_0232777_375_1598	380
86	3300046694	Ga0495649_0038314	Ga0495649_0038314_638_1861	380
87	3300005439	Ga0070711_100093680	Ga0070711_1000936802	381
88	3300006844	Ga0075428_100016311	Ga0075428_1000163112	381
89	3300009147	Ga0114129_10129565	Ga0114129_101295653	381
90	3300025916	Ga0207663_10064326	Ga0207663_100643262	381
91	3300028380	Ga0268265_10123368	Ga0268265_101233682	381
92	3300048907	Ga0496104_0008283	Ga0496104_0008283_7613_8833	381
93	3300048917	Ga0496114_0141202	Ga0496114_0141202_566_1786	381
94	3300048918	Ga0496115_0027034	Ga0496115_0027034_1606_2826	381
95	3300049585	Ga0501069_0001003	Ga0501069_0001003_830_2053	381
96	3300050507	nmdc:mga05p37_22322_c1	nmdc:mga05p37_22322_c1_465_1688	381
97	3300050516	nmdc:mga0sz30_14177_c1	nmdc:mga0sz30_14177_c1_1088_2311	381
98	iso_pu_bacteria	2808606384	2808970469	381
99	iso_pu_bacteria	2808606390	2809005424	381
100	iso_pu_bacteria	2808606391	2809012175	381
101	3300005367	Ga0070667_100280485	Ga0070667_1002804851	382
102	3300005437	Ga0070710_10061711	Ga0070710_100617112	382
103	3300005468	Ga0070707_100267430	Ga0070707_1002674302	382
104	3300005563	Ga0068855_100110380	Ga0068855_1001103802	382
105	3300005937	Ga0081455_10001171	Ga0081455_100011714	382
106	3300006028	Ga0070717_10121032	Ga0070717_101210322	382
107	3300006353	Ga0075370_10059793	Ga0075370_100597932	382
108	3300006847	Ga0075431_100098853	Ga0075431_1000988534	382
109	3300006852	Ga0075433_10068699	Ga0075433_100686992	382
110	3300006871	Ga0075434_100077468	Ga0075434_1000774683	382
111	3300006871	Ga0075434_100200512	Ga0075434_1002005122	382
112	3300007076	Ga0075435_100150060	Ga0075435_1001500602	382
113	3300009094	Ga0111539_10000608	Ga0111539_1000060837	382
114	3300009147	Ga0114129_10231701	Ga0114129_102317011	382
115	3300020070	Ga0206356_10029485	Ga0206356_100294852	382
116	3300020075	Ga0206349_1147441	Ga0206349_11474412	382
117	3300025898	Ga0207692_10038946	Ga0207692_100389462	382
118	3300025906	Ga0207699_10129780	Ga0207699_101297801	382
119	3300025915	Ga0207693_10005333	Ga0207693_100053336	382
120	3300025921	Ga0207652_10011709	Ga0207652_100117096	382
121	3300025986	Ga0207658_10180615	Ga0207658_101806152	382
122	3300027907	Ga0207428_10003092	Ga0207428_1000309213	382
123	3300028381	Ga0268264_10108088	Ga0268264_101080883	382
124	3300037418	Ga0395900_0141221	Ga0395900_0141221_549_1835	382
125	3300037466	Ga0395898_0002370	Ga0395898_0002370_15019_16305	382
126	3300038443	Ga0395901_0003499	Ga0395901_0003499_2737_4023	382
127	3300042435	Ga0439434_0011960	Ga0439434_0011960_820_2040	382
128	3300044693	Ga0466961_0003580	Ga0466961_0003580_609_1832	382
129	3300044719	Ga0466971_0001420	Ga0466971_0001420_1515_2738	382
130	3300044842	Ga0466957_0023912	Ga0466957_0023912_2177_3400	382
131	3300048903	Ga0496100_0096550	Ga0496100_0096550_472_1680	382
132	3300049571	Ga0501034_0000196	Ga0501034_0000196_13865_15058	382
133	3300049573	Ga0501037_0156483	Ga0501037_0156483_83_1276	382
134	3300049584	Ga0501068_0000238	Ga0501068_0000238_12822_14015	382
135	3300049589	Ga0501073_0004825	Ga0501073_0004825_5862_7055	382
136	3300049590	Ga0501074_0002623	Ga0501074_0002623_3401_4594	382
137	3300049742	Ga0501080_0001877	Ga0501080_0001877_564_1757	382
138	3300050507	nmdc:mga05p37_137183_c1	nmdc:mga05p37_137183_c1_1093_2379	382
139	3300050511	nmdc:mga08y16_5938_c1	nmdc:mga08y16_5938_c1_6399_7619	382
140	3300050512	nmdc:mga0n895_95973_c1	nmdc:mga0n895_95973_c1_156_1442	382
141	3300050515	nmdc:mga0a205_222456_c1	nmdc:mga0a205_222456_c1_390_1604	382
142	3300050515	nmdc:mga0a205_61269_c1	nmdc:mga0a205_61269_c1_393_1679	382
143	3300050516	nmdc:mga0sz30_12256_c1	nmdc:mga0sz30_12256_c1_480_1706	382
144	3300059509	Ga0587089_003751	Ga0587089_003751_148_1389	382
145	3300059654	Ga0587110_000488	Ga0587110_000488_480_1721	382
146	3300005937	Ga0081455_10016500	Ga0081455_100165002	383
147	3300005981	Ga0081538_10058765	Ga0081538_100587651	383
148	3300031901	Ga0307406_10012419	Ga0307406_100124192	383
149	3300046543	Ga0495645_0004342	Ga0495645_0004342_673_1944	383
150	3300005458	Ga0070681_10113088	Ga0070681_101130883	384
151	3300005471	Ga0070698_100004096	Ga0070698_1000040969	384
152	3300005530	Ga0070679_100096522	Ga0070679_1000965222	384
153	3300026116	Ga0207674_10063321	Ga0207674_100633212	384
154	3300039437	Ga0436365_0483403	Ga0436365_0483403_6884_8101	384
155	3300049584	Ga0501068_0123803	Ga0501068_0123803_103_1335	384
156	3300005327	Ga0070658_10000387	Ga0070658_1000038727	386
157	3300005336	Ga0070680_100061754	Ga0070680_1000617542	386
158	3300005458	Ga0070681_10008190	Ga0070681_100081902	386
159	3300005530	Ga0070679_100002689	Ga0070679_10000268912	386
160	3300020070	Ga0206356_10342573	Ga0206356_103425731	386
161	3300020081	Ga0206354_11268747	Ga0206354_112687475	386
162	3300020082	Ga0206353_10617730	Ga0206353_106177306	386
163	3300025909	Ga0207705_10003007	Ga0207705_100030079	386
164	3300025912	Ga0207707_10003033	Ga0207707_100030339	386
165	3300025917	Ga0207660_10005146	Ga0207660_100051462	386
166	3300025921	Ga0207652_10001367	Ga0207652_1000136712	386
167	3300045976	Ga0466967_0002876	Ga0466967_0002876_2947_4206	386
168	3300005327	Ga0070658_10000889	Ga0070658_100008896	387
169	3300005336	Ga0070680_100021640	Ga0070680_1000216404	387
170	3300005339	Ga0070660_100103301	Ga0070660_1001033012	387
171	3300005458	Ga0070681_10001795	Ga0070681_1000179514	387
172	3300005530	Ga0070679_100015574	Ga0070679_1000155742	387
173	3300006051	Ga0075364_10152204	Ga0075364_101522041	387
174	3300006353	Ga0075370_10000565	Ga0075370_100005653	387
175	3300020077	Ga0206351_10032121	Ga0206351_100321211	387
176	3300020081	Ga0206354_10223644	Ga0206354_102236441	387
177	3300020082	Ga0206353_10716727	Ga0206353_1071672716	387
178	3300025909	Ga0207705_10032485	Ga0207705_100324851	387
179	3300025912	Ga0207707_10001330	Ga0207707_1000133018	387
180	3300025917	Ga0207660_10026285	Ga0207660_100262853	387
181	3300025921	Ga0207652_10002000	Ga0207652_100020004	387
182	3300039437	Ga0436365_1345306	Ga0436365_1345306_5671_6933	387
183	3300050516	nmdc:mga0sz30_22505_c1	nmdc:mga0sz30_22505_c1_703_1974	387
184	3300044683	Ga0466965_0016948	Ga0466965_0016948_496_1737	388
185	3300044735	Ga0466968_0004826	Ga0466968_0004826_569_1810	388
186	3300044765	Ga0466970_0020769	Ga0466970_0020769_1739_2980	388
187	3300044842	Ga0466957_0010030	Ga0466957_0010030_1807_3048	388
188	3300044901	Ga0466960_0000317	Ga0466960_0000317_4775_6016	388
189	3300045976	Ga0466967_0048896	Ga0466967_0048896_297_1538	388
190	iso_pu_bacteria	2738541264	2738663981	388
191	iso_pu_bacteria	2738541356	2739143116	388
192	3300044694	Ga0466963_0036062	Ga0466963_0036062_1397_2665	389
193	3300048929	Ga0496126_0011753	Ga0496126_0011753_1990_3270	389
194	3300006038	Ga0075365_10010877	Ga0075365_100108771	390
195	3300006186	Ga0075369_10018973	Ga0075369_100189731	390
196	3300009148	Ga0105243_10038800	Ga0105243_100388001	390
197	3300044683	Ga0466965_0000685	Ga0466965_0000685_8775_10031	390
198	3300044735	Ga0466968_0000928	Ga0466968_0000928_510_1766	390
199	3300044765	Ga0466970_0003014	Ga0466970_0003014_819_2075	390
200	3300044842	Ga0466957_0041391	Ga0466957_0041391_770_2026	390
201	3300045049	Ga0466959_0029525	Ga0466959_0029525_383_1639	390
202	3300046460	Ga0495638_0006320	Ga0495638_0006320_6609_7832	390
203	3300047320	Ga0495672_0008696	Ga0495672_0008696_575_1795	390
204	3300048915	Ga0496112_0038632	Ga0496112_0038632_2223_3485	390
205	3300048915	Ga0496112_0039728	Ga0496112_0039728_2103_3359	390
206	3300048916	Ga0496113_0014842	Ga0496113_0014842_74_1336	390
207	3300048925	Ga0496122_0038512	Ga0496122_0038512_1571_2857	390
208	3300048926	Ga0496123_0022653	Ga0496123_0022653_2580_3866	390
209	3300048929	Ga0496126_0003993	Ga0496126_0003993_13084_14346	390
210	3300048929	Ga0496126_0005439	Ga0496126_0005439_1466_2722	390
211	3300048929	Ga0496126_0065677	Ga0496126_0065677_1173_2396	390
212	3300053087	Ga0500643_027927	Ga0500643_027927_252_1475	390
213	3300053136	Ga0500559_0007000	Ga0500559_0007000_2613_3836	390
214	3300053730	Ga0500645_000004	Ga0500645_000004_267141_268364	390
215	iso_pu_bacteria	2738541274	2738703290	390
216	iso_pu_bacteria	2738543028	2739329249	390
217	iso_pu_bacteria	2902799365	2902800319	390
218	3300003792	Ga0055540_1001599	Ga0055540_100159915	391
219	3300003792	Ga0055540_1002005	Ga0055540_10020056	391
220	3300003792	Ga0055540_1003957	Ga0055540_10039579	391
221	3300005347	Ga0070668_100016137	Ga0070668_1000161372	391
222	3300005353	Ga0070669_100026754	Ga0070669_1000267541	391
223	3300005356	Ga0070674_100018676	Ga0070674_1000186765	391
224	3300005367	Ga0070667_100000312	Ga0070667_10000031231	391
225	3300005437	Ga0070710_10066109	Ga0070710_100661092	391
226	3300005539	Ga0068853_100025692	Ga0068853_1000256922	391
227	3300005548	Ga0070665_100043474	Ga0070665_1000434742	391
228	3300005841	Ga0068863_100005158	Ga0068863_1000051583	391
229	3300005842	Ga0068858_100003994	Ga0068858_1000039948	391
230	3300005843	Ga0068860_100000190	Ga0068860_10000019091	391
231	3300005844	Ga0068862_100000791	Ga0068862_1000007919	391
232	3300005937	Ga0081455_10013771	Ga0081455_100137717	391
233	3300005937	Ga0081455_10051388	Ga0081455_100513882	391
234	3300006048	Ga0075363_100000122	Ga0075363_10000012210	391
235	3300006051	Ga0075364_10000809	Ga0075364_100008096	391
236	3300006051	Ga0075364_10019460	Ga0075364_100194602	391
237	3300006051	Ga0075364_10021056	Ga0075364_100210562	391
238	3300006186	Ga0075369_10002826	Ga0075369_100028266	391
239	3300006186	Ga0075369_10038076	Ga0075369_100380762	391
240	3300006353	Ga0075370_10053787	Ga0075370_100537872	391
241	3300006846	Ga0075430_100065710	Ga0075430_1000657103	391
242	3300009092	Ga0105250_10032268	Ga0105250_100322682	391
243	3300009101	Ga0105247_10000046	Ga0105247_1000004645	391
244	3300009176	Ga0105242_10144456	Ga0105242_101444562	391
245	3300009177	Ga0105248_10001720	Ga0105248_100017203	391
246	3300009177	Ga0105248_10041820	Ga0105248_100418202	391
247	3300009545	Ga0105237_10004959	Ga0105237_1000495911	391
248	3300009553	Ga0105249_10000333	Ga0105249_1000033339	391
249	3300009553	Ga0105249_10296643	Ga0105249_102966432	391
250	3300010375	Ga0105239_10041941	Ga0105239_100419412	391
251	3300013306	Ga0163162_10167688	Ga0163162_101676882	391
252	3300013306	Ga0163162_10247813	Ga0163162_102478132	391
253	3300014325	Ga0163163_10128551	Ga0163163_101285512	391
254	3300014326	Ga0157380_10168317	Ga0157380_101683172	391
255	3300021384	Ga0213876_10001749	Ga0213876_100017497	391
256	3300021384	Ga0213876_10044381	Ga0213876_100443812	391
257	3300021388	Ga0213875_10012539	Ga0213875_100125394	391
258	3300025303	Ga0209051_1000292	Ga0209051_100029264	391
259	3300025303	Ga0209051_1001531	Ga0209051_10015315	391
260	3300025303	Ga0209051_1006099	Ga0209051_10060992	391
261	3300025303	Ga0209051_1033408	Ga0209051_10334082	391
262	3300025898	Ga0207692_10061904	Ga0207692_100619041	391
263	3300025900	Ga0207710_10000071	Ga0207710_1000007145	391
264	3300025914	Ga0207671_10014228	Ga0207671_100142283	391
265	3300025916	Ga0207663_10179714	Ga0207663_101797141	391
266	3300025929	Ga0207664_10040636	Ga0207664_100406364	391
267	3300025929	Ga0207664_10131779	Ga0207664_101317792	391
268	3300025937	Ga0207669_10154899	Ga0207669_101548991	391
269	3300025941	Ga0207711_10000106	Ga0207711_100001062	391
270	3300025961	Ga0207712_10000289	Ga0207712_100002899	391
271	3300025961	Ga0207712_10145944	Ga0207712_101459442	391
272	3300025972	Ga0207668_10003860	Ga0207668_100038602	391
273	3300025986	Ga0207658_10000272	Ga0207658_1000027225	391
274	3300026035	Ga0207703_10030178	Ga0207703_100301783	391
275	3300026041	Ga0207639_10021078	Ga0207639_100210784	391
276	3300026088	Ga0207641_10001289	Ga0207641_1000128922	391
277	3300028379	Ga0268266_10054018	Ga0268266_100540183	391
278	3300028380	Ga0268265_10000012	Ga0268265_10000012319	391
279	3300028381	Ga0268264_10000223	Ga0268264_1000022325	391
280	3300031995	Ga0307409_100061210	Ga0307409_1000612101	391
281	3300037853	Ga0436364_0008660	Ga0436364_0008660_1999_3231	391
282	3300037853	Ga0436364_0755214	Ga0436364_0755214_7842_9077	391
283	3300037853	Ga0436364_1523495	Ga0436364_1523495_3755_5059	391
284	3300039437	Ga0436365_0522719	Ga0436365_0522719_142_1380	391
285	3300039437	Ga0436365_0566691	Ga0436365_0566691_8578_9813	391
286	3300039437	Ga0436365_1069106	Ga0436365_1069106_1367_2593	391
287	3300039437	Ga0436365_1850420	Ga0436365_1850420_2152_3411	391
288	3300041410	Ga0439461_0004658	Ga0439461_0004658_613_1941	391
289	3300041411	Ga0439466_0001196	Ga0439466_0001196_7626_8849	391
290	3300041411	Ga0439466_0026249	Ga0439466_0026249_510_1733	391
291	3300041997	Ga0439431_0012703	Ga0439431_0012703_587_1810	391
292	3300044683	Ga0466965_0000269	Ga0466965_0000269_15414_16655	391
293	3300044684	Ga0466966_0009627	Ga0466966_0009627_1905_3137	391
294	3300044694	Ga0466963_0063922	Ga0466963_0063922_318_1577	391
295	3300044694	Ga0466963_0065888	Ga0466963_0065888_1087_2319	391
296	3300044694	Ga0466963_0075333	Ga0466963_0075333_46_1251	391
297	3300044765	Ga0466970_0011701	Ga0466970_0011701_328_1560	391
298	3300044842	Ga0466957_0012395	Ga0466957_0012395_2829_4088	391
299	3300044901	Ga0466960_0000385	Ga0466960_0000385_5829_7070	391
300	3300044901	Ga0466960_0017588	Ga0466960_0017588_924_2183	391
301	3300045049	Ga0466959_0001288	Ga0466959_0001288_6869_8101	391
302	3300045049	Ga0466959_0153146	Ga0466959_0153146_155_1369	391
303	3300045976	Ga0466967_0003443	Ga0466967_0003443_1862_3121	391
304	3300045976	Ga0466967_0014438	Ga0466967_0014438_4452_5711	391
305	3300045976	Ga0466967_0397248	Ga0466967_0397248_46_1269	391
306	3300046460	Ga0495638_0005542	Ga0495638_0005542_593_1816	391
307	3300046524	Ga0495648_0004470	Ga0495648_0004470_5419_6642	391
308	3300046616	Ga0495668_0022486	Ga0495668_0022486_954_2177	391
309	3300046690	Ga0495624_0077675	Ga0495624_0077675_781_2004	391
310	3300047319	Ga0495674_0089680	Ga0495674_0089680_427_1650	391
311	3300047469	Ga0495673_0001252	Ga0495673_0001252_8766_9989	391
312	3300047472	Ga0495686_0006819	Ga0495686_0006819_1056_2279	391
313	3300047673	Ga0495593_0015157	Ga0495593_0015157_1496_2719	391
314	3300048903	Ga0496100_0000518	Ga0496100_0000518_9716_10939	391
315	3300048903	Ga0496100_0001158	Ga0496100_0001158_9151_10377	391
316	3300048903	Ga0496100_0018740	Ga0496100_0018740_869_2104	391
317	3300048904	Ga0496101_0000319	Ga0496101_0000319_29507_30733	391
318	3300048904	Ga0496101_0007290	Ga0496101_0007290_4529_5764	391
319	3300048904	Ga0496101_0015251	Ga0496101_0015251_2363_3586	391
320	3300048905	Ga0496102_0000026	Ga0496102_0000026_180044_181270	391
321	3300048905	Ga0496102_0001182	Ga0496102_0001182_21615_22850	391
322	3300048905	Ga0496102_0007350	Ga0496102_0007350_4631_5857	391
323	3300048905	Ga0496102_0053715	Ga0496102_0053715_2362_3585	391
324	3300048906	Ga0496103_0000023	Ga0496103_0000023_45905_47131	391
325	3300048906	Ga0496103_0001400	Ga0496103_0001400_9897_11132	391
326	3300048907	Ga0496104_0036639	Ga0496104_0036639_1435_2658	391
327	3300048908	Ga0496105_0010680	Ga0496105_0010680_3706_4929	391
328	3300048909	Ga0496106_0002723	Ga0496106_0002723_9361_10587	391
329	3300048909	Ga0496106_0026451	Ga0496106_0026451_1686_2909	391
330	3300048910	Ga0496107_0050934	Ga0496107_0050934_1606_2829	391
331	3300048917	Ga0496114_0000114	Ga0496114_0000114_2259_3482	391
332	3300048917	Ga0496114_0116184	Ga0496114_0116184_696_1922	391
333	3300048918	Ga0496115_0051030	Ga0496115_0051030_418_1641	391
334	3300048919	Ga0496116_0000018	Ga0496116_0000018_364608_365834	391
335	3300048919	Ga0496116_0027546	Ga0496116_0027546_2174_3409	391
336	3300048920	Ga0496117_0000015	Ga0496117_0000015_180044_181270	391
337	3300048920	Ga0496117_0002354	Ga0496117_0002354_8404_9639	391
338	3300048921	Ga0496118_0000012	Ga0496118_0000012_180044_181270	391
339	3300048921	Ga0496118_0002881	Ga0496118_0002881_7312_8547	391
340	3300048921	Ga0496118_0003906	Ga0496118_0003906_9342_10568	391
341	3300048922	Ga0496119_0019133	Ga0496119_0019133_3092_4324	391
342	3300048922	Ga0496119_0080623	Ga0496119_0080623_413_1639	391
343	3300048922	Ga0496119_0094601	Ga0496119_0094601_54_1286	391
344	3300048923	Ga0496120_0020922	Ga0496120_0020922_238_1464	391
345	3300048924	Ga0496121_0000062	Ga0496121_0000062_2514_3740	391
346	3300048924	Ga0496121_0013799	Ga0496121_0013799_7312_8547	391
347	3300048929	Ga0496126_0005673	Ga0496126_0005673_2915_4141	391
348	3300048929	Ga0496126_0009506	Ga0496126_0009506_8612_9847	391
349	3300049569	Ga0501032_0102516	Ga0501032_0102516_384_1616	391
350	3300049570	Ga0501033_0028151	Ga0501033_0028151_2735_3967	391
351	3300049571	Ga0501034_0081225	Ga0501034_0081225_543_1775	391
352	3300049573	Ga0501037_0060294	Ga0501037_0060294_852_2111	391
353	3300049579	Ga0501043_0069568	Ga0501043_0069568_406_1629	391
354	3300049580	Ga0501046_0000357	Ga0501046_0000357_40484_41743	391
355	3300049581	Ga0501047_0073693	Ga0501047_0073693_814_2046	391
356	3300049582	Ga0501048_0030689	Ga0501048_0030689_122_1381	391
357	3300049585	Ga0501069_0037906	Ga0501069_0037906_1126_2385	391
358	3300049586	Ga0501070_0021308	Ga0501070_0021308_853_2112	391
359	3300049822	Ga0501035_0001773	Ga0501035_0001773_12695_13927	391
360	3300049822	Ga0501035_0003349	Ga0501035_0003349_8253_9512	391
361	3300049823	Ga0501044_0001429	Ga0501044_0001429_7749_9008	391
362	3300049823	Ga0501044_0002085	Ga0501044_0002085_9061_10293	391
363	3300050490	nmdc:mga03n38_630_c1	nmdc:mga03n38_630_c1_7206_8450	391
364	3300050491	nmdc:mga00v17_27881_c1	nmdc:mga00v17_27881_c1_1897_3153	391
365	3300050491	nmdc:mga00v17_27933_c1	nmdc:mga00v17_27933_c1_337_1563	391
366	3300050491	nmdc:mga00v17_4726_c1	nmdc:mga00v17_4726_c1_893_2092	391
367	3300050491	nmdc:mga00v17_62832_c1	nmdc:mga00v17_62832_c1_405_1649	391
368	3300050509	nmdc:mga0qj67_73058_c1	nmdc:mga0qj67_73058_c1_514_1740	391
369	3300050516	nmdc:mga0sz30_28446_c1	nmdc:mga0sz30_28446_c1_17_1207	391
370	3300053079	Ga0500610_0044027	Ga0500610_0044027_703_1926	391
371	3300053080	Ga0500635_0000700	Ga0500635_0000700_3844_5157	391
372	3300053087	Ga0500643_002620	Ga0500643_002620_5691_6917	391
373	3300053104	Ga0500556_0017042	Ga0500556_0017042_458_1681	391
374	3300053131	Ga0500652_000651	Ga0500652_000651_7132_8361	391
375	3300053131	Ga0500652_004272	Ga0500652_004272_1495_2808	391
376	iso_pu_bacteria	2643221687	2644488436	391
377	iso_pu_bacteria	2643221715	2644634061	391
378	iso_pu_bacteria	2643221715	2644639875	391
379	iso_pu_bacteria	2842134933	2842136239	391
380	iso_pu_bacteria	2902792274	2902795357	391
381	iso_pu_bacteria	2902810491	2902810979	391
382	iso_pu_bacteria	2902810491	2902813062	391
383	iso_pu_bacteria	2902837492	2902842820	391
384	iso_pu_bacteria	2939582691	2939583803	391
385	3300003792	Ga0055540_1000127	Ga0055540_10001273	392
386	3300005335	Ga0070666_10037735	Ga0070666_100377351	392
387	3300005367	Ga0070667_100000389	Ga0070667_10000038929	392
388	3300009545	Ga0105237_10026672	Ga0105237_100266721	392
389	3300010375	Ga0105239_10006617	Ga0105239_100066178	392
390	3300025303	Ga0209051_1000014	Ga0209051_100001467	392
391	3300025903	Ga0207680_10014516	Ga0207680_100145162	392
392	3300025914	Ga0207671_10070987	Ga0207671_100709873	392
393	3300025986	Ga0207658_10003748	Ga0207658_100037486	392
394	3300031251	Ga0265327_10001930	Ga0265327_1000193019	392
395	3300044683	Ga0466965_0034553	Ga0466965_0034553_409_1587	392
396	3300045976	Ga0466967_0073701	Ga0466967_0073701_494_1705	392
397	3300048903	Ga0496100_0000039	Ga0496100_0000039_2160_3371	392
398	3300048904	Ga0496101_0000043	Ga0496101_0000043_135891_137102	392
399	3300048906	Ga0496103_0001781	Ga0496103_0001781_11374_12585	392
400	3300048909	Ga0496106_0001390	Ga0496106_0001390_5487_6698	392
401	3300048910	Ga0496107_0004780	Ga0496107_0004780_3546_4757	392
402	3300048911	Ga0496108_0001472	Ga0496108_0001472_6808_8019	392
403	3300048912	Ga0496109_0000145	Ga0496109_0000145_24527_25738	392
404	3300048917	Ga0496114_0000219	Ga0496114_0000219_24536_25747	392
405	3300048918	Ga0496115_0025646	Ga0496115_0025646_2680_3891	392
406	3300048919	Ga0496116_0009239	Ga0496116_0009239_5335_6546	392
407	3300048921	Ga0496118_0033640	Ga0496118_0033640_1746_2957	392
408	3300048922	Ga0496119_0010103	Ga0496119_0010103_1874_3085	392
409	3300048924	Ga0496121_0000002	Ga0496121_0000002_24554_25765	392
410	3300048925	Ga0496122_0001790	Ga0496122_0001790_24554_25765	392
411	3300048926	Ga0496123_0017312	Ga0496123_0017312_549_1760	392
412	3300048927	Ga0496124_0000002	Ga0496124_0000002_1468824_1470035	392
413	3300048928	Ga0496125_0000002	Ga0496125_0000002_24554_25765	392
414	3300048929	Ga0496126_0000009	Ga0496126_0000009_724586_725797	392

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00067

p450

Cytochrome P450

315

439

0.9 PF00067

p450

Cytochrome P450

84

309

0.78 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3r9b-assembly3.cif.gz_C	crystal structure of mycobacterium smegmatis cyp164a2 in ligand free state	0.9556	2	392
5l94-assembly2.cif.gz_B	the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone	0.9415	8	391
3r9c-assembly1.cif.gz_A	crystal structure of mycobacterium smegmatis cyp164a2 with econazole bound	0.9323	2	392
3r9b-assembly3.cif.gz_C	crystal structure of mycobacterium smegmatis cyp164a2 in ligand free state	0.9323	2	392
5l94-assembly2.cif.gz_B	the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone	0.9288	8	391

ID	Description	Score	Start	End	Superfamily
3r9bC00	Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450	0.9556	2	392	1.10.630.10
3ejbD02	Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450	0.944	75	391	1.10.630.10
3r9bC00	Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450	0.9323	2	392	1.10.630.10
af_A0A0N7KMG3_266_458_1.10.630.10	Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450	0.9323	220	365	1.10.630.10
5vwsA00	Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450	0.9226	2	391	1.10.630.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2S9F448-F1-model_v4	Cytochrome P450	0.9855	230	391	GO:0004497 GO:0005506 GO:0016705 GO:0020037
AF-A0A4Q3SS38-F1-model_v4	Cytochrome P450	0.9801	230	390	GO:0004497 GO:0005506 GO:0016705 GO:0020037
AF-A0A7K0LW52-F1-model_v4	Cytochrome P450	0.97	272	390	GO:0004497 GO:0005506 GO:0016705 GO:0020037
AF-A0A4R5BCH8-F1-model_v4	Cytochrome P450	0.9698	207	390	GO:0004497 GO:0005506 GO:0016705 GO:0020037
AF-A0A499UEL5-F1-model_v4	Cytochrome P450	0.9697	275	390	GO:0005506 GO:0006707 GO:0008395 GO:0020037 GO:0036199

Feature Viewer

pLDDT	pTM	Quality
91.13	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F438383

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00067

p450

Cytochrome P450

315

439

0.9

PF00067

p450

Cytochrome P450

84

309

0.78

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map