F438333

General Info

Members Datasets Scaffolds Average Seq Length
414 236 388 642

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10002838|Ga0213876_100028384
Length 690
Sequence MGSHNCNSCDKNDCNEENCIHTLPNWSVAKSSDRQWQLYSWVVWKRMPSHKTCMRKFIITVFTLGFLTVVTYSQDAVKPGSAGFDLKRENIARGNIDTITYESKTVGTNRRALIYTPPGYSKNTRYPVLYLLHGIGGDEKEWLNGGNPQVILDNLYSDGKLVPMIVVMPNGRAMKDDRATGNIMAPDKVQAFATFEKDLLNDLTPYIEKNFPVLNDREHRAIAGLSMGGGQALNFGLGNLDMFAWVGGFSSAPNTKQPAELLPDPEAARKKLKLLFISCGASDGLIGFSKRTHDYFEKNNVPHIYFIEPGVHDFKVWKDGLYMFSQLLFKPVDPSTFSKYPVAGAPAATNIRNGAYPQIMTDSRVKFSIKAPEAKKVQVDLGRKYDLTKDENGVWTATTDSVSEGFHYYSLLIDGVALADPASESFYGMGRMASGIEIPFAGGSYYALRNVPHGDIRIKKYFSRVTNSWRQCYVYTPPAYDSNATARYPVLYLLHGGGEDERGWSQQGKADLILDNLIAAKKAVPMIIVMMDGNFNGGFGEQSLKNFENELKQSVIPFVDNNFRTETGANSRALAGLSLGGLQTLYAGLKNTSMFSQLGVFSSGWWSNQPALSDPQYEFMKNNAAAINSNLKTFWISQGGKEDIAYNNNKIMMGRFDELGIKYVYSEYPGGHTWPVWRNNLFNFAQLLFK

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738543023 Pedobacter sp. OK628 Isolate Unclassified
5 2818991444 Filimonas endophytica 3197 Isolate Unclassified
6 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
7 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
8 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
9 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
10 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
11 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
12 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
13 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
14 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
15 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
16 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
17 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
18 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
19 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
20 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
21 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
22 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
23 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
24 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
25 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
26 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
27 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
161 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
165 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
186 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
225 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
226 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
227 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
236 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.24
Metatranscriptomes 0
Isolates 6.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 1.21
Rhizosphere 86.71
Stem 0
Stem Tuber 0
Unclassified 9.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000002 3300002067 Bacteria 624895
2 rootH1_10063766 3300003316 Bacteria 9737
3 rootH1_10063766 3300003323 Bacteria 1469
4 rootH2_10009880 3300003320 Bacteria 22399
5 rootL2_10050196 3300003322 Bacteria 4009
6 rootL2_10072910 3300003322 Bacteria 4166
7 rootL2_10144249 3300003322 Bacteria 4239
8 rootL2_10189367 3300003322 Bacteria 3975
9 rootH1_10002972 3300003316 Bacteria 19140
10 rootH1_10002972 3300003323 Bacteria 60440
11 rootH1_10011789 3300003323 Bacteria 124621
12 rootH1_10310511 3300003323 Bacteria 2779
13 Ga0055531_10000067 3300003794 Bacteria 114289
14 Ga0065165_1001172 3300005262 Bacteria 30464
15 Ga0065714_10064725 3300005288 Bacteria 20956
16 Ga0065714_10066450 3300005288 Bacteria 6832
17 Ga0065704_10071510 3300005289 Bacteria 10875
18 Ga0065704_10073782 3300005289 Bacteria 6790
19 Ga0070658_10004727 3300005327 Bacteria 11071
20 Ga0070658_10015289 3300005327 Bacteria 6142
21 Ga0070676_10004752 3300005328 Bacteria 7184
22 Ga0070683_100005037 3300005329 Bacteria 10967
23 Ga0070683_100007775 3300005329 Bacteria 9077
24 Ga0070690_100056558 3300005330 Bacteria 2516
25 Ga0070670_100073621 3300005331 Bacteria 2934
26 Ga0068869_100028559 3300005334 Bacteria 3900
27 Ga0068869_100035578 3300005334 Bacteria 3530
28 Ga0068869_100075350 3300005334 Bacteria 2507
29 Ga0070666_10000052 3300005335 Bacteria 99095
30 Ga0070666_10003770 3300005335 Bacteria 9194
31 Ga0070666_10008027 3300005335 Bacteria 6531
32 Ga0070680_100001415 3300005336 Bacteria 17343
33 Ga0070682_100000973 3300005337 Bacteria 16612
34 Ga0070682_100063969 3300005337 Bacteria 2334
35 Ga0068868_100000964 3300005338 Bacteria 19618
36 Ga0068868_100014224 3300005338 Bacteria 5861
37 Ga0070660_100003297 3300005339 Bacteria 11097
38 Ga0070689_100039368 3300005340 Bacteria 3619
39 Ga0070689_100044423 3300005340 Bacteria 3418
40 Ga0070691_10022692 3300005341 Bacteria 2913
41 Ga0070661_100003187 3300005344 Bacteria 11306
42 Ga0070668_100002128 3300005347 Bacteria 14482
43 Ga0070668_100008599 3300005347 Bacteria 7584
44 Ga0070669_100001992 3300005353 Bacteria 14773
45 Ga0070674_100027286 3300005356 Bacteria 3741
46 Ga0070673_100010125 3300005364 Bacteria 6366
47 Ga0070673_100097563 3300005364 Bacteria 2414
48 Ga0070688_100003822 3300005365 Bacteria 7806
49 Ga0070667_100012416 3300005367 Bacteria 7049
50 Ga0070667_100018604 3300005367 Bacteria 5762
51 Ga0070678_100069785 3300005456 Bacteria 2624
52 Ga0070681_10003766 3300005458 Bacteria 14242
53 Ga0068867_100021779 3300005459 Bacteria 4576
54 Ga0068867_100075908 3300005459 Bacteria 2522
55 Ga0070685_10007455 3300005466 Bacteria 5599
56 Ga0070698_100015956 3300005471 Bacteria 7932
57 Ga0070698_100032295 3300005471 Bacteria 5424
58 Ga0070679_100017950 3300005530 Bacteria 6855
59 Ga0070679_100031514 3300005530 Bacteria 5238
60 Ga0070679_100158391 3300005530 Bacteria 2238
61 Ga0070684_100004494 3300005535 Bacteria 10615
62 Ga0070684_100008178 3300005535 Bacteria 8169
63 Ga0070684_100011502 3300005535 Bacteria 7048
64 Ga0070684_100015068 3300005535 Bacteria 6283
65 Ga0068853_100010157 3300005539 Bacteria 7605
66 Ga0068853_100054542 3300005539 Bacteria 3445
67 Ga0068853_100085323 3300005539 Bacteria 2768
68 Ga0070672_100005362 3300005543 Bacteria 8494
69 Ga0070693_100005021 3300005547 Bacteria 6321
70 Ga0070665_100000006 3300005548 Bacteria 718034
71 Ga0070665_100007305 3300005548 Bacteria 11241
72 Ga0068855_100027417 3300005563 Bacteria 6814
73 Ga0068855_100110214 3300005563 Bacteria 3160
74 Ga0068855_100204437 3300005563 Bacteria 2222
75 Ga0070664_100005452 3300005564 Bacteria 10214
76 Ga0068857_100009779 3300005577 Bacteria 8328
77 Ga0068857_100030948 3300005577 Bacteria 4729
78 Ga0068856_100003725 3300005614 Bacteria 15294
79 Ga0068856_100006864 3300005614 Bacteria 11135
80 Ga0068856_100122754 3300005614 Bacteria 2600
81 Ga0068852_100000318 3300005616 Bacteria 32729
82 Ga0068852_100002743 3300005616 Bacteria 12190
83 Ga0068852_100012570 3300005616 Bacteria 6432
84 Ga0068852_100046608 3300005616 Bacteria 3694
85 Ga0068859_100000112 3300005617 Bacteria 77364
86 Ga0068859_100100391 3300005617 Bacteria 2949
87 Ga0068864_100010726 3300005618 Bacteria 7573
88 Ga0068864_100152610 3300005618 Bacteria 2094
89 Ga0068866_10012578 3300005718 Bacteria 3691
90 Ga0068861_100007157 3300005719 Bacteria 7637
91 Ga0068861_100019106 3300005719 Bacteria 4894
92 Ga0068851_10000754 3300005834 Bacteria 13904
93 Ga0068863_100000485 3300005841 Bacteria 40572
94 Ga0068863_100006897 3300005841 Bacteria 11130
95 Ga0068858_100008716 3300005842 Bacteria 9739
96 Ga0068858_100047081 3300005842 Bacteria 3999
97 Ga0068860_100000026 3300005843 Bacteria 270483
98 Ga0068860_100003156 3300005843 Bacteria 17014
99 Ga0068860_100006421 3300005843 Bacteria 11804
100 Ga0068860_100014266 3300005843 Bacteria 7791
101 Ga0068862_100002335 3300005844 Bacteria 16891
102 Ga0068871_100019243 3300006358 Bacteria 5211
103 Ga0068871_100045171 3300006358 Bacteria 3544
104 Ga0068871_100079087 3300006358 Bacteria 2720
105 Ga0075428_100004578 3300006844 Bacteria 15293
106 Ga0075428_100033969 3300006844 Bacteria 5627
107 Ga0075430_100053660 3300006846 Bacteria 3393
108 Ga0075431_100102289 3300006847 Bacteria 2957
109 Ga0075429_100000606 3300006880 Bacteria 27574
110 Ga0068865_100005986 3300006881 Bacteria 7410
111 Ga0097620_100000112 3300006931 Bacteria 77364
112 Ga0097620_100100394 3300006931 Bacteria 2949
113 Ga0105240_10000008 3300009093 Bacteria 618862
114 Ga0105240_10000054 3300009093 Bacteria 225529
115 Ga0105240_10006096 3300009093 Bacteria 17790
116 Ga0105240_10008140 3300009093 Bacteria 15040
117 Ga0105240_10027179 3300009093 Bacteria 7496
118 Ga0105240_10057426 3300009093 Bacteria 4863
119 Ga0105240_10062870 3300009093 Bacteria 4620
120 Ga0105240_10089030 3300009093 Bacteria 3776
121 Ga0111539_10004316 3300009094 Bacteria 18606
122 Ga0111539_10011851 3300009094 Bacteria 10930
123 Ga0105247_10030364 3300009101 Bacteria 3276
124 Ga0114129_10032485 3300009147 Bacteria 7377
125 Ga0105241_10003117 3300009174 Bacteria 12342
126 Ga0105241_10005972 3300009174 Bacteria 8982
127 Ga0105241_10008728 3300009174 Bacteria 7446
128 Ga0105242_10026587 3300009176 Bacteria 4587
129 Ga0105248_10037799 3300009177 Bacteria 5402
130 Ga0105237_10000082 3300009545 Bacteria 127340
131 Ga0105237_10000248 3300009545 Bacteria 76402
132 Ga0105237_10002765 3300009545 Bacteria 21337
133 Ga0105237_10018840 3300009545 Bacteria 7139
134 Ga0105237_10022477 3300009545 Bacteria 6471
135 Ga0105237_10058455 3300009545 Bacteria 3859
136 Ga0105237_10068036 3300009545 Bacteria 3556
137 Ga0105238_10002711 3300009551 Bacteria 17626
138 Ga0105249_10008368 3300009553 Bacteria 9009
139 Ga0105249_10011270 3300009553 Bacteria 7848
140 Ga0105249_10014262 3300009553 Bacteria 7026
141 Ga0105239_10002499 3300010375 Bacteria 23410
142 Ga0105239_10032156 3300010375 Bacteria 5766
143 Ga0157373_10009769 3300013100 Bacteria 7077
144 Ga0157373_10009803 3300013100 Bacteria 7063
145 Ga0157373_10034165 3300013100 Bacteria 3653
146 Ga0157371_10000037 3300013102 Bacteria 214866
147 Ga0157371_10000364 3300013102 Bacteria 57324
148 Ga0157371_10003293 3300013102 Bacteria 14781
149 Ga0157371_10009835 3300013102 Bacteria 7498
150 Ga0157371_10010385 3300013102 Bacteria 7259
151 Ga0157371_10024386 3300013102 Bacteria 4417
152 Ga0157370_10000022 3300013104 Bacteria 163793
153 Ga0157370_10000973 3300013104 Bacteria 36273
154 Ga0157370_10006106 3300013104 Bacteria 13367
155 Ga0157370_10010106 3300013104 Bacteria 9968
156 Ga0157370_10010802 3300013104 Bacteria 9597
157 Ga0157370_10147459 3300013104 Bacteria 2190
158 Ga0157369_10000005 3300013105 Bacteria 470816
159 Ga0157369_10021312 3300013105 Bacteria 7248
160 Ga0157369_10058646 3300013105 Bacteria 4152
161 Ga0157374_10012891 3300013296 Bacteria 7282
162 Ga0157374_10086914 3300013296 Bacteria 2976
163 Ga0157374_10089188 3300013296 Bacteria 2938
164 Ga0157374_10108685 3300013296 Bacteria 2666
165 Ga0157378_10000842 3300013297 Bacteria 28489
166 Ga0157378_10065876 3300013297 Unclassified 3243
167 Ga0157378_10139577 3300013297 Bacteria 2249
168 Ga0163162_10001989 3300013306 Bacteria 19217
169 Ga0163162_10004020 3300013306 Bacteria 14114
170 Ga0163162_10004208 3300013306 Bacteria 13834
171 Ga0163162_10011353 3300013306 Bacteria 8685
172 Ga0163162_10045299 3300013306 Bacteria 4407
173 Ga0163162_10065346 3300013306 Bacteria 3685
174 Ga0163162_10164413 3300013306 Bacteria 2342
175 Ga0157372_10000180 3300013307 Bacteria 69650
176 Ga0157372_10001831 3300013307 Bacteria 23034
177 Ga0157375_10002943 3300013308 Bacteria 14772
178 Ga0157375_10024226 3300013308 Bacteria 5613
179 Ga0157375_10060564 3300013308 Bacteria 3755
180 Ga0163163_10007450 3300014325 Bacteria 9656
181 Ga0163163_10015290 3300014325 Bacteria 7091
182 Ga0163163_10161308 3300014325 Bacteria 2287
183 Ga0157380_10001955 3300014326 Bacteria 13726
184 Ga0182008_10000168 3300014497 Bacteria 51118
185 Ga0157379_10014683 3300014968 Bacteria 6871
186 Ga0157379_10118996 3300014968 Bacteria 2376
187 Ga0157376_10005623 3300014969 Bacteria 8772
188 Ga0157376_10098071 3300014969 Bacteria 2554
189 Ga0182006_1000215 3300015261 Bacteria 56244
190 Ga0182007_10000039 3300015262 Bacteria 120751
191 Ga0163161_10000229 3300017792 Bacteria 51544
192 Ga0163161_10001469 3300017792 Bacteria 17440
193 Ga0163161_10008497 3300017792 Bacteria 7111
194 Ga0163161_10015837 3300017792 Bacteria 5258
195 Ga0213876_10002838 3300021384 Bacteria 10074
196 Ga0209646_1000045 3300025246 Bacteria 333765
197 Ga0209026_1000241 3300025250 Bacteria 70485
198 Ga0209050_1002465 3300025298 Bacteria 15771
199 Ga0209257_1000005 3300025304 Bacteria 1592528
200 Ga0207656_10003295 3300025321 Bacteria 5533
201 Ga0207682_10015762 3300025893 Bacteria 2946
202 Ga0207688_10013739 3300025901 Bacteria 4401
203 Ga0207680_10000035 3300025903 Bacteria 73889
204 Ga0207680_10016290 3300025903 Bacteria 3899
205 Ga0207645_10001124 3300025907 Bacteria 22129
206 Ga0207645_10002051 3300025907 Bacteria 16146
207 Ga0207645_10007487 3300025907 Bacteria 7706
208 Ga0207705_10002350 3300025909 Bacteria 14614
209 Ga0207654_10000791 3300025911 Bacteria 17421
210 Ga0207654_10004010 3300025911 Bacteria 7411
211 Ga0207654_10006984 3300025911 Bacteria 5687
212 Ga0207707_10000682 3300025912 Bacteria 33701
213 Ga0207695_10000021 3300025913 Bacteria 679399
214 Ga0207695_10000043 3300025913 Bacteria 444585
215 Ga0207695_10000567 3300025913 Bacteria 75760
216 Ga0207695_10036916 3300025913 Bacteria 5276
217 Ga0207695_10044019 3300025913 Bacteria 4752
218 Ga0207695_10051285 3300025913 Bacteria 4334
219 Ga0207695_10098543 3300025913 Bacteria 2922
220 Ga0207671_10000341 3300025914 Bacteria 68530
221 Ga0207671_10002429 3300025914 Bacteria 19951
222 Ga0207671_10003507 3300025914 Bacteria 15576
223 Ga0207671_10036030 3300025914 Bacteria 3669
224 Ga0207671_10045909 3300025914 Bacteria 3231
225 Ga0207660_10001951 3300025917 Bacteria 13762
226 Ga0207657_10015508 3300025919 Bacteria 7381
227 Ga0207652_10000295 3300025921 Bacteria 51567
228 Ga0207652_10002325 3300025921 Bacteria 16108
229 Ga0207652_10119652 3300025921 Bacteria 2342
230 Ga0207652_10155958 3300025921 Bacteria 2045
231 Ga0207694_10011333 3300025924 Bacteria 6729
232 Ga0207694_10014539 3300025924 Bacteria 5936
233 Ga0207706_10057156 3300025933 Bacteria 3438
234 Ga0207686_10001460 3300025934 Bacteria 13366
235 Ga0207704_10004257 3300025938 Bacteria 6538
236 Ga0207691_10000411 3300025940 Bacteria 42937
237 Ga0207691_10050403 3300025940 Bacteria 3811
238 Ga0207691_10085592 3300025940 Bacteria 2829
239 Ga0207689_10000760 3300025942 Bacteria 30926
240 Ga0207689_10003645 3300025942 Bacteria 14064
241 Ga0207689_10030346 3300025942 Bacteria 4505
242 Ga0207689_10039501 3300025942 Bacteria 3907
243 Ga0207689_10047961 3300025942 Bacteria 3524
244 Ga0207689_10052454 3300025942 Bacteria 3361
245 Ga0207661_10005220 3300025944 Bacteria 9131
246 Ga0207661_10022553 3300025944 Bacteria 4744
247 Ga0207661_10061451 3300025944 Bacteria 3035
248 Ga0207667_10024317 3300025949 Bacteria 6652
249 Ga0207667_10027262 3300025949 Bacteria 6223
250 Ga0207667_10088510 3300025949 Bacteria 3202
251 Ga0207712_10002931 3300025961 Bacteria 10898
252 Ga0207712_10005832 3300025961 Bacteria 7763
253 Ga0207712_10010061 3300025961 Bacteria 5996
254 Ga0207668_10008212 3300025972 Bacteria 6217
255 Ga0207658_10001482 3300025986 Bacteria 18222
256 Ga0207658_10050261 3300025986 Bacteria 3067
257 Ga0207677_10001043 3300026023 Bacteria 15221
258 Ga0207703_10019032 3300026035 Bacteria 5363
259 Ga0207703_10021534 3300026035 Bacteria 5048
260 Ga0207678_10096528 3300026067 Bacteria 2526
261 Ga0207702_10001071 3300026078 Bacteria 28042
262 Ga0207702_10025956 3300026078 Bacteria 4864
263 Ga0207702_10035483 3300026078 Bacteria 4170
264 Ga0207702_10067393 3300026078 Bacteria 3072
265 Ga0207641_10000089 3300026088 Bacteria 128603
266 Ga0207641_10000434 3300026088 Bacteria 47935
267 Ga0207641_10007421 3300026088 Bacteria 9120
268 Ga0207641_10037162 3300026088 Bacteria 4066
269 Ga0207648_10001885 3300026089 Bacteria 22909
270 Ga0207648_10047859 3300026089 Bacteria 3746
271 Ga0207648_10111457 3300026089 Bacteria 2402
272 Ga0207676_10002287 3300026095 Bacteria 13739
273 Ga0207676_10037996 3300026095 Bacteria 3673
274 Ga0207676_10056851 3300026095 Bacteria 3078
275 Ga0207674_10002307 3300026116 Bacteria 24170
276 Ga0207674_10013052 3300026116 Bacteria 9251
277 Ga0207675_100000148 3300026118 Bacteria 61193
278 Ga0207675_100001526 3300026118 Bacteria 23217
279 Ga0207675_100024255 3300026118 Bacteria 5640
280 Ga0207683_10002413 3300026121 Bacteria 16319
281 Ga0207683_10032491 3300026121 Unclassified 4534
282 Ga0207698_10004943 3300026142 Bacteria 8171
283 Ga0207698_10007196 3300026142 Bacteria 6971
284 Ga0207698_10047430 3300026142 Bacteria 3254
285 Ga0207428_10069387 3300027907 Bacteria 2771
286 Ga0268266_10000010 3300028379 Bacteria 1030233
287 Ga0268266_10004312 3300028379 Bacteria 13682
288 Ga0268264_10000455 3300028381 Bacteria 55791
289 Ga0268264_10001248 3300028381 Bacteria 24263
290 Ga0268264_10004783 3300028381 Bacteria 11492
291 Ga0268264_10008856 3300028381 Bacteria 8341
292 Ga0265337_1000335 3300028556 Bacteria 25111
293 Ga0265319_1000157 3300028563 Bacteria 51291
294 Ga0265334_10002931 3300028573 Bacteria 7816
295 Ga0265318_10003421 3300028577 Bacteria 7972
296 Ga0265322_10004051 3300028654 Bacteria 4387
297 Ga0265336_10000278 3300028666 Bacteria 36004
298 Ga0307515_10000076 3300028794 Bacteria 228736
299 Ga0265338_10001413 3300028800 Bacteria 39092
300 Ga0265338_10003207 3300028800 Bacteria 23338
301 Ga0265324_10005232 3300029957 Bacteria 5646
302 Ga0265320_10005996 3300031240 Bacteria 7720
303 Ga0265325_10003933 3300031241 Bacteria 9510
304 Ga0265325_10012911 3300031241 Unclassified 4764
305 Ga0265340_10002946 3300031247 Bacteria 9693
306 Ga0265339_10038346 3300031249 Bacteria 2674
307 Ga0265313_10004645 3300031595 Bacteria 10399
308 Ga0265342_10010675 3300031712 Bacteria 6346
309 Ga0316578_10005324 3300031728 Bacteria 6221
310 Ga0307405_10000038 3300031731 Bacteria 86305
311 Ga0316577_10008655 3300031733 Bacteria 5458
312 Ga0307407_10000005 3300031903 Bacteria 233125
313 Ga0307416_100000001 3300032002 Bacteria 515017
314 Ga0307414_10015830 3300032004 Bacteria 4565
315 Ga0307414_10023606 3300032004 Bacteria 3904
316 Ga0316582_0015619 3300036647 Bacteria 4349
317 Ga0316582_0062686 3300036647 Unclassified 2388
318 Ga0316584_0000579 3300036712 Bacteria 19770
319 Ga0395905_0080484 3300037471 Bacteria 3053
320 Ga0436365_1287042 3300039437 Bacteria 20912
321 Ga0439457_002748 3300042014 Bacteria 4944
322 Ga0450894_002737 3300042131 Bacteria 2337
323 Ga0439434_0008834 3300042435 Bacteria 2961
324 Ga0451577_0013291 3300042876 Bacteria 7712
325 Ga0451577_0035688 3300042876 Bacteria 4479
326 Ga0466972_0000086 3300044658 Bacteria 85000
327 Ga0466972_0001776 3300044658 Bacteria 10566
328 Ga0466972_0005470 3300044658 Bacteria 6362
329 Ga0453683_0009447 3300044673 Bacteria 6506
330 Ga0453684_0001568 3300044712 Bacteria 63367
331 Ga0453684_0014405 3300044712 Bacteria 12656
332 Ga0453684_0021778 3300044712 Bacteria 9551
333 Ga0466957_0003869 3300044842 Bacteria 8271
334 Ga0466957_0005275 3300044842 Bacteria 7239
335 Ga0451576_0003589 3300045051 Bacteria 21101
336 Ga0451576_0007136 3300045051 Bacteria 13484
337 Ga0451576_0014170 3300045051 Bacteria 8885
338 Ga0495638_0000050 3300046460 Bacteria 206131
339 Ga0495650_0000057 3300046471 Bacteria 303569
340 Ga0495606_0000010 3300046507 Bacteria 299893
341 Ga0495606_0025158 3300046507 Bacteria 4271
342 Ga0495616_0018252 3300046513 Bacteria 3854
343 Ga0495632_0006807 3300046519 Bacteria 7294
344 Ga0495586_0045549 3300046535 Bacteria 2364
345 Ga0495633_0001834 3300046558 Bacteria 15612
346 Ga0495668_0001248 3300046616 Bacteria 25500
347 Ga0495634_0024995 3300046642 Bacteria 4187
348 Ga0495611_0000373 3300046648 Bacteria 28805
349 Ga0495625_0000003 3300046660 Bacteria 686847
350 Ga0495625_0012091 3300046660 Bacteria 7004
351 Ga0495661_0001280 3300046665 Bacteria 21554
352 Ga0495649_0000002 3300046694 Bacteria 1093458
353 Ga0495687_007668 3300047443 Bacteria 6309
354 Ga0495687_028373 3300047443 Bacteria 2604
355 Ga0495686_0000699 3300047472 Bacteria 45297
356 Ga0495686_0001883 3300047472 Bacteria 20972
357 Ga0495686_0014213 3300047472 Bacteria 5488
358 Ga0495686_0022877 3300047472 Bacteria 4130
359 Ga0496101_0084199 3300048904 Bacteria 2355
360 Ga0496102_0017343 3300048905 Bacteria 6307
361 Ga0496109_0119807 3300048912 Bacteria 2451
362 Ga0496113_0032678 3300048916 Bacteria 3782
363 Ga0496116_0000012 3300048919 Bacteria 611365
364 Ga0496117_0000112 3300048920 Bacteria 184013
365 Ga0496118_0000562 3300048921 Bacteria 61253
366 Ga0496119_0000002 3300048922 Bacteria 738385
367 Ga0496122_0003447 3300048925 Bacteria 20795
368 Ga0496122_0003531 3300048925 Bacteria 20465
369 Ga0496123_0000882 3300048926 Bacteria 47574
370 Ga0496124_0002792 3300048927 Bacteria 22157
371 Ga0496125_0021338 3300048928 Bacteria 6045
372 Ga0496126_0008322 3300048929 Bacteria 11201
373 Ga0501300_003010 3300049523 Unclassified 2516
374 Ga0501034_0082987 3300049571 Bacteria 3207
375 Ga0501206_001473 3300049653 Bacteria 2937
376 Ga0501259_001138 3300049688 Bacteria 4432
377 Ga0501225_0000109 3300049705 Bacteria 25558
378 Ga0501225_0006232 3300049705 Bacteria 3485
379 Ga0501264_000366 3300049761 Bacteria 7056
380 nmdc:mga05p37_14139_c1 3300050507 Bacteria 9579
381 nmdc:mga0qj67_102495_c1 3300050509 Bacteria 2308
382 nmdc:mga08y16_36422_c1 3300050511 Bacteria 5168
383 Ga0495619_0053798 3300053085 Unclassified 2664
384 Ga0500578_0000019 3300053086 Bacteria 169042
385 Ga0500616_0000004 3300053153 Bacteria 1002714
386 Ga0500622_0000110 3300053156 Bacteria 83911
387 Ga0500622_0000804 3300053156 Bacteria 26977
388 Ga0500611_000048 3300053727 Bacteria 56160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049523 Ga0501300_003010 Ga0501300_003010_14_1714 560
2 3300046616 Ga0495668_0001248 Ga0495668_0001248_276_2000 572
3 3300013100 Ga0157373_10009803 Ga0157373_100098033 577
4 3300005614 Ga0068856_100003725 Ga0068856_10000372510 614
5 3300026078 Ga0207702_10001071 Ga0207702_1000107123 614
6 3300005365 Ga0070688_100003822 Ga0070688_1000038222 617
7 3300036647 Ga0316582_0062686 Ga0316582_0062686_157_2076 619
8 3300042876 Ga0451577_0013291 Ga0451577_0013291_370_2238 619
9 3300047472 Ga0495686_0000699 Ga0495686_0000699_41494_43410 620
10 3300014325 Ga0163163_10007450 Ga0163163_100074506 622
11 3300014968 Ga0157379_10118996 Ga0157379_101189961 622
12 3300025893 Ga0207682_10015762 Ga0207682_100157622 622
13 iso_pu_bacteria 2522125168 2522553024 622
14 3300005841 Ga0068863_100006897 Ga0068863_1000068978 624
15 3300026088 Ga0207641_10000434 Ga0207641_1000043432 624
16 3300003322 rootL2_10050196 rootL2_100501962 625
17 3300042876 Ga0451577_0035688 Ga0451577_0035688_686_2602 625
18 3300013105 Ga0157369_10021312 Ga0157369_100213123 626
19 iso_pu_bacteria 2818991444 2819587269 627
20 iso_pu_bacteria 2818991460 2819681366 627
21 iso_pu_bacteria 2929239360 2929243926 627
22 iso_pu_bacteria 2910245624 2910246186 628
23 iso_pu_bacteria 2929154850 2929158312 628
24 iso_pu_bacteria 2884791551 2884794019 629
25 iso_pu_bacteria 2929177148 2929179022 629
26 iso_pu_bacteria 2929921140 2929924079 629
27 iso_pu_bacteria 2945977869 2945981426 629
28 iso_pu_bacteria 2946013367 2946019175 629
29 iso_pu_bacteria 8003151029 8003154892 629
30 3300006844 Ga0075428_100004578 Ga0075428_1000045783 630
31 3300009094 Ga0111539_10004316 Ga0111539_100043165 630
32 3300009094 Ga0111539_10011851 Ga0111539_100118517 630
33 3300027907 Ga0207428_10069387 Ga0207428_100693871 630
34 3300050511 nmdc:mga08y16_36422_c1 nmdc:mga08y16_36422_c1_2197_4110 630
35 iso_pu_bacteria 2911138879 2911142296 630
36 3300005329 Ga0070683_100005037 Ga0070683_1000050375 631
37 3300005344 Ga0070661_100003187 Ga0070661_1000031875 631
38 3300005535 Ga0070684_100011502 Ga0070684_1000115024 631
39 3300005539 Ga0068853_100010157 Ga0068853_1000101573 631
40 3300005564 Ga0070664_100005452 Ga0070664_1000054524 631
41 3300005577 Ga0068857_100009779 Ga0068857_1000097794 631
42 3300013102 Ga0157371_10000364 Ga0157371_1000036438 631
43 3300026116 Ga0207674_10002307 Ga0207674_1000230711 631
44 iso_pu_bacteria 2585428187 2588234361 631
45 iso_pu_bacteria 2919692658 2919697035 631
46 iso_pu_bacteria 2977243572 2977246536 631
47 iso_pu_bacteria 2984572630 2984575859 631
48 iso_pu_bacteria 2984606641 2984609315 631
49 iso_pu_bacteria 2993480792 2993484464 631
50 3300003322 rootL2_10072910 rootL2_100729102 632
51 3300003322 rootL2_10189367 rootL2_101893671 632
52 3300005548 Ga0070665_100000006 Ga0070665_100000006469 632
53 3300005563 Ga0068855_100204437 Ga0068855_1002044372 632
54 3300005614 Ga0068856_100006864 Ga0068856_1000068643 632
55 3300005616 Ga0068852_100000318 Ga0068852_10000031811 632
56 3300005843 Ga0068860_100000026 Ga0068860_100000026181 632
57 3300009093 Ga0105240_10027179 Ga0105240_100271792 632
58 3300009093 Ga0105240_10089030 Ga0105240_100890302 632
59 3300009545 Ga0105237_10002765 Ga0105237_1000276510 632
60 3300009551 Ga0105238_10002711 Ga0105238_100027113 632
61 3300013104 Ga0157370_10010802 Ga0157370_100108022 632
62 3300013105 Ga0157369_10058646 Ga0157369_100586462 632
63 3300013306 Ga0163162_10001989 Ga0163162_1000198915 632
64 3300013307 Ga0157372_10000180 Ga0157372_1000018015 632
65 3300025913 Ga0207695_10051285 Ga0207695_100512852 632
66 3300025924 Ga0207694_10014539 Ga0207694_100145392 632
67 3300025949 Ga0207667_10027262 Ga0207667_100272622 632
68 3300025949 Ga0207667_10088510 Ga0207667_100885102 632
69 3300026078 Ga0207702_10067393 Ga0207702_100673932 632
70 3300028379 Ga0268266_10000010 Ga0268266_10000010549 632
71 3300028381 Ga0268264_10000455 Ga0268264_1000045523 632
72 3300037471 Ga0395905_0080484 Ga0395905_0080484_876_2804 632
73 3300045051 Ga0451576_0014170 Ga0451576_0014170_1061_2977 632
74 3300048904 Ga0496101_0084199 Ga0496101_0084199_387_2303 632
75 3300048929 Ga0496126_0008322 Ga0496126_0008322_7979_9895 632
76 3300053156 Ga0500622_0000110 Ga0500622_0000110_783_2699 632
77 iso_pu_bacteria 2599185184 2599478169 632
78 iso_pu_bacteria 2928078545 2928080124 632
79 iso_pu_bacteria 2928147474 2928149706 632
80 iso_pu_bacteria 2932082852 2932083529 632
81 3300003323 rootH1_10011789 rootH1_100117898 633
82 3300005327 Ga0070658_10004727 Ga0070658_100047275 633
83 3300005328 Ga0070676_10004752 Ga0070676_100047522 633
84 3300005334 Ga0068869_100028559 Ga0068869_1000285594 633
85 3300005334 Ga0068869_100035578 Ga0068869_1000355782 633
86 3300005334 Ga0068869_100075350 Ga0068869_1000753502 633
87 3300005335 Ga0070666_10003770 Ga0070666_100037704 633
88 3300005336 Ga0070680_100001415 Ga0070680_10000141518 633
89 3300005337 Ga0070682_100000973 Ga0070682_10000097318 633
90 3300005338 Ga0068868_100000964 Ga0068868_1000009648 633
91 3300005341 Ga0070691_10022692 Ga0070691_100226922 633
92 3300005347 Ga0070668_100002128 Ga0070668_1000021284 633
93 3300005367 Ga0070667_100012416 Ga0070667_1000124165 633
94 3300005458 Ga0070681_10003766 Ga0070681_1000376615 633
95 3300005459 Ga0068867_100021779 Ga0068867_1000217792 633
96 3300005459 Ga0068867_100075908 Ga0068867_1000759082 633
97 3300005530 Ga0070679_100017950 Ga0070679_1000179502 633
98 3300005535 Ga0070684_100015068 Ga0070684_1000150684 633
99 3300005543 Ga0070672_100005362 Ga0070672_1000053622 633
100 3300005547 Ga0070693_100005021 Ga0070693_1000050214 633
101 3300005548 Ga0070665_100007305 Ga0070665_1000073057 633
102 3300005577 Ga0068857_100030948 Ga0068857_1000309483 633
103 3300005616 Ga0068852_100046608 Ga0068852_1000466082 633
104 3300005618 Ga0068864_100010726 Ga0068864_1000107264 633
105 3300005718 Ga0068866_10012578 Ga0068866_100125782 633
106 3300005834 Ga0068851_10000754 Ga0068851_100007549 633
107 3300005842 Ga0068858_100047081 Ga0068858_1000470812 633
108 3300005843 Ga0068860_100014266 Ga0068860_1000142662 633
109 3300006881 Ga0068865_100005986 Ga0068865_1000059865 633
110 3300009093 Ga0105240_10006096 Ga0105240_100060964 633
111 3300009101 Ga0105247_10030364 Ga0105247_100303642 633
112 3300009174 Ga0105241_10003117 Ga0105241_1000311711 633
113 3300009177 Ga0105248_10037799 Ga0105248_100377992 633
114 3300009553 Ga0105249_10008368 Ga0105249_100083685 633
115 3300010375 Ga0105239_10032156 Ga0105239_100321563 633
116 3300013104 Ga0157370_10000973 Ga0157370_1000097328 633
117 3300013296 Ga0157374_10012891 Ga0157374_100128912 633
118 3300013296 Ga0157374_10086914 Ga0157374_100869142 633
119 3300013306 Ga0163162_10045299 Ga0163162_100452992 633
120 3300013308 Ga0157375_10002943 Ga0157375_100029434 633
121 3300014325 Ga0163163_10015290 Ga0163163_100152902 633
122 3300014968 Ga0157379_10014683 Ga0157379_100146833 633
123 3300014969 Ga0157376_10098071 Ga0157376_100980712 633
124 3300021384 Ga0213876_10002838 Ga0213876_100028384 633
125 3300025246 Ga0209646_1000045 Ga0209646_100004524 633
126 3300025250 Ga0209026_1000241 Ga0209026_100024122 633
127 3300025321 Ga0207656_10003295 Ga0207656_100032953 633
128 3300025903 Ga0207680_10016290 Ga0207680_100162902 633
129 3300025907 Ga0207645_10007487 Ga0207645_100074872 633
130 3300025911 Ga0207654_10000791 Ga0207654_100007912 633
131 3300025912 Ga0207707_10000682 Ga0207707_100006829 633
132 3300025913 Ga0207695_10036916 Ga0207695_100369163 633
133 3300025913 Ga0207695_10044019 Ga0207695_100440192 633
134 3300025917 Ga0207660_10001951 Ga0207660_1000195115 633
135 3300025921 Ga0207652_10002325 Ga0207652_100023259 633
136 3300025938 Ga0207704_10004257 Ga0207704_100042572 633
137 3300025940 Ga0207691_10000411 Ga0207691_100004114 633
138 3300025942 Ga0207689_10039501 Ga0207689_100395012 633
139 3300025942 Ga0207689_10047961 Ga0207689_100479613 633
140 3300025942 Ga0207689_10052454 Ga0207689_100524543 633
141 3300025944 Ga0207661_10061451 Ga0207661_100614512 633
142 3300025961 Ga0207712_10005832 Ga0207712_100058321 633
143 3300025972 Ga0207668_10008212 Ga0207668_100082122 633
144 3300025986 Ga0207658_10001482 Ga0207658_100014825 633
145 3300026023 Ga0207677_10001043 Ga0207677_100010435 633
146 3300026035 Ga0207703_10019032 Ga0207703_100190322 633
147 3300026088 Ga0207641_10007421 Ga0207641_100074213 633
148 3300026089 Ga0207648_10001885 Ga0207648_100018855 633
149 3300026095 Ga0207676_10002287 Ga0207676_100022872 633
150 3300026142 Ga0207698_10007196 Ga0207698_100071962 633
151 3300028379 Ga0268266_10004312 Ga0268266_100043126 633
152 3300028381 Ga0268264_10008856 Ga0268264_100088563 633
153 3300039437 Ga0436365_1287042 Ga0436365_1287042_16972_18885 633
154 3300042131 Ga0450894_002737 Ga0450894_002737_14_2032 633
155 3300044658 Ga0466972_0005470 Ga0466972_0005470_2044_3963 633
156 3300048912 Ga0496109_0119807 Ga0496109_0119807_483_2429 633
157 3300053085 Ga0495619_0053798 Ga0495619_0053798_717_2642 633
158 3300053086 Ga0500578_0000019 Ga0500578_0000019_153189_155105 633
159 3300003320 rootH2_10009880 rootH2_100098806 634
160 3300003794 Ga0055531_10000067 Ga0055531_1000006787 634
161 3300005340 Ga0070689_100044423 Ga0070689_1000444232 634
162 3300005618 Ga0068864_100152610 Ga0068864_1001526102 634
163 3300005719 Ga0068861_100019106 Ga0068861_1000191062 634
164 3300006844 Ga0075428_100033969 Ga0075428_1000339694 634
165 3300006880 Ga0075429_100000606 Ga0075429_10000060614 634
166 3300013102 Ga0157371_10010385 Ga0157371_100103854 634
167 3300013296 Ga0157374_10108685 Ga0157374_101086852 634
168 3300014325 Ga0163163_10161308 Ga0163163_101613081 634
169 3300014326 Ga0157380_10001955 Ga0157380_100019554 634
170 3300025304 Ga0209257_1000005 Ga0209257_1000005650 634
171 3300031728 Ga0316578_10005324 Ga0316578_100053245 634
172 3300032004 Ga0307414_10015830 Ga0307414_100158303 634
173 3300044712 Ga0453684_0001568 Ga0453684_0001568_8120_10036 634
174 3300047472 Ga0495686_0014213 Ga0495686_0014213_1932_3854 634
175 3300049761 Ga0501264_000366 Ga0501264_000366_3933_5855 634
176 iso_pu_bacteria 2842722452 2842722765 634
177 iso_pu_bacteria 2842909656 2842913402 634
178 iso_pu_bacteria 2954016120 2954016813 634
179 3300003323 rootH1_10002972 rootH1_1000297245 635
180 3300003323 rootH1_10310511 rootH1_103105111 635
181 3300005262 Ga0065165_1001172 Ga0065165_100117212 635
182 3300005288 Ga0065714_10066450 Ga0065714_100664501 635
183 3300005289 Ga0065704_10071510 Ga0065704_100715105 635
184 3300005289 Ga0065704_10073782 Ga0065704_100737822 635
185 3300005327 Ga0070658_10015289 Ga0070658_100152893 635
186 3300005329 Ga0070683_100007775 Ga0070683_1000077753 635
187 3300005330 Ga0070690_100056558 Ga0070690_1000565582 635
188 3300005331 Ga0070670_100073621 Ga0070670_1000736212 635
189 3300005335 Ga0070666_10008027 Ga0070666_100080276 635
190 3300005337 Ga0070682_100063969 Ga0070682_1000639691 635
191 3300005338 Ga0068868_100014224 Ga0068868_1000142244 635
192 3300005339 Ga0070660_100003297 Ga0070660_1000032974 635
193 3300005340 Ga0070689_100039368 Ga0070689_1000393683 635
194 3300005347 Ga0070668_100008599 Ga0070668_1000085994 635
195 3300005353 Ga0070669_100001992 Ga0070669_1000019929 635
196 3300005356 Ga0070674_100027286 Ga0070674_1000272862 635
197 3300005364 Ga0070673_100097563 Ga0070673_1000975631 635
198 3300005456 Ga0070678_100069785 Ga0070678_1000697851 635
199 3300005466 Ga0070685_10007455 Ga0070685_100074552 635
200 3300005471 Ga0070698_100032295 Ga0070698_1000322952 635
201 3300005530 Ga0070679_100031514 Ga0070679_1000315142 635
202 3300005530 Ga0070679_100158391 Ga0070679_1001583911 635
203 3300005535 Ga0070684_100004494 Ga0070684_1000044946 635
204 3300005535 Ga0070684_100008178 Ga0070684_1000081783 635
205 3300005539 Ga0068853_100085323 Ga0068853_1000853232 635
206 3300005563 Ga0068855_100027417 Ga0068855_1000274173 635
207 3300005563 Ga0068855_100110214 Ga0068855_1001102142 635
208 3300005616 Ga0068852_100002743 Ga0068852_1000027434 635
209 3300005617 Ga0068859_100100391 Ga0068859_1001003912 635
210 3300005719 Ga0068861_100007157 Ga0068861_1000071574 635
211 3300005844 Ga0068862_100002335 Ga0068862_1000023354 635
212 3300006358 Ga0068871_100019243 Ga0068871_1000192433 635
213 3300006358 Ga0068871_100045171 Ga0068871_1000451712 635
214 3300006358 Ga0068871_100079087 Ga0068871_1000790872 635
215 3300006931 Ga0097620_100100394 Ga0097620_1001003942 635
216 3300009093 Ga0105240_10000008 Ga0105240_1000000840 635
217 3300009093 Ga0105240_10000054 Ga0105240_1000005419 635
218 3300009093 Ga0105240_10008140 Ga0105240_100081405 635
219 3300009093 Ga0105240_10057426 Ga0105240_100574263 635
220 3300009093 Ga0105240_10062870 Ga0105240_100628702 635
221 3300009147 Ga0114129_10032485 Ga0114129_100324854 635
222 3300009174 Ga0105241_10005972 Ga0105241_100059725 635
223 3300009176 Ga0105242_10026587 Ga0105242_100265872 635
224 3300009545 Ga0105237_10000248 Ga0105237_1000024838 635
225 3300009545 Ga0105237_10058455 Ga0105237_100584551 635
226 3300009545 Ga0105237_10068036 Ga0105237_100680362 635
227 3300009553 Ga0105249_10014262 Ga0105249_100142626 635
228 3300013100 Ga0157373_10034165 Ga0157373_100341652 635
229 3300013102 Ga0157371_10000037 Ga0157371_1000003713 635
230 3300013102 Ga0157371_10009835 Ga0157371_100098352 635
231 3300013104 Ga0157370_10010106 Ga0157370_100101062 635
232 3300013296 Ga0157374_10089188 Ga0157374_100891882 635
233 3300013297 Ga0157378_10065876 Ga0157378_100658762 635
234 3300013306 Ga0163162_10065346 Ga0163162_100653463 635
235 3300013306 Ga0163162_10164413 Ga0163162_101644131 635
236 3300013308 Ga0157375_10024226 Ga0157375_100242263 635
237 3300013308 Ga0157375_10060564 Ga0157375_100605642 635
238 3300014969 Ga0157376_10005623 Ga0157376_100056235 635
239 3300017792 Ga0163161_10000229 Ga0163161_1000022934 635
240 3300017792 Ga0163161_10015837 Ga0163161_100158372 635
241 3300025298 Ga0209050_1002465 Ga0209050_10024655 635
242 3300025901 Ga0207688_10013739 Ga0207688_100137392 635
243 3300025907 Ga0207645_10001124 Ga0207645_100011243 635
244 3300025907 Ga0207645_10002051 Ga0207645_100020512 635
245 3300025909 Ga0207705_10002350 Ga0207705_100023502 635
246 3300025911 Ga0207654_10006984 Ga0207654_100069842 635
247 3300025913 Ga0207695_10000021 Ga0207695_10000021362 635
248 3300025913 Ga0207695_10000043 Ga0207695_10000043281 635
249 3300025913 Ga0207695_10000567 Ga0207695_1000056732 635
250 3300025913 Ga0207695_10098543 Ga0207695_100985432 635
251 3300025914 Ga0207671_10003507 Ga0207671_100035075 635
252 3300025919 Ga0207657_10015508 Ga0207657_100155083 635
253 3300025921 Ga0207652_10000295 Ga0207652_1000029519 635
254 3300025921 Ga0207652_10119652 Ga0207652_101196521 635
255 3300025921 Ga0207652_10155958 Ga0207652_101559581 635
256 3300025924 Ga0207694_10011333 Ga0207694_100113332 635
257 3300025933 Ga0207706_10057156 Ga0207706_100571562 635
258 3300025934 Ga0207686_10001460 Ga0207686_100014608 635
259 3300025940 Ga0207691_10085592 Ga0207691_100855922 635
260 3300025942 Ga0207689_10003645 Ga0207689_100036454 635
261 3300025942 Ga0207689_10030346 Ga0207689_100303463 635
262 3300025944 Ga0207661_10005220 Ga0207661_100052203 635
263 3300025944 Ga0207661_10022553 Ga0207661_100225533 635
264 3300025949 Ga0207667_10024317 Ga0207667_100243173 635
265 3300025961 Ga0207712_10002931 Ga0207712_100029315 635
266 3300026067 Ga0207678_10096528 Ga0207678_100965282 635
267 3300026078 Ga0207702_10035483 Ga0207702_100354832 635
268 3300026088 Ga0207641_10037162 Ga0207641_100371623 635
269 3300026089 Ga0207648_10047859 Ga0207648_100478593 635
270 3300026095 Ga0207676_10037996 Ga0207676_100379963 635
271 3300026095 Ga0207676_10056851 Ga0207676_100568512 635
272 3300026116 Ga0207674_10013052 Ga0207674_100130523 635
273 3300026118 Ga0207675_100000148 Ga0207675_10000014812 635
274 3300026118 Ga0207675_100001526 Ga0207675_10000152614 635
275 3300026118 Ga0207675_100024255 Ga0207675_1000242554 635
276 3300026121 Ga0207683_10002413 Ga0207683_100024133 635
277 3300026121 Ga0207683_10032491 Ga0207683_100324912 635
278 3300026142 Ga0207698_10004943 Ga0207698_100049433 635
279 3300042014 Ga0439457_002748 Ga0439457_002748_372_2294 635
280 3300042435 Ga0439434_0008834 Ga0439434_0008834_92_2146 635
281 3300044658 Ga0466972_0000086 Ga0466972_0000086_73785_75710 635
282 3300044658 Ga0466972_0001776 Ga0466972_0001776_1158_3080 635
283 3300044673 Ga0453683_0009447 Ga0453683_0009447_4529_6451 635
284 3300044712 Ga0453684_0014405 Ga0453684_0014405_6145_8061 635
285 3300044842 Ga0466957_0003869 Ga0466957_0003869_4330_6252 635
286 3300044842 Ga0466957_0005275 Ga0466957_0005275_1325_3250 635
287 3300045051 Ga0451576_0003589 Ga0451576_0003589_8949_10871 635
288 3300045051 Ga0451576_0007136 Ga0451576_0007136_6051_7970 635
289 3300046460 Ga0495638_0000050 Ga0495638_0000050_137111_139036 635
290 3300046519 Ga0495632_0006807 Ga0495632_0006807_89_2017 635
291 3300046558 Ga0495633_0001834 Ga0495633_0001834_9762_11690 635
292 3300046648 Ga0495611_0000373 Ga0495611_0000373_6472_8388 635
293 3300046660 Ga0495625_0012091 Ga0495625_0012091_588_2516 635
294 3300047472 Ga0495686_0001883 Ga0495686_0001883_14165_16093 635
295 3300048905 Ga0496102_0017343 Ga0496102_0017343_3381_5306 635
296 3300048916 Ga0496113_0032678 Ga0496113_0032678_23_1948 635
297 3300048919 Ga0496116_0000012 Ga0496116_0000012_238306_240231 635
298 3300048920 Ga0496117_0000112 Ga0496117_0000112_164030_165955 635
299 3300048921 Ga0496118_0000562 Ga0496118_0000562_18046_19971 635
300 3300048922 Ga0496119_0000002 Ga0496119_0000002_412937_414862 635
301 3300048925 Ga0496122_0003447 Ga0496122_0003447_18074_19999 635
302 3300048926 Ga0496123_0000882 Ga0496123_0000882_8675_10600 635
303 3300048927 Ga0496124_0002792 Ga0496124_0002792_18073_19998 635
304 3300048928 Ga0496125_0021338 Ga0496125_0021338_3311_5236 635
305 3300049571 Ga0501034_0082987 Ga0501034_0082987_237_2183 635
306 3300049653 Ga0501206_001473 Ga0501206_001473_515_2440 635
307 3300049688 Ga0501259_001138 Ga0501259_001138_1805_3730 635
308 3300049705 Ga0501225_0000109 Ga0501225_0000109_21738_23678 635
309 3300049705 Ga0501225_0006232 Ga0501225_0006232_815_2740 635
310 3300050507 nmdc:mga05p37_14139_c1 nmdc:mga05p37_14139_c1_4182_6107 635
311 3300053153 Ga0500616_0000004 Ga0500616_0000004_854659_856584 635
312 3300053156 Ga0500622_0000804 Ga0500622_0000804_4036_5961 635
313 3300053727 Ga0500611_000048 Ga0500611_000048_8344_10359 635
314 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002125 636
315 3300003316 rootH1_10063766 rootH1_100637663 636
316 3300003322 rootL2_10144249 rootL2_101442493 636
317 3300005288 Ga0065714_10064725 Ga0065714_1006472510 636
318 3300005335 Ga0070666_10000052 Ga0070666_1000005236 636
319 3300005364 Ga0070673_100010125 Ga0070673_1000101253 636
320 3300005367 Ga0070667_100018604 Ga0070667_1000186042 636
321 3300005471 Ga0070698_100015956 Ga0070698_1000159561 636
322 3300005539 Ga0068853_100054542 Ga0068853_1000545422 636
323 3300005614 Ga0068856_100122754 Ga0068856_1001227542 636
324 3300005616 Ga0068852_100012570 Ga0068852_1000125702 636
325 3300005617 Ga0068859_100000112 Ga0068859_10000011222 636
326 3300005841 Ga0068863_100000485 Ga0068863_1000004857 636
327 3300005842 Ga0068858_100008716 Ga0068858_1000087166 636
328 3300005843 Ga0068860_100003156 Ga0068860_10000315611 636
329 3300005843 Ga0068860_100006421 Ga0068860_1000064218 636
330 3300006846 Ga0075430_100053660 Ga0075430_1000536602 636
331 3300006847 Ga0075431_100102289 Ga0075431_1001022892 636
332 3300006931 Ga0097620_100000112 Ga0097620_10000011227 636
333 3300009174 Ga0105241_10008728 Ga0105241_100087284 636
334 3300009545 Ga0105237_10000082 Ga0105237_1000008244 636
335 3300009545 Ga0105237_10018840 Ga0105237_100188404 636
336 3300009545 Ga0105237_10022477 Ga0105237_100224772 636
337 3300009553 Ga0105249_10011270 Ga0105249_100112704 636
338 3300010375 Ga0105239_10002499 Ga0105239_1000249920 636
339 3300013100 Ga0157373_10009769 Ga0157373_100097693 636
340 3300013102 Ga0157371_10003293 Ga0157371_100032932 636
341 3300013102 Ga0157371_10024386 Ga0157371_100243863 636
342 3300013104 Ga0157370_10000022 Ga0157370_1000002233 636
343 3300013104 Ga0157370_10006106 Ga0157370_100061064 636
344 3300013104 Ga0157370_10147459 Ga0157370_101474592 636
345 3300013105 Ga0157369_10000005 Ga0157369_1000000527 636
346 3300013297 Ga0157378_10000842 Ga0157378_1000084218 636
347 3300013297 Ga0157378_10139577 Ga0157378_101395771 636
348 3300013306 Ga0163162_10004020 Ga0163162_100040204 636
349 3300013306 Ga0163162_10004208 Ga0163162_100042082 636
350 3300013306 Ga0163162_10011353 Ga0163162_100113533 636
351 3300013307 Ga0157372_10001831 Ga0157372_100018312 636
352 3300014497 Ga0182008_10000168 Ga0182008_1000016829 636
353 3300015261 Ga0182006_1000215 Ga0182006_10002152 636
354 3300015262 Ga0182007_10000039 Ga0182007_1000003941 636
355 3300017792 Ga0163161_10001469 Ga0163161_100014694 636
356 3300017792 Ga0163161_10008497 Ga0163161_100084975 636
357 3300025903 Ga0207680_10000035 Ga0207680_1000003539 636
358 3300025911 Ga0207654_10004010 Ga0207654_100040104 636
359 3300025914 Ga0207671_10000341 Ga0207671_1000034144 636
360 3300025914 Ga0207671_10002429 Ga0207671_1000242912 636
361 3300025914 Ga0207671_10036030 Ga0207671_100360302 636
362 3300025914 Ga0207671_10045909 Ga0207671_100459092 636
363 3300025940 Ga0207691_10050403 Ga0207691_100504031 636
364 3300025942 Ga0207689_10000760 Ga0207689_1000076010 636
365 3300025961 Ga0207712_10010061 Ga0207712_100100614 636
366 3300025986 Ga0207658_10050261 Ga0207658_100502612 636
367 3300026035 Ga0207703_10021534 Ga0207703_100215343 636
368 3300026078 Ga0207702_10025956 Ga0207702_100259563 636
369 3300026088 Ga0207641_10000089 Ga0207641_1000008963 636
370 3300026089 Ga0207648_10111457 Ga0207648_101114571 636
371 3300026142 Ga0207698_10047430 Ga0207698_100474302 636
372 3300028381 Ga0268264_10001248 Ga0268264_100012484 636
373 3300028381 Ga0268264_10004783 Ga0268264_100047833 636
374 3300028556 Ga0265337_1000335 Ga0265337_100033510 636
375 3300028563 Ga0265319_1000157 Ga0265319_10001578 636
376 3300028573 Ga0265334_10002931 Ga0265334_100029314 636
377 3300028577 Ga0265318_10003421 Ga0265318_100034215 636
378 3300028654 Ga0265322_10004051 Ga0265322_100040513 636
379 3300028666 Ga0265336_10000278 Ga0265336_1000027827 636
380 3300028794 Ga0307515_10000076 Ga0307515_1000007673 636
381 3300028800 Ga0265338_10001413 Ga0265338_1000141320 636
382 3300028800 Ga0265338_10003207 Ga0265338_100032075 636
383 3300029957 Ga0265324_10005232 Ga0265324_100052323 636
384 3300031240 Ga0265320_10005996 Ga0265320_100059966 636
385 3300031241 Ga0265325_10003933 Ga0265325_100039334 636
386 3300031241 Ga0265325_10012911 Ga0265325_100129113 636
387 3300031247 Ga0265340_10002946 Ga0265340_100029464 636
388 3300031249 Ga0265339_10038346 Ga0265339_100383462 636
389 3300031595 Ga0265313_10004645 Ga0265313_100046452 636
390 3300031712 Ga0265342_10010675 Ga0265342_100106752 636
391 3300031731 Ga0307405_10000038 Ga0307405_100000387 636
392 3300031733 Ga0316577_10008655 Ga0316577_100086552 636
393 3300031903 Ga0307407_10000005 Ga0307407_10000005115 636
394 3300032002 Ga0307416_100000001 Ga0307416_10000000168 636
395 3300032004 Ga0307414_10023606 Ga0307414_100236062 636
396 3300036647 Ga0316582_0015619 Ga0316582_0015619_2364_4289 636
397 3300036712 Ga0316584_0000579 Ga0316584_0000579_2387_4312 636
398 3300044712 Ga0453684_0021778 Ga0453684_0021778_747_2666 636
399 3300046471 Ga0495650_0000057 Ga0495650_0000057_250725_252641 636
400 3300046507 Ga0495606_0000010 Ga0495606_0000010_89512_91425 636
401 3300046507 Ga0495606_0025158 Ga0495606_0025158_1617_3533 636
402 3300046513 Ga0495616_0018252 Ga0495616_0018252_1544_3460 636
403 3300046535 Ga0495586_0045549 Ga0495586_0045549_141_2075 636
404 3300046642 Ga0495634_0024995 Ga0495634_0024995_1539_3473 636
405 3300046660 Ga0495625_0000003 Ga0495625_0000003_511761_513677 636
406 3300046665 Ga0495661_0001280 Ga0495661_0001280_19229_21145 636
407 3300046694 Ga0495649_0000002 Ga0495649_0000002_493328_495244 636
408 3300047443 Ga0495687_007668 Ga0495687_007668_3855_5768 636
409 3300047443 Ga0495687_028373 Ga0495687_028373_289_2202 636
410 3300047472 Ga0495686_0022877 Ga0495686_0022877_1083_2999 636
411 3300048925 Ga0496122_0003531 Ga0496122_0003531_15014_16957 636
412 3300050509 nmdc:mga0qj67_102495_c1 nmdc:mga0qj67_102495_c1_269_2203 636
413 iso_pu_bacteria 2738543023 2739302346 636
414 iso_pu_bacteria 2857627736 2857628867 636

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

463

687

0.85

PF00756

Esterase

Putative esterase

103

324

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jt2-assembly1.cif.gz_A structural basis for the substrate specificity of the ferul domain of the cellulosomal xylanase z from c. thermocellum 0.9507 22 273
1jjf-assembly1.cif.gz_A structural basis for the substrate specificity of the feruloyl esterase domain of the cellulosomal xylanase z of clostridium thermocellum 0.9501 22 273
1jt2-assembly1.cif.gz_A structural basis for the substrate specificity of the ferul domain of the cellulosomal xylanase z from c. thermocellum 0.9102 22 273
1jjf-assembly1.cif.gz_A structural basis for the substrate specificity of the feruloyl esterase domain of the cellulosomal xylanase z of clostridium thermocellum 0.9097 22 273
5cxx-assembly3.cif.gz_C structure of a ce1 ferulic acid esterase, amce1/fae1a, from anaeromyces mucronatus in complex with ferulic acid 0.8969 20 276
ID Description Score Start End Superfamily
1jt2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9507 22 273 3.40.50.1820
af_P31471_131_389_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9203 391 636 3.40.50.1820
1jt2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9102 22 273 3.40.50.1820
af_A4HYV9_156_416_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9058 391 636 3.40.50.1820
af_P31471_28_126_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8831 305 363 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7C1HVZ4-F1-model_v4 Esterase 0.9985 154 278 GO:0016747
AF-A0A3N5YMA8-F1-model_v4 deleted 0.9983 401 636
AF-A0A848A8I9-F1-model_v4 deleted 0.9932 394 477
AF-A0A3L7RLP6-F1-model_v4 Esterase family protein 0.9906 46 276 GO:0016747
AF-A0A520A827-F1-model_v4 Esterase family protein 0.9894 27 210 GO:0016747

Feature Viewer

pLDDT pTM Quality
87.98 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map