F438156

General Info

Members Datasets Scaffolds Average Seq Length
413 222 826 168

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0889934|Ga0496112_0889934_46_597
Length 165
Sequence MILAQSAISCLAGREIRQMQIRVNERSWTVNAAPDTPLLYVLMNELQLQGPRFGCGLAQCGSCSVLVNGVELEGLPAFYAAQKKLAKAPALHPVQQAMIDEQAVQCGYCFNGMIIKSSELLSKTPKPTDAQIRTAMNGHLCRCGTYPRIMKAIQRASRVMTGGAV

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.6
Rhizosphere 94.92
Stem 0
Stem Tuber 0
Unclassified 17.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0889934 3300048915 Bacteria 813
2 Ga0058861_12074609 3300004800 Bacteria 740
3 Ga0065704_10373211 3300005289 Unclassified 782
4 Ga0065712_10274713 3300005290 Bacteria 899
5 Ga0065707_10039303 3300005295 Unclassified 905
6 Ga0070690_100000995 3300005330 Bacteria 14435
7 Ga0070690_100262651 3300005330 Bacteria 1225
8 Ga0070670_100059506 3300005331 Bacteria 3279
9 Ga0070670_100152218 3300005331 Bacteria 2002
10 Ga0068869_100012171 3300005334 Bacteria 5674
11 Ga0070666_10016539 3300005335 Bacteria 4720
12 Ga0070680_100008717 3300005336 Bacteria 7776
13 Ga0070680_100543623 3300005336 Unclassified 995
14 Ga0068868_100039341 3300005338 Bacteria 3675
15 Ga0068868_100041913 3300005338 Bacteria 3569
16 Ga0070661_100014284 3300005344 Bacteria 5594
17 Ga0070661_100551805 3300005344 Unclassified 927
18 Ga0070675_100082041 3300005354 Bacteria 2690
19 Ga0070675_100089267 3300005354 Bacteria 2581
20 Ga0070671_100007388 3300005355 Bacteria 8778
21 Ga0070673_100078277 3300005364 Bacteria 2675
22 Ga0070673_101949706 3300005364 Bacteria 557
23 Ga0070667_100001653 3300005367 Bacteria 19933
24 Ga0070667_100034027 3300005367 Bacteria 4263
25 Ga0070709_10296695 3300005434 Unclassified 1179
26 Ga0070709_10300831 3300005434 Bacteria 1172
27 Ga0070709_11110164 3300005434 Bacteria 633
28 Ga0070713_100071166 3300005436 Bacteria 2938
29 Ga0070713_100184169 3300005436 Unclassified 1878
30 Ga0070713_100511912 3300005436 Unclassified 1133
31 Ga0070713_100688048 3300005436 Unclassified 976
32 Ga0070711_100148000 3300005439 Bacteria 1768
33 Ga0070711_100302206 3300005439 Bacteria 1273
34 Ga0070711_100327759 3300005439 Unclassified 1225
35 Ga0070663_100790655 3300005455 Bacteria 813
36 Ga0070678_100127016 3300005456 Bacteria 2020
37 Ga0070681_10104359 3300005458 Bacteria 2777
38 Ga0070681_10770780 3300005458 Bacteria 879
39 Ga0070681_10823515 3300005458 Bacteria 846
40 Ga0068867_100311828 3300005459 Bacteria 1300
41 Ga0070685_10041985 3300005466 Bacteria 2608
42 Ga0070698_100756378 3300005471 Bacteria 915
43 Ga0070679_100017005 3300005530 Bacteria 7030
44 Ga0070684_100010143 3300005535 Bacteria 7448
45 Ga0070684_100168279 3300005535 Bacteria 1990
46 Ga0070697_100668441 3300005536 Unclassified 915
47 Ga0068853_100207351 3300005539 Unclassified 1786
48 Ga0070672_100019178 3300005543 Bacteria 4961
49 Ga0070696_100129771 3300005546 Bacteria 1833
50 Ga0070665_100428882 3300005548 Bacteria 1331
51 Ga0068855_100021792 3300005563 Bacteria 7685
52 Ga0068855_100261288 3300005563 Unclassified 1928
53 Ga0070664_100007056 3300005564 Bacteria 9066
54 Ga0068857_100007314 3300005577 Bacteria 9511
55 Ga0068856_100025412 3300005614 Bacteria 5776
56 Ga0070702_100820872 3300005615 Bacteria 721
57 Ga0068859_100041686 3300005617 Bacteria 4611
58 Ga0068859_100057467 3300005617 Bacteria 3919
59 Ga0068859_100991990 3300005617 Bacteria 922
60 Ga0068859_101694190 3300005617 Unclassified 698
61 Ga0068864_100013640 3300005618 Bacteria 6737
62 Ga0068864_100248212 3300005618 Bacteria 1651
63 Ga0068863_100011261 3300005841 Bacteria 8663
64 Ga0068863_100028949 3300005841 Bacteria 5290
65 Ga0068863_100144592 3300005841 Bacteria 2274
66 Ga0068863_101299377 3300005841 Bacteria 734
67 Ga0068858_100001948 3300005842 Bacteria 21050
68 Ga0068858_100028339 3300005842 Bacteria 5204
69 Ga0068858_100045007 3300005842 Bacteria 4090
70 Ga0068858_100081142 3300005842 Bacteria 3014
71 Ga0068860_100002778 3300005843 Bacteria 18198
72 Ga0068860_100160643 3300005843 Bacteria 2166
73 Ga0068860_100670854 3300005843 Unclassified 1045
74 Ga0068860_100743576 3300005843 Unclassified 992
75 Ga0068860_101082921 3300005843 Bacteria 820
76 Ga0081455_10034424 3300005937 Bacteria 4537
77 Ga0081455_10526686 3300005937 Unclassified 787
78 Ga0081540_1022332 3300005983 Bacteria 3738
79 Ga0070717_10195636 3300006028 Bacteria 1768
80 Ga0070716_100229613 3300006173 Unclassified 1252
81 Ga0070712_101472366 3300006175 Bacteria 595
82 Ga0097621_100099134 3300006237 Bacteria 2449
83 Ga0097621_100121001 3300006237 Unclassified 2220
84 Ga0097621_100303578 3300006237 Bacteria 1410
85 Ga0097621_100366729 3300006237 Bacteria 1284
86 Ga0097621_100392176 3300006237 Bacteria 1242
87 Ga0097621_100852506 3300006237 Unclassified 846
88 Ga0068871_100022737 3300006358 Bacteria 4838
89 Ga0068871_100107625 3300006358 Unclassified 2342
90 Ga0068871_100128889 3300006358 Bacteria 2143
91 Ga0068871_100159299 3300006358 Bacteria 1929
92 Ga0068871_100270621 3300006358 Bacteria 1484
93 Ga0068871_100285693 3300006358 Bacteria 1444
94 Ga0068871_100326123 3300006358 Bacteria 1353
95 Ga0068871_100647095 3300006358 Unclassified 965
96 Ga0075428_100724215 3300006844 Unclassified 1059
97 Ga0075433_10371358 3300006852 Bacteria 1263
98 Ga0075433_11066174 3300006852 Unclassified 703
99 Ga0075434_100024043 3300006871 Bacteria 5951
100 Ga0075434_100251731 3300006871 Unclassified 1786
101 Ga0075429_100138018 3300006880 Bacteria 2134
102 Ga0068865_100176451 3300006881 Bacteria 1642
103 Ga0068865_100601916 3300006881 Bacteria 929
104 Ga0068865_100688544 3300006881 Bacteria 872
105 Ga0097620_100041686 3300006931 Bacteria 4611
106 Ga0097620_100057467 3300006931 Bacteria 3919
107 Ga0097620_100992179 3300006931 Bacteria 922
108 Ga0097620_101694265 3300006931 Unclassified 698
109 Ga0099795_10001248 3300007788 Bacteria 5395
110 Ga0099795_10053935 3300007788 Bacteria 1472
111 Ga0105240_10028834 3300009093 Bacteria 7240
112 Ga0105240_10053353 3300009093 Bacteria 5074
113 Ga0105240_10164884 3300009093 Bacteria 2629
114 Ga0105240_10943129 3300009093 Bacteria 926
115 Ga0105240_11621517 3300009093 Unclassified 676
116 Ga0111539_10104350 3300009094 Bacteria 3326
117 Ga0111539_10141661 3300009094 Bacteria 2815
118 Ga0111539_10662974 3300009094 Unclassified 1215
119 Ga0105245_10003747 3300009098 Bacteria 13545
120 Ga0105245_10339770 3300009098 Bacteria 1484
121 Ga0105245_10977380 3300009098 Bacteria 890
122 Ga0105245_11891618 3300009098 Bacteria 650
123 Ga0105247_10050980 3300009101 Unclassified 2548
124 Ga0105247_10492695 3300009101 Bacteria 891
125 Ga0114129_10043798 3300009147 Bacteria 6298
126 Ga0114129_10490102 3300009147 Bacteria 1607
127 Ga0105243_10369723 3300009148 Unclassified 1322
128 Ga0105243_10902134 3300009148 Bacteria 879
129 Ga0105241_10004990 3300009174 Bacteria 9793
130 Ga0105242_10038023 3300009176 Bacteria 3868
131 Ga0105242_10060151 3300009176 Bacteria 3120
132 Ga0105242_10172851 3300009176 Bacteria 1900
133 Ga0105242_10271335 3300009176 Bacteria 1537
134 Ga0105242_10401300 3300009176 Bacteria 1280
135 Ga0105248_10007692 3300009177 Bacteria 11839
136 Ga0105248_10012088 3300009177 Bacteria 9524
137 Ga0105248_10118583 3300009177 Bacteria 2985
138 Ga0105248_10127514 3300009177 Unclassified 2871
139 Ga0105248_10250023 3300009177 Bacteria 1995
140 Ga0105248_10995883 3300009177 Unclassified 947
141 Ga0105248_11110675 3300009177 Bacteria 894
142 Ga0105237_10011649 3300009545 Bacteria 9304
143 Ga0105237_10137155 3300009545 Bacteria 2441
144 Ga0105238_10014651 3300009551 Bacteria 7929
145 Ga0105238_10014694 3300009551 Bacteria 7915
146 Ga0105249_10007424 3300009553 Bacteria 9561
147 Ga0105249_10066079 3300009553 Bacteria 3329
148 Ga0099796_10011183 3300010159 Bacteria 2495
149 Ga0099796_10078787 3300010159 Bacteria 1204
150 Ga0105239_10418681 3300010375 Unclassified 1517
151 Ga0105239_10664147 3300010375 Unclassified 1191
152 Ga0105246_10006855 3300011119 Bacteria 6967
153 Ga0157370_10006085 3300013104 Bacteria 13393
154 Ga0157370_10020995 3300013104 Bacteria 6512
155 Ga0157369_10016131 3300013105 Bacteria 8407
156 Ga0157369_10088465 3300013105 Bacteria 3306
157 Ga0157369_10249200 3300013105 Unclassified 1854
158 Ga0157378_11483225 3300013297 Bacteria 722
159 Ga0163162_10002142 3300013306 Bacteria 18521
160 Ga0163162_10094790 3300013306 Bacteria 3071
161 Ga0163162_10146378 3300013306 Bacteria 2479
162 Ga0163162_11232853 3300013306 Bacteria 849
163 Ga0157372_10040686 3300013307 Bacteria 5135
164 Ga0157372_10269972 3300013307 Bacteria 1976
165 Ga0157375_10002867 3300013308 Bacteria 14933
166 Ga0157375_10017713 3300013308 Bacteria 6439
167 Ga0157375_10106456 3300013308 Bacteria 2896
168 Ga0157375_10386021 3300013308 Bacteria 1567
169 Ga0157375_10450757 3300013308 Bacteria 1452
170 Ga0157375_11950433 3300013308 Bacteria 697
171 Ga0163163_10002128 3300014325 Bacteria 16717
172 Ga0163163_10002332 3300014325 Bacteria 16040
173 Ga0163163_10005907 3300014325 Bacteria 10653
174 Ga0163163_10029441 3300014325 Bacteria 5282
175 Ga0163163_10560960 3300014325 Bacteria 1205
176 Ga0157379_10127550 3300014968 Bacteria 2289
177 Ga0157379_10225840 3300014968 Bacteria 1697
178 Ga0157379_10374272 3300014968 Bacteria 1306
179 Ga0157379_10600567 3300014968 Bacteria 1027
180 Ga0157376_10002692 3300014969 Bacteria 12092
181 Ga0157376_10083564 3300014969 Bacteria 2747
182 Ga0157376_10126847 3300014969 Bacteria 2271
183 Ga0157376_10129523 3300014969 Unclassified 2249
184 Ga0157376_10224865 3300014969 Bacteria 1740
185 Ga0157376_10542431 3300014969 Unclassified 1150
186 Ga0157376_10809209 3300014969 Unclassified 950
187 Ga0157376_11271321 3300014969 Unclassified 765
188 Ga0206353_11465081 3300020082 Bacteria 784
189 Ga0224572_1014085 3300024225 Bacteria 1527
190 Ga0207710_10268144 3300025900 Bacteria 857
191 Ga0207680_10014663 3300025903 Bacteria 4066
192 Ga0207699_10331153 3300025906 Bacteria 1070
193 Ga0207654_10012027 3300025911 Bacteria 4426
194 Ga0207707_10007739 3300025912 Bacteria 9354
195 Ga0207707_10083041 3300025912 Bacteria 2797
196 Ga0207707_10659176 3300025912 Bacteria 882
197 Ga0207695_10014069 3300025913 Bacteria 9502
198 Ga0207695_10054081 3300025913 Unclassified 4195
199 Ga0207671_10028893 3300025914 Bacteria 4142
200 Ga0207671_10472989 3300025914 Unclassified 999
201 Ga0207693_10391436 3300025915 Bacteria 1087
202 Ga0207663_10405214 3300025916 Bacteria 1044
203 Ga0207663_10660716 3300025916 Unclassified 825
204 Ga0207663_11039382 3300025916 Bacteria 658
205 Ga0207649_10198952 3300025920 Bacteria 1414
206 Ga0207649_10627868 3300025920 Unclassified 828
207 Ga0207652_10009853 3300025921 Bacteria 7688
208 Ga0207681_10978092 3300025923 Unclassified 710
209 Ga0207694_10004780 3300025924 Bacteria 10522
210 Ga0207694_10056470 3300025924 Unclassified 3049
211 Ga0207694_10665339 3300025924 Unclassified 878
212 Ga0207650_10101785 3300025925 Bacteria 2212
213 Ga0207650_10221261 3300025925 Bacteria 1524
214 Ga0207659_10053463 3300025926 Bacteria 2881
215 Ga0207687_10006782 3300025927 Bacteria 7547
216 Ga0207687_10009769 3300025927 Bacteria 6277
217 Ga0207687_10011599 3300025927 Bacteria 5760
218 Ga0207687_10356686 3300025927 Bacteria 1192
219 Ga0207687_10734494 3300025927 Bacteria 839
220 Ga0207700_10012304 3300025928 Bacteria 5510
221 Ga0207700_10035925 3300025928 Bacteria 3574
222 Ga0207700_10186666 3300025928 Unclassified 1740
223 Ga0207700_10703101 3300025928 Bacteria 902
224 Ga0207644_10034855 3300025931 Bacteria 3523
225 Ga0207686_10066719 3300025934 Bacteria 2299
226 Ga0207686_10077771 3300025934 Bacteria 2155
227 Ga0207686_10079157 3300025934 Bacteria 2139
228 Ga0207686_10171632 3300025934 Bacteria 1530
229 Ga0207709_10112756 3300025935 Bacteria 1821
230 Ga0207709_10216382 3300025935 Unclassified 1379
231 Ga0207704_10008598 3300025938 Bacteria 4890
232 Ga0207704_10079212 3300025938 Bacteria 2116
233 Ga0207704_10098270 3300025938 Bacteria 1944
234 Ga0207665_10805953 3300025939 Unclassified 742
235 Ga0207691_10021814 3300025940 Bacteria 6045
236 Ga0207711_10005278 3300025941 Bacteria 10952
237 Ga0207711_10007250 3300025941 Bacteria 9291
238 Ga0207711_10053953 3300025941 Bacteria 3448
239 Ga0207711_10354612 3300025941 Bacteria 1358
240 Ga0207711_10416710 3300025941 Bacteria 1249
241 Ga0207661_10003493 3300025944 Bacteria 10914
242 Ga0207661_10007350 3300025944 Bacteria 7836
243 Ga0207661_10843783 3300025944 Unclassified 843
244 Ga0207679_10010273 3300025945 Bacteria 6024
245 Ga0207667_10000938 3300025949 Bacteria 37175
246 Ga0207667_10025993 3300025949 Bacteria 6403
247 Ga0207651_11668467 3300025960 Bacteria 574
248 Ga0207712_10073365 3300025961 Unclassified 2468
249 Ga0207712_10108694 3300025961 Bacteria 2076
250 Ga0207658_10155150 3300025986 Bacteria 1870
251 Ga0207677_10005910 3300026023 Bacteria 6660
252 Ga0207677_10039624 3300026023 Bacteria 3100
253 Ga0207703_10004835 3300026035 Bacteria 10963
254 Ga0207703_10178026 3300026035 Unclassified 1875
255 Ga0207639_10014006 3300026041 Bacteria 5627
256 Ga0207702_10037856 3300026078 Bacteria 4039
257 Ga0207641_10048924 3300026088 Bacteria 3571
258 Ga0207641_10056731 3300026088 Bacteria 3329
259 Ga0207641_10094665 3300026088 Bacteria 2620
260 Ga0207648_10354515 3300026089 Bacteria 1323
261 Ga0207676_10004482 3300026095 Bacteria 9870
262 Ga0207676_10829343 3300026095 Unclassified 903
263 Ga0207674_10000659 3300026116 Bacteria 44890
264 Ga0207698_10001976 3300026142 Bacteria 12066
265 Ga0207698_11706644 3300026142 Bacteria 645
266 Ga0209179_1020245 3300027512 Bacteria 1289
267 Ga0209588_1014090 3300027671 Bacteria 2445
268 Ga0207428_10727133 3300027907 Bacteria 709
269 Ga0265357_1001480 3300028023 Bacteria 1735
270 Ga0268265_11224851 3300028380 Unclassified 749
271 Ga0268264_10014148 3300028381 Bacteria 6561
272 Ga0268264_10750226 3300028381 Unclassified 972
273 Ga0265760_10039988 3300031090 Bacteria 1396
274 Ga0265760_10040118 3300031090 Bacteria 1394
275 Ga0265330_10059053 3300031235 Unclassified 1671
276 Ga0265340_10017525 3300031247 Bacteria 3706
277 Ga0265313_10002007 3300031595 Bacteria 18280
278 Ga0265314_10001056 3300031711 Bacteria 32032
279 Ga0373938_0087881 3300034957 Bacteria 765
280 Ga0373929_0019711 3300035085 Bacteria 1353
281 Ga0373934_0003288 3300035086 Bacteria 5912
282 Ga0373923_0205624 3300035111 Bacteria 911
283 Ga0373923_0600849 3300035111 Bacteria 542
284 Ga0373932_0011841 3300035112 Bacteria 2138
285 Ga0373932_0049249 3300035112 Bacteria 1245
286 Ga0373945_0040422 3300035116 Bacteria 1684
287 Ga0373953_0193334 3300035117 Bacteria 879
288 Ga0373953_0215520 3300035117 Bacteria 831
289 Ga0373954_0003256 3300035118 Bacteria 6855
290 Ga0373957_0012047 3300035120 Unclassified 2902
291 Ga0373957_0064196 3300035120 Bacteria 1427
292 Ga0373960_0220530 3300035121 Bacteria 678
293 Ga0373946_0195387 3300035171 Bacteria 967
294 Ga0373955_0055511 3300035172 Bacteria 2170
295 Ga0373955_0717098 3300035172 Unclassified 614
296 Ga0373955_0719841 3300035172 Unclassified 613
297 Ga0373924_0064817 3300035410 Unclassified 1534
298 Ga0373931_0033591 3300035691 Bacteria 2659
299 Ga0373931_0235665 3300035691 Bacteria 1107
300 Ga0373935_0054163 3300035692 Bacteria 2553
301 Ga0373935_0299121 3300035692 Bacteria 1137
302 Ga0373927_0088595 3300035695 Bacteria 2009
303 Ga0373927_0132132 3300035695 Bacteria 1631
304 Ga0373927_0172860 3300035695 Bacteria 1416
305 Ga0373947_0126486 3300035725 Bacteria 1628
306 Ga0373947_0229795 3300035725 Bacteria 1222
307 Ga0373947_0252236 3300035725 Bacteria 1167
308 Ga0373937_0001605 3300036401 Bacteria 18991
309 Ga0373937_0027098 3300036401 Bacteria 5180
310 Ga0373937_0028863 3300036401 Bacteria 5023
311 Ga0373937_0035926 3300036401 Bacteria 4513
312 Ga0373937_0217005 3300036401 Bacteria 1800
313 Ga0373937_0530551 3300036401 Bacteria 1118
314 Ga0373937_0865335 3300036401 Unclassified 852
315 Ga0373925_0027810 3300037068 Bacteria 4140
316 Ga0373925_0039219 3300037068 Bacteria 3504
317 Ga0395900_0757403 3300037418 Bacteria 901
318 Ga0436364_1344421 3300037853 Bacteria 4009
319 Ga0395901_0084721 3300038443 Bacteria 3313
320 Ga0451853_3572502 3300041512 Bacteria 706
321 Ga0466957_0121346 3300044842 Bacteria 1666
322 Ga0466959_0322259 3300045049 Bacteria 1056
323 Ga0466958_0023165 3300045836 Bacteria 3642
324 Ga0495592_0003377 3300046454 Bacteria 11443
325 Ga0495651_0162876 3300046462 Bacteria 1596
326 Ga0495653_0340367 3300046463 Bacteria 967
327 Ga0495580_0044755 3300046472 Unclassified 3147
328 Ga0495580_0376511 3300046472 Bacteria 959
329 Ga0495580_0637669 3300046472 Bacteria 702
330 Ga0495582_0018387 3300046473 Bacteria 3822
331 Ga0495639_0037850 3300046475 Bacteria 2164
332 Ga0495639_0601915 3300046475 Bacteria 565
333 Ga0495608_0020738 3300046511 Unclassified 4515
334 Ga0495618_0005305 3300046514 Bacteria 7869
335 Ga0495618_0329309 3300046514 Unclassified 945
336 Ga0495628_0130318 3300046516 Bacteria 1924
337 Ga0495628_0496139 3300046516 Bacteria 882
338 Ga0495652_0216980 3300046529 Unclassified 1440
339 Ga0495665_0098665 3300046531 Bacteria 1533
340 Ga0495586_0124198 3300046535 Unclassified 1443
341 Ga0495586_0183800 3300046535 Bacteria 1183
342 Ga0495587_0001175 3300046536 Bacteria 17261
343 Ga0495587_0134803 3300046536 Bacteria 1411
344 Ga0495587_0172816 3300046536 Bacteria 1227
345 Ga0495587_0254602 3300046536 Bacteria 987
346 Ga0495645_0104122 3300046543 Unclassified 2016
347 Ga0495622_0211769 3300046557 Bacteria 861
348 Ga0495667_0003137 3300046559 Bacteria 11087
349 Ga0495667_0235735 3300046559 Bacteria 1166
350 Ga0495667_0279825 3300046559 Bacteria 1059
351 Ga0495634_0144287 3300046642 Bacteria 1509
352 Ga0495635_0360100 3300046663 Bacteria 970
353 Ga0495588_0090731 3300046674 Bacteria 1601
354 Ga0495657_0001063 3300046675 Bacteria 24027
355 Ga0495599_0002566 3300046678 Bacteria 10575
356 Ga0495623_0094191 3300046679 Bacteria 1832
357 Ga0495647_0055651 3300046681 Bacteria 1549
358 Ga0495658_0018216 3300046683 Bacteria 3646
359 Ga0495658_0082479 3300046683 Bacteria 1889
360 Ga0495658_0491357 3300046683 Unclassified 785
361 Ga0495669_0470720 3300046684 Unclassified 610
362 Ga0495613_0021442 3300046689 Bacteria 4815
363 Ga0495613_0709163 3300046689 Unclassified 662
364 Ga0495636_0056025 3300047318 Unclassified 1659
365 Ga0495674_0174321 3300047319 Bacteria 1793
366 Ga0495674_0751391 3300047319 Bacteria 762
367 Ga0495675_0166151 3300047444 Bacteria 1357
368 Ga0495684_0159657 3300047471 Bacteria 1682
369 Ga0495684_0177889 3300047471 Bacteria 1578
370 Ga0495602_0006388 3300048088 Bacteria 12365
371 Ga0496100_0060044 3300048903 Bacteria 2501
372 Ga0496100_0651968 3300048903 Bacteria 820
373 Ga0496101_0164574 3300048904 Bacteria 1702
374 Ga0496102_0424219 3300048905 Bacteria 1249
375 Ga0496104_0597790 3300048907 Bacteria 1013
376 Ga0496106_0035737 3300048909 Bacteria 3716
377 Ga0496106_0328507 3300048909 Bacteria 1228
378 Ga0496107_0275639 3300048910 Bacteria 1252
379 Ga0496107_0318056 3300048910 Bacteria 1158
380 Ga0496107_0392518 3300048910 Bacteria 1032
381 Ga0496110_0165559 3300048913 Bacteria 2005
382 Ga0496111_0396956 3300048914 Bacteria 1019
383 Ga0496112_0023894 3300048915 Bacteria 5847
384 Ga0496113_0380100 3300048916 Bacteria 1134
385 Ga0496114_0588523 3300048917 Bacteria 981
386 Ga0496115_0011545 3300048918 Bacteria 6621
387 Ga0496115_0202344 3300048918 Bacteria 1640
388 Ga0496115_0490578 3300048918 Bacteria 988
389 Ga0501047_0358403 3300049581 Bacteria 1294
390 Ga0501068_0081185 3300049584 Bacteria 1990
391 Ga0501070_0048687 3300049586 Bacteria 3520
392 Ga0501073_0291808 3300049589 Bacteria 1125
393 Ga0501074_0380703 3300049590 Bacteria 1001
394 Ga0501075_0447836 3300049591 Bacteria 985
395 Ga0501079_0674160 3300049741 Bacteria 814
396 Ga0501080_0081754 3300049742 Bacteria 3001
397 Ga0501083_0623851 3300049744 Bacteria 701
398 Ga0501045_0163686 3300049824 Bacteria 1656
399 nmdc:mga05p37_204105_c1 3300050507 Bacteria 2392
400 nmdc:mga09592_122085_c1 3300050508 Unclassified 2238
401 nmdc:mga0qj67_5_c1 3300050509 Bacteria 160703
402 nmdc:mga08y16_119727_c1 3300050511 Bacteria 2740
403 nmdc:mga08y16_89432_c1 3300050511 Bacteria 3209
404 nmdc:mga0n895_17400_c1 3300050512 Bacteria 6623
405 nmdc:mga0rr50_178805_c1 3300050513 Unclassified 1733
406 nmdc:mga0rr50_721012_c1 3300050513 Bacteria 851
407 nmdc:mga08x19_560916_c1 3300050514 Bacteria 808
408 nmdc:mga0a205_467714_c1 3300050515 Unclassified 1120
409 Ga0495601_0144976 3300053077 Bacteria 1550
410 Ga0495612_0074193 3300053078 Bacteria 1422
411 Ga0495595_0042369 3300053084 Bacteria 2085
412 Ga0495619_0081272 3300053085 Unclassified 2182
413 Ga0495619_0121975 3300053085 Bacteria 1787
414 Ga0496112_0889934
415 Ga0058861_12074609
416 Ga0065704_10373211
417 Ga0065712_10274713
418 Ga0065707_10039303
419 Ga0070690_100000995
420 Ga0070690_100262651
421 Ga0070670_100059506
422 Ga0070670_100152218
423 Ga0068869_100012171
424 Ga0070666_10016539
425 Ga0070680_100008717
426 Ga0070680_100543623
427 Ga0068868_100039341
428 Ga0068868_100041913
429 Ga0070661_100014284
430 Ga0070661_100551805
431 Ga0070675_100082041
432 Ga0070675_100089267
433 Ga0070671_100007388
434 Ga0070673_100078277
435 Ga0070673_101949706
436 Ga0070667_100001653
437 Ga0070667_100034027
438 Ga0070709_10296695
439 Ga0070709_10300831
440 Ga0070709_11110164
441 Ga0070713_100071166
442 Ga0070713_100184169
443 Ga0070713_100511912
444 Ga0070713_100688048
445 Ga0070711_100148000
446 Ga0070711_100302206
447 Ga0070711_100327759
448 Ga0070663_100790655
449 Ga0070678_100127016
450 Ga0070681_10104359
451 Ga0070681_10770780
452 Ga0070681_10823515
453 Ga0068867_100311828
454 Ga0070685_10041985
455 Ga0070698_100756378
456 Ga0070679_100017005
457 Ga0070684_100010143
458 Ga0070684_100168279
459 Ga0070697_100668441
460 Ga0068853_100207351
461 Ga0070672_100019178
462 Ga0070696_100129771
463 Ga0070665_100428882
464 Ga0068855_100021792
465 Ga0068855_100261288
466 Ga0070664_100007056
467 Ga0068857_100007314
468 Ga0068856_100025412
469 Ga0070702_100820872
470 Ga0068859_100041686
471 Ga0068859_100057467
472 Ga0068859_100991990
473 Ga0068859_101694190
474 Ga0068864_100013640
475 Ga0068864_100248212
476 Ga0068863_100011261
477 Ga0068863_100028949
478 Ga0068863_100144592
479 Ga0068863_101299377
480 Ga0068858_100001948
481 Ga0068858_100028339
482 Ga0068858_100045007
483 Ga0068858_100081142
484 Ga0068860_100002778
485 Ga0068860_100160643
486 Ga0068860_100670854
487 Ga0068860_100743576
488 Ga0068860_101082921
489 Ga0081455_10034424
490 Ga0081455_10526686
491 Ga0081540_1022332
492 Ga0070717_10195636
493 Ga0070716_100229613
494 Ga0070712_101472366
495 Ga0097621_100099134
496 Ga0097621_100121001
497 Ga0097621_100303578
498 Ga0097621_100366729
499 Ga0097621_100392176
500 Ga0097621_100852506
501 Ga0068871_100022737
502 Ga0068871_100107625
503 Ga0068871_100128889
504 Ga0068871_100159299
505 Ga0068871_100270621
506 Ga0068871_100285693
507 Ga0068871_100326123
508 Ga0068871_100647095
509 Ga0075428_100724215
510 Ga0075433_10371358
511 Ga0075433_11066174
512 Ga0075434_100024043
513 Ga0075434_100251731
514 Ga0075429_100138018
515 Ga0068865_100176451
516 Ga0068865_100601916
517 Ga0068865_100688544
518 Ga0097620_100041686
519 Ga0097620_100057467
520 Ga0097620_100992179
521 Ga0097620_101694265
522 Ga0099795_10001248
523 Ga0099795_10053935
524 Ga0105240_10028834
525 Ga0105240_10053353
526 Ga0105240_10164884
527 Ga0105240_10943129
528 Ga0105240_11621517
529 Ga0111539_10104350
530 Ga0111539_10141661
531 Ga0111539_10662974
532 Ga0105245_10003747
533 Ga0105245_10339770
534 Ga0105245_10977380
535 Ga0105245_11891618
536 Ga0105247_10050980
537 Ga0105247_10492695
538 Ga0114129_10043798
539 Ga0114129_10490102
540 Ga0105243_10369723
541 Ga0105243_10902134
542 Ga0105241_10004990
543 Ga0105242_10038023
544 Ga0105242_10060151
545 Ga0105242_10172851
546 Ga0105242_10271335
547 Ga0105242_10401300
548 Ga0105248_10007692
549 Ga0105248_10012088
550 Ga0105248_10118583
551 Ga0105248_10127514
552 Ga0105248_10250023
553 Ga0105248_10995883
554 Ga0105248_11110675
555 Ga0105237_10011649
556 Ga0105237_10137155
557 Ga0105238_10014651
558 Ga0105238_10014694
559 Ga0105249_10007424
560 Ga0105249_10066079
561 Ga0099796_10011183
562 Ga0099796_10078787
563 Ga0105239_10418681
564 Ga0105239_10664147
565 Ga0105246_10006855
566 Ga0157370_10006085
567 Ga0157370_10020995
568 Ga0157369_10016131
569 Ga0157369_10088465
570 Ga0157369_10249200
571 Ga0157378_11483225
572 Ga0163162_10002142
573 Ga0163162_10094790
574 Ga0163162_10146378
575 Ga0163162_11232853
576 Ga0157372_10040686
577 Ga0157372_10269972
578 Ga0157375_10002867
579 Ga0157375_10017713
580 Ga0157375_10106456
581 Ga0157375_10386021
582 Ga0157375_10450757
583 Ga0157375_11950433
584 Ga0163163_10002128
585 Ga0163163_10002332
586 Ga0163163_10005907
587 Ga0163163_10029441
588 Ga0163163_10560960
589 Ga0157379_10127550
590 Ga0157379_10225840
591 Ga0157379_10374272
592 Ga0157379_10600567
593 Ga0157376_10002692
594 Ga0157376_10083564
595 Ga0157376_10126847
596 Ga0157376_10129523
597 Ga0157376_10224865
598 Ga0157376_10542431
599 Ga0157376_10809209
600 Ga0157376_11271321
601 Ga0206353_11465081
602 Ga0224572_1014085
603 Ga0207710_10268144
604 Ga0207680_10014663
605 Ga0207699_10331153
606 Ga0207654_10012027
607 Ga0207707_10007739
608 Ga0207707_10083041
609 Ga0207707_10659176
610 Ga0207695_10014069
611 Ga0207695_10054081
612 Ga0207671_10028893
613 Ga0207671_10472989
614 Ga0207693_10391436
615 Ga0207663_10405214
616 Ga0207663_10660716
617 Ga0207663_11039382
618 Ga0207649_10198952
619 Ga0207649_10627868
620 Ga0207652_10009853
621 Ga0207681_10978092
622 Ga0207694_10004780
623 Ga0207694_10056470
624 Ga0207694_10665339
625 Ga0207650_10101785
626 Ga0207650_10221261
627 Ga0207659_10053463
628 Ga0207687_10006782
629 Ga0207687_10009769
630 Ga0207687_10011599
631 Ga0207687_10356686
632 Ga0207687_10734494
633 Ga0207700_10012304
634 Ga0207700_10035925
635 Ga0207700_10186666
636 Ga0207700_10703101
637 Ga0207644_10034855
638 Ga0207686_10066719
639 Ga0207686_10077771
640 Ga0207686_10079157
641 Ga0207686_10171632
642 Ga0207709_10112756
643 Ga0207709_10216382
644 Ga0207704_10008598
645 Ga0207704_10079212
646 Ga0207704_10098270
647 Ga0207665_10805953
648 Ga0207691_10021814
649 Ga0207711_10005278
650 Ga0207711_10007250
651 Ga0207711_10053953
652 Ga0207711_10354612
653 Ga0207711_10416710
654 Ga0207661_10003493
655 Ga0207661_10007350
656 Ga0207661_10843783
657 Ga0207679_10010273
658 Ga0207667_10000938
659 Ga0207667_10025993
660 Ga0207651_11668467
661 Ga0207712_10073365
662 Ga0207712_10108694
663 Ga0207658_10155150
664 Ga0207677_10005910
665 Ga0207677_10039624
666 Ga0207703_10004835
667 Ga0207703_10178026
668 Ga0207639_10014006
669 Ga0207702_10037856
670 Ga0207641_10048924
671 Ga0207641_10056731
672 Ga0207641_10094665
673 Ga0207648_10354515
674 Ga0207676_10004482
675 Ga0207676_10829343
676 Ga0207674_10000659
677 Ga0207698_10001976
678 Ga0207698_11706644
679 Ga0209179_1020245
680 Ga0209588_1014090
681 Ga0207428_10727133
682 Ga0265357_1001480
683 Ga0268265_11224851
684 Ga0268264_10014148
685 Ga0268264_10750226
686 Ga0265760_10039988
687 Ga0265760_10040118
688 Ga0265330_10059053
689 Ga0265340_10017525
690 Ga0265313_10002007
691 Ga0265314_10001056
692 Ga0373938_0087881
693 Ga0373929_0019711
694 Ga0373934_0003288
695 Ga0373923_0205624
696 Ga0373923_0600849
697 Ga0373932_0011841
698 Ga0373932_0049249
699 Ga0373945_0040422
700 Ga0373953_0193334
701 Ga0373953_0215520
702 Ga0373954_0003256
703 Ga0373957_0012047
704 Ga0373957_0064196
705 Ga0373960_0220530
706 Ga0373946_0195387
707 Ga0373955_0055511
708 Ga0373955_0717098
709 Ga0373955_0719841
710 Ga0373924_0064817
711 Ga0373931_0033591
712 Ga0373931_0235665
713 Ga0373935_0054163
714 Ga0373935_0299121
715 Ga0373927_0088595
716 Ga0373927_0132132
717 Ga0373927_0172860
718 Ga0373947_0126486
719 Ga0373947_0229795
720 Ga0373947_0252236
721 Ga0373937_0001605
722 Ga0373937_0027098
723 Ga0373937_0028863
724 Ga0373937_0035926
725 Ga0373937_0217005
726 Ga0373937_0530551
727 Ga0373937_0865335
728 Ga0373925_0027810
729 Ga0373925_0039219
730 Ga0395900_0757403
731 Ga0436364_1344421
732 Ga0395901_0084721
733 Ga0451853_3572502
734 Ga0466957_0121346
735 Ga0466959_0322259
736 Ga0466958_0023165
737 Ga0495592_0003377
738 Ga0495651_0162876
739 Ga0495653_0340367
740 Ga0495580_0044755
741 Ga0495580_0376511
742 Ga0495580_0637669
743 Ga0495582_0018387
744 Ga0495639_0037850
745 Ga0495639_0601915
746 Ga0495608_0020738
747 Ga0495618_0005305
748 Ga0495618_0329309
749 Ga0495628_0130318
750 Ga0495628_0496139
751 Ga0495652_0216980
752 Ga0495665_0098665
753 Ga0495586_0124198
754 Ga0495586_0183800
755 Ga0495587_0001175
756 Ga0495587_0134803
757 Ga0495587_0172816
758 Ga0495587_0254602
759 Ga0495645_0104122
760 Ga0495622_0211769
761 Ga0495667_0003137
762 Ga0495667_0235735
763 Ga0495667_0279825
764 Ga0495634_0144287
765 Ga0495635_0360100
766 Ga0495588_0090731
767 Ga0495657_0001063
768 Ga0495599_0002566
769 Ga0495623_0094191
770 Ga0495647_0055651
771 Ga0495658_0018216
772 Ga0495658_0082479
773 Ga0495658_0491357
774 Ga0495669_0470720
775 Ga0495613_0021442
776 Ga0495613_0709163
777 Ga0495636_0056025
778 Ga0495674_0174321
779 Ga0495674_0751391
780 Ga0495675_0166151
781 Ga0495684_0159657
782 Ga0495684_0177889
783 Ga0495602_0006388
784 Ga0496100_0060044
785 Ga0496100_0651968
786 Ga0496101_0164574
787 Ga0496102_0424219
788 Ga0496104_0597790
789 Ga0496106_0035737
790 Ga0496106_0328507
791 Ga0496107_0275639
792 Ga0496107_0318056
793 Ga0496107_0392518
794 Ga0496110_0165559
795 Ga0496111_0396956
796 Ga0496112_0023894
797 Ga0496113_0380100
798 Ga0496114_0588523
799 Ga0496115_0011545
800 Ga0496115_0202344
801 Ga0496115_0490578
802 Ga0501047_0358403
803 Ga0501068_0081185
804 Ga0501070_0048687
805 Ga0501073_0291808
806 Ga0501074_0380703
807 Ga0501075_0447836
808 Ga0501079_0674160
809 Ga0501080_0081754
810 Ga0501083_0623851
811 Ga0501045_0163686
812 nmdc:mga05p37_204105_c1
813 nmdc:mga09592_122085_c1
814 nmdc:mga0qj67_5_c1
815 nmdc:mga08y16_119727_c1
816 nmdc:mga08y16_89432_c1
817 nmdc:mga0n895_17400_c1
818 nmdc:mga0rr50_178805_c1
819 nmdc:mga0rr50_721012_c1
820 nmdc:mga08x19_560916_c1
821 nmdc:mga0a205_467714_c1
822 Ga0495601_0144976
823 Ga0495612_0074193
824 Ga0495595_0042369
825 Ga0495619_0081272
826 Ga0495619_0121975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

81

154

0.91

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

21

90

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ylf-assembly2.cif.gz_C insights into flavin-based electron bifurcation via the nadh-dependent reduced ferredoxin-nadp oxidoreductase structure 0.7478 37 71
6yj4-assembly1.cif.gz_G structure of yarrowia lipolytica complex i at 2.7 a 0.7397 3 74
7zmb-assembly1.cif.gz_A cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 2) 0.7182 3 74
8a1x-assembly1.cif.gz_F sodium pumping nadh-quinone oxidoreductase with inhibitor dqa 0.7109 4 77
8esz-assembly1.cif.gz_S1 structure of mitochondrial complex i from drosophila melanogaster, helix-locked state 0.7077 4 73
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9323 1 77 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9317 1 77 3.10.20.30
1alo001 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9247 3 74 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9205 1 76 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9173 3 77 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2V9JR17-F1-model_v4 (2Fe-2S)-binding protein 0.9943 5 79 GO:0051537
AF-A0A7V4ZSI2-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9883 5 80 GO:0051537
AF-A0A6L9J6X1-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9841 3 79 GO:0051537
AF-A0A1Q7AH13-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9836 3 79 GO:0051537
AF-A0A523G0Y4-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9812 1 76 GO:0051537

Map