F438130

General Info

Members Datasets Scaffolds Average Seq Length
413 188 826 242

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0024706|Ga0495603_0024706_2104_2844
Length 246
Sequence MRMSSLRIKRDGDVLHVTIAKPQRRNAFDAELIRELTEAFSDVGDARAVVLTGEGESFCAGADIEWQRSSIDLSYEDNVEDALRLYEMLAAVDGCPAPLVAWIQGYCLGGGCGLAACADVAIADESAKFGFSEVKLGIIPAVISPFVLAKIGSGAARRYVLTGERFGADVALRIGLVSEIAPAADHVVSDLLSSGPAAVREAKRLVRPDPGDGRALAELAARMRTSEEGQDGLRAFLERREPSWTA

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 1.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.04
Rhizosphere 85.47
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0024706 3300046455 Bacteria 3635
2 Ga0070658_10009834 3300005327 Bacteria 7683
3 Ga0070658_10025101 3300005327 Bacteria 4778
4 Ga0070683_100033177 3300005329 Bacteria 4706
5 Ga0070683_100042536 3300005329 Bacteria 4183
6 Ga0070683_100093342 3300005329 Bacteria 2827
7 Ga0070683_100141896 3300005329 Unclassified 2276
8 Ga0070683_100172342 3300005329 Bacteria 2054
9 Ga0070683_100225526 3300005329 Bacteria 1781
10 Ga0070680_100027877 3300005336 Bacteria 4526
11 Ga0070680_100057974 3300005336 Bacteria 3166
12 Ga0070680_100335269 3300005336 Bacteria 1285
13 Ga0070680_100432234 3300005336 Unclassified 1124
14 Ga0070660_100018733 3300005339 Bacteria 5064
15 Ga0070660_100026295 3300005339 Bacteria 4331
16 Ga0070660_100203959 3300005339 Bacteria 1604
17 Ga0070661_100013894 3300005344 Bacteria 5658
18 Ga0070661_100042442 3300005344 Bacteria 3320
19 Ga0070661_100053829 3300005344 Bacteria 2946
20 Ga0070661_100111874 3300005344 Unclassified 2040
21 Ga0070661_100207221 3300005344 Bacteria 1500
22 Ga0070671_100235975 3300005355 Bacteria 1552
23 Ga0070659_100008070 3300005366 Bacteria 7676
24 Ga0070659_100687800 3300005366 Bacteria 884
25 Ga0070708_100319287 3300005445 Bacteria 1463
26 Ga0070663_100642329 3300005455 Bacteria 897
27 Ga0070681_10022690 3300005458 Bacteria 6306
28 Ga0070681_10052234 3300005458 Bacteria 4076
29 Ga0070681_10112408 3300005458 Unclassified 2663
30 Ga0070681_10118980 3300005458 Unclassified 2578
31 Ga0070681_10148269 3300005458 Bacteria 2273
32 Ga0070681_10176470 3300005458 Bacteria 2058
33 Ga0070685_10291063 3300005466 Bacteria 1097
34 Ga0070706_100025961 3300005467 Bacteria 5390
35 Ga0070707_100302594 3300005468 Unclassified 1554
36 Ga0070698_100026449 3300005471 Bacteria 6040
37 Ga0070699_100147984 3300005518 Bacteria 2076
38 Ga0070679_100004606 3300005530 Bacteria 12730
39 Ga0070679_100018604 3300005530 Bacteria 6744
40 Ga0070679_100062605 3300005530 Bacteria 3709
41 Ga0070679_100062749 3300005530 Bacteria 3704
42 Ga0070684_100011940 3300005535 Bacteria 6938
43 Ga0070684_100020086 3300005535 Bacteria 5540
44 Ga0070684_100036359 3300005535 Bacteria 4219
45 Ga0070684_100075637 3300005535 Bacteria 2970
46 Ga0070684_100118068 3300005535 Bacteria 2384
47 Ga0070684_100166477 3300005535 Bacteria 2001
48 Ga0070684_100307852 3300005535 Bacteria 1454
49 Ga0070696_100088186 3300005546 Bacteria 2205
50 Ga0068855_100023338 3300005563 Bacteria 7408
51 Ga0068855_100064217 3300005563 Bacteria 4281
52 Ga0068855_100082269 3300005563 Bacteria 3731
53 Ga0068855_100318387 3300005563 Bacteria 1720
54 Ga0070664_100197474 3300005564 Archaea 1794
55 Ga0068857_100001430 3300005577 Bacteria 18914
56 Ga0068857_100062727 3300005577 Bacteria 3304
57 Ga0068857_100234251 3300005577 Bacteria 1680
58 Ga0068857_100257628 3300005577 Bacteria 1600
59 Ga0068857_100538211 3300005577 Bacteria 1099
60 Ga0068856_100124482 3300005614 Bacteria 2581
61 Ga0068856_100363508 3300005614 Bacteria 1466
62 Ga0068856_100509047 3300005614 Bacteria 1225
63 Ga0068856_100860674 3300005614 Viruses 926
64 Ga0068852_100033055 3300005616 Bacteria 4290
65 Ga0068852_100148052 3300005616 Bacteria 2180
66 Ga0081540_1028203 3300005983 Bacteria 3159
67 Ga0070717_10074898 3300006028 Bacteria 2831
68 Ga0070717_10308526 3300006028 Bacteria 1408
69 Ga0097621_100641359 3300006237 Bacteria 974
70 Ga0075429_100386689 3300006880 Bacteria 1225
71 Ga0075435_100040330 3300007076 Bacteria 3728
72 Ga0075435_100076678 3300007076 Bacteria 2740
73 Ga0105240_10410531 3300009093 Bacteria 1523
74 Ga0111539_10165059 3300009094 Bacteria 2590
75 Ga0105245_10049654 3300009098 Bacteria 3758
76 Ga0105245_10147046 3300009098 Bacteria 2224
77 Ga0105245_10441812 3300009098 Bacteria 1308
78 Ga0114129_10089389 3300009147 Bacteria 4269
79 Ga0114129_10123381 3300009147 Bacteria 3563
80 Ga0114129_11080370 3300009147 Bacteria 1006
81 Ga0105243_10072931 3300009148 Bacteria 2780
82 Ga0105242_10034248 3300009176 Bacteria 4072
83 Ga0105242_10144106 3300009176 Unclassified 2070
84 Ga0105242_10869605 3300009176 Bacteria 899
85 Ga0105237_10037415 3300009545 Bacteria 4905
86 Ga0105237_10055578 3300009545 Bacteria 3964
87 Ga0105238_10021148 3300009551 Bacteria 6631
88 Ga0105249_11026934 3300009553 Unclassified 894
89 Ga0157373_10264584 3300013100 Bacteria 1217
90 Ga0157370_10015594 3300013104 Bacteria 7721
91 Ga0157370_10019327 3300013104 Bacteria 6838
92 Ga0157370_10043296 3300013104 Bacteria 4334
93 Ga0157369_10001694 3300013105 Bacteria 26852
94 Ga0157369_10019574 3300013105 Bacteria 7575
95 Ga0157369_10020161 3300013105 Bacteria 7456
96 Ga0157369_10168155 3300013105 Unclassified 2311
97 Ga0157374_10146880 3300013296 Unclassified 2290
98 Ga0157374_10155942 3300013296 Bacteria 2222
99 Ga0157372_10129326 3300013307 Bacteria 2904
100 Ga0157372_10411533 3300013307 Bacteria 1576
101 Ga0157375_11118100 3300013308 Bacteria 923
102 Ga0182008_10092930 3300014497 Bacteria 1488
103 Ga0197907_10467557 3300020069 Bacteria 1322
104 Ga0206354_11311267 3300020081 Bacteria 2272
105 Ga0206354_11413394 3300020081 Bacteria 1221
106 Ga0206353_10946294 3300020082 Unclassified 1397
107 Ga0206353_11039692 3300020082 Bacteria 5444
108 Ga0206353_11332917 3300020082 Bacteria 5384
109 Ga0207688_10084236 3300025901 Bacteria 1820
110 Ga0207705_10108075 3300025909 Bacteria 2053
111 Ga0207707_10096413 3300025912 Bacteria 2585
112 Ga0207707_10374697 3300025912 Bacteria 1224
113 Ga0207695_10131004 3300025913 Bacteria 2465
114 Ga0207695_10266634 3300025913 Viruses 1609
115 Ga0207671_10049448 3300025914 Unclassified 3113
116 Ga0207660_10035154 3300025917 Bacteria 3476
117 Ga0207660_10288766 3300025917 Bacteria 1304
118 Ga0207657_10002378 3300025919 Bacteria 20354
119 Ga0207657_10005185 3300025919 Bacteria 13668
120 Ga0207657_10015331 3300025919 Bacteria 7429
121 Ga0207657_10021024 3300025919 Bacteria 6152
122 Ga0207657_10491372 3300025919 Bacteria 962
123 Ga0207649_10014580 3300025920 Bacteria 4402
124 Ga0207649_10049212 3300025920 Bacteria 2602
125 Ga0207649_10232361 3300025920 Bacteria 1319
126 Ga0207649_10431120 3300025920 Bacteria 992
127 Ga0207652_10519982 3300025921 Unclassified 1071
128 Ga0207646_10114639 3300025922 Bacteria 2420
129 Ga0207646_10517618 3300025922 Bacteria 1074
130 Ga0207694_10106577 3300025924 Bacteria 2226
131 Ga0207687_10273598 3300025927 Bacteria 1351
132 Ga0207664_10560983 3300025929 Bacteria 1025
133 Ga0207664_10684167 3300025929 Bacteria 922
134 Ga0207690_10267653 3300025932 Bacteria 1326
135 Ga0207706_10701748 3300025933 Bacteria 864
136 Ga0207709_10192366 3300025935 Unclassified 1450
137 Ga0207709_10225377 3300025935 Bacteria 1354
138 Ga0207704_10472793 3300025938 Unclassified 1005
139 Ga0207665_10187506 3300025939 Bacteria 1501
140 Ga0207711_10230027 3300025941 Bacteria 1698
141 Ga0207661_10013023 3300025944 Bacteria 6069
142 Ga0207661_10069282 3300025944 Unclassified 2876
143 Ga0207661_10210659 3300025944 Bacteria 1713
144 Ga0207661_10260293 3300025944 Bacteria 1545
145 Ga0207661_10640357 3300025944 Bacteria 977
146 Ga0207679_10205477 3300025945 Bacteria 1648
147 Ga0207667_10133805 3300025949 Bacteria 2553
148 Ga0207667_10178473 3300025949 Bacteria 2181
149 Ga0207667_10326033 3300025949 Bacteria 1568
150 Ga0207667_10410537 3300025949 Bacteria 1378
151 Ga0207712_10705495 3300025961 Unclassified 881
152 Ga0207677_10056458 3300026023 Bacteria 2691
153 Ga0207639_10212328 3300026041 Bacteria 1667
154 Ga0207639_10300694 3300026041 Bacteria 1418
155 Ga0207702_10855198 3300026078 Viruses 900
156 Ga0207674_10007738 3300026116 Bacteria 12506
157 Ga0207674_10104970 3300026116 Bacteria 2804
158 Ga0207674_10117544 3300026116 Bacteria 2630
159 Ga0207674_10161387 3300026116 Bacteria 2196
160 Ga0207674_10397328 3300026116 Bacteria 1332
161 Ga0207683_10060267 3300026121 Bacteria 3336
162 Ga0207698_10375888 3300026142 Bacteria 1350
163 Ga0268266_10689659 3300028379 Unclassified 984
164 Ga0265318_10039455 3300028577 Bacteria 1802
165 Ga0265322_10004957 3300028654 Bacteria 3948
166 Ga0265322_10041686 3300028654 Bacteria 1307
167 Ga0265338_10002899 3300028800 Bacteria 24960
168 Ga0265338_10016797 3300028800 Bacteria 7927
169 Ga0265325_10009897 3300031241 Bacteria 5547
170 Ga0265340_10046249 3300031247 Bacteria 2123
171 Ga0265340_10048790 3300031247 Bacteria 2058
172 Ga0265339_10043531 3300031249 Bacteria 2482
173 Ga0265327_10003899 3300031251 Bacteria 13720
174 Ga0265316_10004010 3300031344 Bacteria 14745
175 Ga0265313_10004245 3300031595 Bacteria 11111
176 Ga0265314_10010034 3300031711 Bacteria 7939
177 Ga0307416_100043112 3300032002 Bacteria 3530
178 Ga0373945_0024836 3300035116 Bacteria 2079
179 Ga0373943_0000800 3300035170 Bacteria 13806
180 Ga0373935_0043605 3300035692 Bacteria 2824
181 Ga0373947_0000652 3300035725 Bacteria 20593
182 Ga0373925_0001708 3300037068 Bacteria 18502
183 Ga0395899_0068047 3300037312 Bacteria 2612
184 Ga0395899_0076375 3300037312 Bacteria 2445
185 Ga0395899_0132853 3300037312 Bacteria 1776
186 Ga0395900_0042796 3300037418 Bacteria 4666
187 Ga0395900_0074243 3300037418 Bacteria 3497
188 Ga0395900_0074694 3300037418 Bacteria 3485
189 Ga0395900_0076713 3300037418 Bacteria 3434
190 Ga0395900_0267668 3300037418 Bacteria 1704
191 Ga0395900_0416892 3300037418 Bacteria 1304
192 Ga0395900_0652136 3300037418 Bacteria 989
193 Ga0395898_0026495 3300037466 Bacteria 5832
194 Ga0395898_0053547 3300037466 Bacteria 3941
195 Ga0395898_0056612 3300037466 Bacteria 3821
196 Ga0395898_0199071 3300037466 Bacteria 1913
197 Ga0395898_0281400 3300037466 Bacteria 1587
198 Ga0395898_0367228 3300037466 Unclassified 1372
199 Ga0395905_0071200 3300037471 Bacteria 3260
200 Ga0395905_0170547 3300037471 Unclassified 2044
201 Ga0395905_0264913 3300037471 Bacteria 1604
202 Ga0395905_0283880 3300037471 Bacteria 1542
203 Ga0395901_0005601 3300038443 Bacteria 12710
204 Ga0395901_0028404 3300038443 Bacteria 5752
205 Ga0395901_0055221 3300038443 Bacteria 4130
206 Ga0395901_0079812 3300038443 Bacteria 3416
207 Ga0395901_0093215 3300038443 Bacteria 3153
208 Ga0395901_0139079 3300038443 Bacteria 2552
209 Ga0395901_0214716 3300038443 Unclassified 2012
210 Ga0395901_0451240 3300038443 Bacteria 1315
211 Ga0395901_0511668 3300038443 Bacteria 1221
212 Ga0436363_1584113 3300039450 Bacteria 933
213 Ga0436362_0467121 3300039453 Bacteria 804
214 Ga0451853_0075298 3300041512 Bacteria 2428
215 Ga0439455_0057542 3300042012 Bacteria 1026
216 Ga0466966_0018387 3300044684 Bacteria 4610
217 Ga0466966_0246579 3300044684 Bacteria 1076
218 Ga0466966_0284927 3300044684 Bacteria 993
219 Ga0466961_0120728 3300044693 Bacteria 1646
220 Ga0466963_0019523 3300044694 Bacteria 4253
221 Ga0466963_0026793 3300044694 Bacteria 3688
222 Ga0466963_0028048 3300044694 Bacteria 3611
223 Ga0466963_0052020 3300044694 Bacteria 2717
224 Ga0466963_0087889 3300044694 Bacteria 2114
225 Ga0466963_0216697 3300044694 Bacteria 1340
226 Ga0466964_0003589 3300044706 Bacteria 5667
227 Ga0466964_0003703 3300044706 Bacteria 5598
228 Ga0466964_0043368 3300044706 Bacteria 1824
229 Ga0466968_0052277 3300044735 Bacteria 1748
230 Ga0466970_0128892 3300044765 Bacteria 1389
231 Ga0466957_0094450 3300044842 Bacteria 1878
232 Ga0466959_0085361 3300045049 Bacteria 2272
233 Ga0466959_0093379 3300045049 Bacteria 2159
234 Ga0466958_0014903 3300045836 Bacteria 4444
235 Ga0466958_0031046 3300045836 Bacteria 3176
236 Ga0466958_0142261 3300045836 Bacteria 1511
237 Ga0466967_0004107 3300045976 Bacteria 9726
238 Ga0466967_0017290 3300045976 Bacteria 5720
239 Ga0466967_0022553 3300045976 Bacteria 5141
240 Ga0466967_0080374 3300045976 Bacteria 2941
241 Ga0466967_0097856 3300045976 Bacteria 2678
242 Ga0466967_0104718 3300045976 Bacteria 2590
243 Ga0466967_0316250 3300045976 Bacteria 1505
244 Ga0466967_0394504 3300045976 Bacteria 1345
245 Ga0495603_0056825 3300046455 Bacteria 2316
246 Ga0495629_0002345 3300046459 Bacteria 14588
247 Ga0495629_0139328 3300046459 Bacteria 1688
248 Ga0495641_0000626 3300046461 Bacteria 29773
249 Ga0495641_0042214 3300046461 Bacteria 2115
250 Ga0495641_0044430 3300046461 Bacteria 2050
251 Ga0495651_0023691 3300046462 Bacteria 4773
252 Ga0495651_0164123 3300046462 Bacteria 1588
253 Ga0495651_0232975 3300046462 Unclassified 1267
254 Ga0495582_0003901 3300046473 Bacteria 8377
255 Ga0495582_0071776 3300046473 Bacteria 1915
256 Ga0495662_0001172 3300046476 Bacteria 12928
257 Ga0495664_0021370 3300046477 Bacteria 3739
258 Ga0495584_0112552 3300046491 Unclassified 1377
259 Ga0495608_0145280 3300046511 Bacteria 1513
260 Ga0495608_0154712 3300046511 Bacteria 1460
261 Ga0495618_0071215 3300046514 Bacteria 2212
262 Ga0495618_0187828 3300046514 Bacteria 1311
263 Ga0495628_0019690 3300046516 Bacteria 5575
264 Ga0495628_0034108 3300046516 Bacteria 4097
265 Ga0495628_0085846 3300046516 Bacteria 2441
266 Ga0495628_0277090 3300046516 Bacteria 1246
267 Ga0495630_0015061 3300046517 Bacteria 5642
268 Ga0495630_0041530 3300046517 Bacteria 3435
269 Ga0495630_0110654 3300046517 Bacteria 2080
270 Ga0495630_0415946 3300046517 Bacteria 1030
271 Ga0495637_0122392 3300046520 Unclassified 1000
272 Ga0495652_0081495 3300046529 Bacteria 2669
273 Ga0495652_0101675 3300046529 Bacteria 2329
274 Ga0495652_0137849 3300046529 Bacteria 1922
275 Ga0495652_0247895 3300046529 Bacteria 1321
276 Ga0495665_0003782 3300046531 Bacteria 8191
277 Ga0495665_0020884 3300046531 Bacteria 3518
278 Ga0495640_0015258 3300046533 Bacteria 5784
279 Ga0495640_0130977 3300046533 Bacteria 1623
280 Ga0495586_0134810 3300046535 Bacteria 1384
281 Ga0495587_0068476 3300046536 Bacteria 2067
282 Ga0495645_0226670 3300046543 Bacteria 1254
283 Ga0495667_0017776 3300046559 Bacteria 4803
284 Ga0495656_0191959 3300046615 Unclassified 1009
285 Ga0495634_0026260 3300046642 Bacteria 4066
286 Ga0495634_0105634 3300046642 Bacteria 1815
287 Ga0495635_0019996 3300046663 Bacteria 4666
288 Ga0495657_0041833 3300046675 Bacteria 3133
289 Ga0495657_0096142 3300046675 Bacteria 1893
290 Ga0495657_0111758 3300046675 Bacteria 1730
291 Ga0495599_0058839 3300046678 Bacteria 2404
292 Ga0495599_0214335 3300046678 Bacteria 1180
293 Ga0495658_0001427 3300046683 Bacteria 12566
294 Ga0495658_0097053 3300046683 Bacteria 1754
295 Ga0495613_0010516 3300046689 Bacteria 6868
296 Ga0495624_0022252 3300046690 Bacteria 4194
297 Ga0495600_0010514 3300046809 Bacteria 5747
298 Ga0495600_0039356 3300046809 Bacteria 3079
299 Ga0495600_0100011 3300046809 Bacteria 1890
300 Ga0495600_0113701 3300046809 Bacteria 1762
301 Ga0495660_0233861 3300046810 Bacteria 860
302 Ga0495581_0010241 3300047315 Bacteria 5423
303 Ga0495581_0033322 3300047315 Bacteria 2982
304 Ga0495604_0011897 3300047317 Bacteria 6920
305 Ga0495604_0029512 3300047317 Bacteria 4363
306 Ga0495604_0193851 3300047317 Bacteria 1414
307 Ga0495674_0009149 3300047319 Bacteria 9414
308 Ga0495674_0016720 3300047319 Bacteria 6843
309 Ga0495674_0073789 3300047319 Bacteria 2940
310 Ga0495676_0005137 3300047321 Bacteria 11991
311 Ga0495676_0006729 3300047321 Bacteria 10576
312 Ga0495680_0002917 3300047322 Bacteria 17178
313 Ga0495680_0006666 3300047322 Bacteria 10694
314 Ga0495680_0009133 3300047322 Bacteria 8948
315 Ga0495680_0035962 3300047322 Bacteria 3982
316 Ga0495684_0019099 3300047471 Bacteria 5278
317 Ga0495684_0139049 3300047471 Bacteria 1821
318 Ga0495684_0158520 3300047471 Bacteria 1689
319 Ga0495593_0012291 3300047673 Bacteria 4892
320 Ga0495602_0195210 3300048088 Unclassified 1549
321 Ga0496100_0000752 3300048903 Bacteria 15462
322 Ga0496100_0077852 3300048903 Bacteria 2231
323 Ga0496100_0101538 3300048903 Bacteria 1983
324 Ga0496101_0002633 3300048904 Bacteria 11027
325 Ga0496101_0005711 3300048904 Bacteria 7945
326 Ga0496101_0042238 3300048904 Bacteria 3254
327 Ga0496101_0219033 3300048904 Bacteria 1476
328 Ga0496101_0635414 3300048904 Unclassified 844
329 Ga0496102_0002544 3300048905 Bacteria 15560
330 Ga0496102_0048467 3300048905 Bacteria 3863
331 Ga0496102_0563818 3300048905 Bacteria 1061
332 Ga0496102_0708046 3300048905 Unclassified 930
333 Ga0496103_0004252 3300048906 Bacteria 8701
334 Ga0496104_0001544 3300048907 Bacteria 19867
335 Ga0496104_0380064 3300048907 Unclassified 1325
336 Ga0496104_0665795 3300048907 Bacteria 950
337 Ga0496105_0088987 3300048908 Bacteria 2550
338 Ga0496105_0110947 3300048908 Bacteria 2264
339 Ga0496106_0032470 3300048909 Bacteria 3892
340 Ga0496106_0159668 3300048909 Bacteria 1782
341 Ga0496106_0313868 3300048909 Bacteria 1258
342 Ga0496107_0000933 3300048910 Bacteria 17270
343 Ga0496107_0006099 3300048910 Bacteria 8281
344 Ga0496107_0010327 3300048910 Bacteria 6485
345 Ga0496107_0204296 3300048910 Bacteria 1468
346 Ga0496108_0023669 3300048911 Bacteria 5054
347 Ga0496108_0184317 3300048911 Unclassified 1808
348 Ga0496108_0209478 3300048911 Bacteria 1692
349 Ga0496109_0010583 3300048912 Bacteria 7889
350 Ga0496109_0026904 3300048912 Bacteria 5131
351 Ga0496109_0041856 3300048912 Bacteria 4150
352 Ga0496109_0055698 3300048912 Unclassified 3607
353 Ga0496109_0111716 3300048912 Bacteria 2541
354 Ga0496110_0025511 3300048913 Bacteria 5052
355 Ga0496110_0107981 3300048913 Bacteria 2499
356 Ga0496110_0294285 3300048913 Bacteria 1479
357 Ga0496110_0358275 3300048913 Bacteria 1329
358 Ga0496110_0382582 3300048913 Bacteria 1282
359 Ga0496111_0028669 3300048914 Bacteria 3947
360 Ga0496111_0095227 3300048914 Bacteria 2184
361 Ga0496111_0176611 3300048914 Bacteria 1587
362 Ga0496112_0001209 3300048915 Bacteria 19393
363 Ga0496112_0013683 3300048915 Bacteria 7498
364 Ga0496112_0103819 3300048915 Bacteria 2812
365 Ga0496113_0112837 3300048916 Bacteria 2118
366 Ga0496113_0524643 3300048916 Unclassified 951
367 Ga0496114_0012483 3300048917 Bacteria 6802
368 Ga0496114_0023859 3300048917 Bacteria 4992
369 Ga0496114_0031261 3300048917 Bacteria 4380
370 Ga0496114_0036318 3300048917 Bacteria 4073
371 Ga0496114_0120400 3300048917 Bacteria 2257
372 Ga0496114_0123532 3300048917 Bacteria 2229
373 Ga0496114_0252733 3300048917 Bacteria 1551
374 Ga0496114_0461711 3300048917 Bacteria 1124
375 Ga0496115_0000406 3300048918 Bacteria 35489
376 Ga0496115_0000452 3300048918 Bacteria 32951
377 Ga0496115_0076075 3300048918 Bacteria 2728
378 Ga0496115_0298017 3300048918 Bacteria 1321
379 Ga0501047_0067554 3300049581 Bacteria 3445
380 Ga0501067_0003180 3300049583 Bacteria 9064
381 Ga0501067_0023061 3300049583 Bacteria 3447
382 Ga0501067_0093660 3300049583 Bacteria 1668
383 Ga0501067_0115347 3300049583 Unclassified 1494
384 Ga0501069_0008869 3300049585 Bacteria 5301
385 Ga0501069_0020492 3300049585 Bacteria 3582
386 Ga0501069_0068107 3300049585 Unclassified 1992
387 Ga0501070_0000159 3300049586 Bacteria 62347
388 Ga0501070_0083721 3300049586 Bacteria 2641
389 Ga0501071_0178955 3300049587 Bacteria 1589
390 Ga0501071_0434688 3300049587 Bacteria 1004
391 Ga0501074_0063019 3300049590 Bacteria 2671
392 Ga0501074_0075751 3300049590 Bacteria 2415
393 Ga0501074_0213632 3300049590 Bacteria 1374
394 Ga0501075_0274525 3300049591 Bacteria 1285
395 Ga0501044_0530764 3300049823 Bacteria 1076
396 Ga0501045_0139241 3300049824 Bacteria 1805
397 nmdc:mga05p37_427280_c1 3300050507 Bacteria 1540
398 nmdc:mga09592_159193_c1 3300050508 Bacteria 1950
399 nmdc:mga0qj67_31888_c1 3300050509 Bacteria 1650
400 nmdc:mga08y16_801054_c1 3300050511 Bacteria 935
401 nmdc:mga0rr50_142430_c1 3300050513 Bacteria 1930
402 nmdc:mga0rr50_77125_c1 3300050513 Bacteria 2560
403 nmdc:mga0rr50_78731_c1 3300050513 Bacteria 2537
404 nmdc:mga0a205_131872_c1 3300050515 Bacteria 2399
405 nmdc:mga0a205_518728_c1 3300050515 Unclassified 1048
406 Ga0495601_0083758 3300053077 Bacteria 2048
407 Ga0495612_0117665 3300053078 Bacteria 1141
408 Ga0495595_0025926 3300053084 Bacteria 2600
409 Ga0495619_0001788 3300053085 Bacteria 14298
410 Ga0495619_0049617 3300053085 Bacteria 2768
411 Ga0501082_0376314 3300060353 Bacteria 1239
412 Ga0466962_0108320 3300061719 Bacteria 1337
413 Ga0530510_0011164 3300061734 Bacteria 6301
414 Ga0495603_0024706
415 Ga0070658_10009834
416 Ga0070658_10025101
417 Ga0070683_100033177
418 Ga0070683_100042536
419 Ga0070683_100093342
420 Ga0070683_100141896
421 Ga0070683_100172342
422 Ga0070683_100225526
423 Ga0070680_100027877
424 Ga0070680_100057974
425 Ga0070680_100335269
426 Ga0070680_100432234
427 Ga0070660_100018733
428 Ga0070660_100026295
429 Ga0070660_100203959
430 Ga0070661_100013894
431 Ga0070661_100042442
432 Ga0070661_100053829
433 Ga0070661_100111874
434 Ga0070661_100207221
435 Ga0070671_100235975
436 Ga0070659_100008070
437 Ga0070659_100687800
438 Ga0070708_100319287
439 Ga0070663_100642329
440 Ga0070681_10022690
441 Ga0070681_10052234
442 Ga0070681_10112408
443 Ga0070681_10118980
444 Ga0070681_10148269
445 Ga0070681_10176470
446 Ga0070685_10291063
447 Ga0070706_100025961
448 Ga0070707_100302594
449 Ga0070698_100026449
450 Ga0070699_100147984
451 Ga0070679_100004606
452 Ga0070679_100018604
453 Ga0070679_100062605
454 Ga0070679_100062749
455 Ga0070684_100011940
456 Ga0070684_100020086
457 Ga0070684_100036359
458 Ga0070684_100075637
459 Ga0070684_100118068
460 Ga0070684_100166477
461 Ga0070684_100307852
462 Ga0070696_100088186
463 Ga0068855_100023338
464 Ga0068855_100064217
465 Ga0068855_100082269
466 Ga0068855_100318387
467 Ga0070664_100197474
468 Ga0068857_100001430
469 Ga0068857_100062727
470 Ga0068857_100234251
471 Ga0068857_100257628
472 Ga0068857_100538211
473 Ga0068856_100124482
474 Ga0068856_100363508
475 Ga0068856_100509047
476 Ga0068856_100860674
477 Ga0068852_100033055
478 Ga0068852_100148052
479 Ga0081540_1028203
480 Ga0070717_10074898
481 Ga0070717_10308526
482 Ga0097621_100641359
483 Ga0075429_100386689
484 Ga0075435_100040330
485 Ga0075435_100076678
486 Ga0105240_10410531
487 Ga0111539_10165059
488 Ga0105245_10049654
489 Ga0105245_10147046
490 Ga0105245_10441812
491 Ga0114129_10089389
492 Ga0114129_10123381
493 Ga0114129_11080370
494 Ga0105243_10072931
495 Ga0105242_10034248
496 Ga0105242_10144106
497 Ga0105242_10869605
498 Ga0105237_10037415
499 Ga0105237_10055578
500 Ga0105238_10021148
501 Ga0105249_11026934
502 Ga0157373_10264584
503 Ga0157370_10015594
504 Ga0157370_10019327
505 Ga0157370_10043296
506 Ga0157369_10001694
507 Ga0157369_10019574
508 Ga0157369_10020161
509 Ga0157369_10168155
510 Ga0157374_10146880
511 Ga0157374_10155942
512 Ga0157372_10129326
513 Ga0157372_10411533
514 Ga0157375_11118100
515 Ga0182008_10092930
516 Ga0197907_10467557
517 Ga0206354_11311267
518 Ga0206354_11413394
519 Ga0206353_10946294
520 Ga0206353_11039692
521 Ga0206353_11332917
522 Ga0207688_10084236
523 Ga0207705_10108075
524 Ga0207707_10096413
525 Ga0207707_10374697
526 Ga0207695_10131004
527 Ga0207695_10266634
528 Ga0207671_10049448
529 Ga0207660_10035154
530 Ga0207660_10288766
531 Ga0207657_10002378
532 Ga0207657_10005185
533 Ga0207657_10015331
534 Ga0207657_10021024
535 Ga0207657_10491372
536 Ga0207649_10014580
537 Ga0207649_10049212
538 Ga0207649_10232361
539 Ga0207649_10431120
540 Ga0207652_10519982
541 Ga0207646_10114639
542 Ga0207646_10517618
543 Ga0207694_10106577
544 Ga0207687_10273598
545 Ga0207664_10560983
546 Ga0207664_10684167
547 Ga0207690_10267653
548 Ga0207706_10701748
549 Ga0207709_10192366
550 Ga0207709_10225377
551 Ga0207704_10472793
552 Ga0207665_10187506
553 Ga0207711_10230027
554 Ga0207661_10013023
555 Ga0207661_10069282
556 Ga0207661_10210659
557 Ga0207661_10260293
558 Ga0207661_10640357
559 Ga0207679_10205477
560 Ga0207667_10133805
561 Ga0207667_10178473
562 Ga0207667_10326033
563 Ga0207667_10410537
564 Ga0207712_10705495
565 Ga0207677_10056458
566 Ga0207639_10212328
567 Ga0207639_10300694
568 Ga0207702_10855198
569 Ga0207674_10007738
570 Ga0207674_10104970
571 Ga0207674_10117544
572 Ga0207674_10161387
573 Ga0207674_10397328
574 Ga0207683_10060267
575 Ga0207698_10375888
576 Ga0268266_10689659
577 Ga0265318_10039455
578 Ga0265322_10004957
579 Ga0265322_10041686
580 Ga0265338_10002899
581 Ga0265338_10016797
582 Ga0265325_10009897
583 Ga0265340_10046249
584 Ga0265340_10048790
585 Ga0265339_10043531
586 Ga0265327_10003899
587 Ga0265316_10004010
588 Ga0265313_10004245
589 Ga0265314_10010034
590 Ga0307416_100043112
591 Ga0373945_0024836
592 Ga0373943_0000800
593 Ga0373935_0043605
594 Ga0373947_0000652
595 Ga0373925_0001708
596 Ga0395899_0068047
597 Ga0395899_0076375
598 Ga0395899_0132853
599 Ga0395900_0042796
600 Ga0395900_0074243
601 Ga0395900_0074694
602 Ga0395900_0076713
603 Ga0395900_0267668
604 Ga0395900_0416892
605 Ga0395900_0652136
606 Ga0395898_0026495
607 Ga0395898_0053547
608 Ga0395898_0056612
609 Ga0395898_0199071
610 Ga0395898_0281400
611 Ga0395898_0367228
612 Ga0395905_0071200
613 Ga0395905_0170547
614 Ga0395905_0264913
615 Ga0395905_0283880
616 Ga0395901_0005601
617 Ga0395901_0028404
618 Ga0395901_0055221
619 Ga0395901_0079812
620 Ga0395901_0093215
621 Ga0395901_0139079
622 Ga0395901_0214716
623 Ga0395901_0451240
624 Ga0395901_0511668
625 Ga0436363_1584113
626 Ga0436362_0467121
627 Ga0451853_0075298
628 Ga0439455_0057542
629 Ga0466966_0018387
630 Ga0466966_0246579
631 Ga0466966_0284927
632 Ga0466961_0120728
633 Ga0466963_0019523
634 Ga0466963_0026793
635 Ga0466963_0028048
636 Ga0466963_0052020
637 Ga0466963_0087889
638 Ga0466963_0216697
639 Ga0466964_0003589
640 Ga0466964_0003703
641 Ga0466964_0043368
642 Ga0466968_0052277
643 Ga0466970_0128892
644 Ga0466957_0094450
645 Ga0466959_0085361
646 Ga0466959_0093379
647 Ga0466958_0014903
648 Ga0466958_0031046
649 Ga0466958_0142261
650 Ga0466967_0004107
651 Ga0466967_0017290
652 Ga0466967_0022553
653 Ga0466967_0080374
654 Ga0466967_0097856
655 Ga0466967_0104718
656 Ga0466967_0316250
657 Ga0466967_0394504
658 Ga0495603_0056825
659 Ga0495629_0002345
660 Ga0495629_0139328
661 Ga0495641_0000626
662 Ga0495641_0042214
663 Ga0495641_0044430
664 Ga0495651_0023691
665 Ga0495651_0164123
666 Ga0495651_0232975
667 Ga0495582_0003901
668 Ga0495582_0071776
669 Ga0495662_0001172
670 Ga0495664_0021370
671 Ga0495584_0112552
672 Ga0495608_0145280
673 Ga0495608_0154712
674 Ga0495618_0071215
675 Ga0495618_0187828
676 Ga0495628_0019690
677 Ga0495628_0034108
678 Ga0495628_0085846
679 Ga0495628_0277090
680 Ga0495630_0015061
681 Ga0495630_0041530
682 Ga0495630_0110654
683 Ga0495630_0415946
684 Ga0495637_0122392
685 Ga0495652_0081495
686 Ga0495652_0101675
687 Ga0495652_0137849
688 Ga0495652_0247895
689 Ga0495665_0003782
690 Ga0495665_0020884
691 Ga0495640_0015258
692 Ga0495640_0130977
693 Ga0495586_0134810
694 Ga0495587_0068476
695 Ga0495645_0226670
696 Ga0495667_0017776
697 Ga0495656_0191959
698 Ga0495634_0026260
699 Ga0495634_0105634
700 Ga0495635_0019996
701 Ga0495657_0041833
702 Ga0495657_0096142
703 Ga0495657_0111758
704 Ga0495599_0058839
705 Ga0495599_0214335
706 Ga0495658_0001427
707 Ga0495658_0097053
708 Ga0495613_0010516
709 Ga0495624_0022252
710 Ga0495600_0010514
711 Ga0495600_0039356
712 Ga0495600_0100011
713 Ga0495600_0113701
714 Ga0495660_0233861
715 Ga0495581_0010241
716 Ga0495581_0033322
717 Ga0495604_0011897
718 Ga0495604_0029512
719 Ga0495604_0193851
720 Ga0495674_0009149
721 Ga0495674_0016720
722 Ga0495674_0073789
723 Ga0495676_0005137
724 Ga0495676_0006729
725 Ga0495680_0002917
726 Ga0495680_0006666
727 Ga0495680_0009133
728 Ga0495680_0035962
729 Ga0495684_0019099
730 Ga0495684_0139049
731 Ga0495684_0158520
732 Ga0495593_0012291
733 Ga0495602_0195210
734 Ga0496100_0000752
735 Ga0496100_0077852
736 Ga0496100_0101538
737 Ga0496101_0002633
738 Ga0496101_0005711
739 Ga0496101_0042238
740 Ga0496101_0219033
741 Ga0496101_0635414
742 Ga0496102_0002544
743 Ga0496102_0048467
744 Ga0496102_0563818
745 Ga0496102_0708046
746 Ga0496103_0004252
747 Ga0496104_0001544
748 Ga0496104_0380064
749 Ga0496104_0665795
750 Ga0496105_0088987
751 Ga0496105_0110947
752 Ga0496106_0032470
753 Ga0496106_0159668
754 Ga0496106_0313868
755 Ga0496107_0000933
756 Ga0496107_0006099
757 Ga0496107_0010327
758 Ga0496107_0204296
759 Ga0496108_0023669
760 Ga0496108_0184317
761 Ga0496108_0209478
762 Ga0496109_0010583
763 Ga0496109_0026904
764 Ga0496109_0041856
765 Ga0496109_0055698
766 Ga0496109_0111716
767 Ga0496110_0025511
768 Ga0496110_0107981
769 Ga0496110_0294285
770 Ga0496110_0358275
771 Ga0496110_0382582
772 Ga0496111_0028669
773 Ga0496111_0095227
774 Ga0496111_0176611
775 Ga0496112_0001209
776 Ga0496112_0013683
777 Ga0496112_0103819
778 Ga0496113_0112837
779 Ga0496113_0524643
780 Ga0496114_0012483
781 Ga0496114_0023859
782 Ga0496114_0031261
783 Ga0496114_0036318
784 Ga0496114_0120400
785 Ga0496114_0123532
786 Ga0496114_0252733
787 Ga0496114_0461711
788 Ga0496115_0000406
789 Ga0496115_0000452
790 Ga0496115_0076075
791 Ga0496115_0298017
792 Ga0501047_0067554
793 Ga0501067_0003180
794 Ga0501067_0023061
795 Ga0501067_0093660
796 Ga0501067_0115347
797 Ga0501069_0008869
798 Ga0501069_0020492
799 Ga0501069_0068107
800 Ga0501070_0000159
801 Ga0501070_0083721
802 Ga0501071_0178955
803 Ga0501071_0434688
804 Ga0501074_0063019
805 Ga0501074_0075751
806 Ga0501074_0213632
807 Ga0501075_0274525
808 Ga0501044_0530764
809 Ga0501045_0139241
810 nmdc:mga05p37_427280_c1
811 nmdc:mga09592_159193_c1
812 nmdc:mga0qj67_31888_c1
813 nmdc:mga08y16_801054_c1
814 nmdc:mga0rr50_142430_c1
815 nmdc:mga0rr50_77125_c1
816 nmdc:mga0rr50_78731_c1
817 nmdc:mga0a205_131872_c1
818 nmdc:mga0a205_518728_c1
819 Ga0495601_0083758
820 Ga0495612_0117665
821 Ga0495595_0025926
822 Ga0495619_0001788
823 Ga0495619_0049617
824 Ga0501082_0376314
825 Ga0466962_0108320
826 Ga0530510_0011164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

14

241

0.9

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

9

246

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kpk-assembly1.cif.gz_A crystal structure of a enoyl-coa hydratase from shewanella pealeana atcc 700345 0.9466 3 245
4zu2-assembly1.cif.gz_C pseudomonas aeruginosa atue 0.9452 3 246
3myb-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase mycobacterium smegmatis 0.9377 3 245
3i47-assembly1.cif.gz_A crystal structure of putative enoyl coa hydratase/isomerase (crotonase) from legionella pneumophila subsp. pneumophila str. philadelphia 1 0.9338 1 245
4k3w-assembly1.cif.gz_B crystal structure of an enoyl-coa hydratase/isomerase from marinobacter aquaeolei 0.9327 3 246
ID Description Score Start End Superfamily
3i47A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9502 1 193 3.90.226.10
3mybC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9454 3 193 3.90.226.10
af_O50402_25_213_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9355 1 171 3.90.226.10
3hinB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9235 2 193 3.90.226.10
5z7rC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9233 1 196 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7V8YVR6-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9977 1 190 GO:0016853
AF-A0A538LHU1-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein (EC 4.2.1.17) 0.9953 1 245 GO:0004300
GO:0016853
AF-A0A538MVX4-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein (EC 4.2.1.17) 0.9938 1 247 GO:0004300
GO:0016853
AF-A0A7V8YVR6-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9873 1 190 GO:0016853
AF-A0A536F7R9-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9871 1 209

Map