F438110

General Info

Members Datasets Scaffolds Average Seq Length
413 256 826 276

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0361718|Ga0436364_0361718_1228_2058
Length 276
Sequence MNAGALTADGRAVQLRDGNQLPMLGLGVWQVPDGPVCVNAVRWALELGYRHIDTAQAYGNEASVGKALRESGVPRGEVFITTKFYPGHHDPVAEAEASLRRLGVDQVDLYLVHWPRGGPLRAWPGMEQARVRGLAKSIGVSNFGADDLGKVIAASVPPAVDQIEFSAVHYRRGLMDACRSAEVVPEAYSPLGTGRHLSNKRVTAIAARTGRTPAQVLLRWCVQHGLPVIPKSTHRERIEENAQIFDFTLSEQDMAELDALDKTRGTDRALERHWWR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
97 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
101 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
243 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
244 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
245 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
246 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
247 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
250 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
253 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
254 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
255 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
256 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.82
Metatranscriptomes 2.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.63
Nodule 0
Rhizoplane 7.99
Rhizosphere 80.39
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0361718 3300037853 Bacteria 2399
2 Ga0070658_10153543 3300005327 Bacteria 1929
3 Ga0070683_100060318 3300005329 Bacteria 3525
4 Ga0070683_100061424 3300005329 Bacteria 3494
5 Ga0070680_100075391 3300005336 Bacteria 2776
6 Ga0070682_100361318 3300005337 Bacteria 1086
7 Ga0070691_10015072 3300005341 Bacteria 3551
8 Ga0070661_100432211 3300005344 Bacteria 1045
9 Ga0070659_100203920 3300005366 Bacteria 1628
10 Ga0070667_100442317 3300005367 Bacteria 1187
11 Ga0070709_10003251 3300005434 Bacteria 8722
12 Ga0070709_10203782 3300005434 Bacteria 1402
13 Ga0070714_100004207 3300005435 Bacteria 10838
14 Ga0070714_100009603 3300005435 Bacteria 7614
15 Ga0070714_100052840 3300005435 Bacteria 3466
16 Ga0070714_100055942 3300005435 Bacteria 3373
17 Ga0070714_100066924 3300005435 Bacteria 3097
18 Ga0070714_100121438 3300005435 Bacteria 2325
19 Ga0070714_100131433 3300005435 Bacteria 2238
20 Ga0070714_100136333 3300005435 Bacteria 2198
21 Ga0070714_100378271 3300005435 Bacteria 1334
22 Ga0070714_100387327 3300005435 Bacteria 1319
23 Ga0070714_100574046 3300005435 Bacteria 1081
24 Ga0070713_100003265 3300005436 Bacteria 10700
25 Ga0070713_100030095 3300005436 Bacteria 4308
26 Ga0070713_100378366 3300005436 Bacteria 1319
27 Ga0070713_100422066 3300005436 Bacteria 1249
28 Ga0070713_100450216 3300005436 Bacteria 1209
29 Ga0070713_100490033 3300005436 Bacteria 1159
30 Ga0070710_10080786 3300005437 Bacteria 1897
31 Ga0070701_10053684 3300005438 Bacteria 2098
32 Ga0070711_100046169 3300005439 Bacteria 2966
33 Ga0070711_100077207 3300005439 Bacteria 2363
34 Ga0070711_100489094 3300005439 Bacteria 1013
35 Ga0070700_100068752 3300005441 Bacteria 2253
36 Ga0070708_100181446 3300005445 Bacteria 1968
37 Ga0070708_100329506 3300005445 Bacteria 1438
38 Ga0070662_100079950 3300005457 Bacteria 2433
39 Ga0070681_10173776 3300005458 Bacteria 2076
40 Ga0070706_100000417 3300005467 Bacteria 51070
41 Ga0070706_100048843 3300005467 Bacteria 3905
42 Ga0070706_100065363 3300005467 Bacteria 3364
43 Ga0070706_100104809 3300005467 Bacteria 2630
44 Ga0070706_100278914 3300005467 Bacteria 1560
45 Ga0070707_100000094 3300005468 Bacteria 80385
46 Ga0070707_100020082 3300005468 Bacteria 6300
47 Ga0070707_100059408 3300005468 Bacteria 3668
48 Ga0070698_100011598 3300005471 Bacteria 9353
49 Ga0070698_100022487 3300005471 Bacteria 6596
50 Ga0070699_100002188 3300005518 Bacteria 17681
51 Ga0070699_100012495 3300005518 Bacteria 7327
52 Ga0070679_100039937 3300005530 Bacteria 4665
53 Ga0070679_100480463 3300005530 Bacteria 1187
54 Ga0070684_100108176 3300005535 Bacteria 2491
55 Ga0070686_100087182 3300005544 Bacteria 2080
56 Ga0070695_100104602 3300005545 Bacteria 1911
57 Ga0070665_100575298 3300005548 Bacteria 1139
58 Ga0070665_100643588 3300005548 Bacteria 1073
59 Ga0070704_100160113 3300005549 Bacteria 1779
60 Ga0068855_100098820 3300005563 Bacteria 3362
61 Ga0068855_100377489 3300005563 Bacteria 1557
62 Ga0068857_100097731 3300005577 Bacteria 2633
63 Ga0068854_100119063 3300005578 Bacteria 2002
64 Ga0068854_100374204 3300005578 Bacteria 1172
65 Ga0068856_100086713 3300005614 Bacteria 3111
66 Ga0068856_100209859 3300005614 Bacteria 1963
67 Ga0068856_100464780 3300005614 Bacteria 1286
68 Ga0068852_100288406 3300005616 Bacteria 1585
69 Ga0068866_10020780 3300005718 Bacteria 3013
70 Ga0068861_100251291 3300005719 Bacteria 1509
71 Ga0081540_1000498 3300005983 Bacteria 38585
72 Ga0081540_1070041 3300005983 Unclassified 1626
73 Ga0081539_10000624 3300005985 Bacteria 71667
74 Ga0081539_10006201 3300005985 Bacteria 11604
75 Ga0070717_10042930 3300006028 Bacteria 3689
76 Ga0070717_10112182 3300006028 Bacteria 2327
77 Ga0070717_10215316 3300006028 Bacteria 1687
78 Ga0070716_100002768 3300006173 Bacteria 8144
79 Ga0070716_100142000 3300006173 Archaea 1532
80 Ga0070712_100152526 3300006175 Bacteria 1776
81 Ga0070712_100365392 3300006175 Bacteria 1184
82 Ga0070712_100420502 3300006175 Unclassified 1107
83 Ga0070712_100421838 3300006175 Bacteria 1106
84 Ga0070712_100671823 3300006175 Bacteria 881
85 Ga0075434_100040476 3300006871 Bacteria 4614
86 Ga0075434_100072642 3300006871 Bacteria 3432
87 Ga0075434_100218075 3300006871 Bacteria 1928
88 Ga0075435_100080790 3300007076 Bacteria 2670
89 Ga0075435_100224490 3300007076 Bacteria 1595
90 Ga0075435_100536919 3300007076 Bacteria 1012
91 Ga0105240_10329637 3300009093 Bacteria 1737
92 Ga0105245_10067491 3300009098 Bacteria 3239
93 Ga0105248_10779370 3300009177 Bacteria 1079
94 Ga0105249_10160764 3300009553 Bacteria 2170
95 Ga0105239_10243568 3300010375 Bacteria 2018
96 Ga0157370_10398128 3300013104 Bacteria 1268
97 Ga0157370_10505442 3300013104 Bacteria 1110
98 Ga0157369_10083537 3300013105 Bacteria 3415
99 Ga0157369_10097453 3300013105 Bacteria 3137
100 Ga0157378_10140356 3300013297 Bacteria 2243
101 Ga0157378_10465433 3300013297 Bacteria 1257
102 Ga0157372_10440422 3300013307 Bacteria 1519
103 Ga0163163_10269438 3300014325 Bacteria 1754
104 Ga0157380_10169724 3300014326 Bacteria 1905
105 Ga0157376_10084691 3300014969 Bacteria 2730
106 Ga0197907_10385276 3300020069 Bacteria 1172
107 Ga0206349_1339926 3300020075 Bacteria 1039
108 Ga0206354_11155897 3300020081 Bacteria 1006
109 Ga0206354_11450649 3300020081 Bacteria 3272
110 Ga0206353_10849918 3300020082 Bacteria 3099
111 Ga0206353_11843674 3300020082 Bacteria 1277
112 Ga0213873_10008648 3300021358 Unclassified 2088
113 Ga0213874_10001484 3300021377 Bacteria 4869
114 Ga0213874_10036992 3300021377 Bacteria 1442
115 Ga0213876_10012461 3300021384 Bacteria 4526
116 Ga0213876_10051305 3300021384 Bacteria 2180
117 Ga0213876_10279387 3300021384 Bacteria 887
118 Ga0213875_10032308 3300021388 Bacteria 2474
119 Ga0213875_10065252 3300021388 Bacteria 1701
120 Ga0213875_10131682 3300021388 Bacteria 1169
121 Ga0224712_10006615 3300022467 Bacteria 3320
122 Ga0207653_10005610 3300025885 Bacteria 3919
123 Ga0207692_10005454 3300025898 Bacteria 5097
124 Ga0207692_10011884 3300025898 Bacteria 3723
125 Ga0207692_10115892 3300025898 Bacteria 1493
126 Ga0207685_10142063 3300025905 Bacteria 1077
127 Ga0207699_10003205 3300025906 Bacteria 7794
128 Ga0207699_10021201 3300025906 Bacteria 3498
129 Ga0207699_10037455 3300025906 Bacteria 2773
130 Ga0207705_10223481 3300025909 Bacteria 1431
131 Ga0207684_10000246 3300025910 Bacteria 81541
132 Ga0207684_10041242 3300025910 Bacteria 3915
133 Ga0207684_10070624 3300025910 Bacteria 2968
134 Ga0207684_10257651 3300025910 Bacteria 1505
135 Ga0207707_10042275 3300025912 Bacteria 3978
136 Ga0207693_10042656 3300025915 Bacteria 3571
137 Ga0207693_10073878 3300025915 Bacteria 2669
138 Ga0207693_10245888 3300025915 Unclassified 1404
139 Ga0207693_10278122 3300025915 Bacteria 1312
140 Ga0207663_10011768 3300025916 Bacteria 4710
141 Ga0207660_10311470 3300025917 Bacteria 1255
142 Ga0207657_10031193 3300025919 Bacteria 4831
143 Ga0207646_10000204 3300025922 Bacteria 80399
144 Ga0207646_10032195 3300025922 Bacteria 4745
145 Ga0207687_10285928 3300025927 Bacteria 1323
146 Ga0207700_10002590 3300025928 Bacteria 10399
147 Ga0207700_10006843 3300025928 Bacteria 6931
148 Ga0207700_10020607 3300025928 Bacteria 4482
149 Ga0207700_10051415 3300025928 Bacteria 3075
150 Ga0207700_10069513 3300025928 Bacteria 2703
151 Ga0207700_10108566 3300025928 Bacteria 2228
152 Ga0207700_10115671 3300025928 Unclassified 2166
153 Ga0207700_10159509 3300025928 Bacteria 1872
154 Ga0207700_10327408 3300025928 Bacteria 1329
155 Ga0207664_10013339 3300025929 Bacteria 5895
156 Ga0207664_10041741 3300025929 Bacteria 3575
157 Ga0207664_10074823 3300025929 Bacteria 2737
158 Ga0207664_10098345 3300025929 Bacteria 2413
159 Ga0207690_10435033 3300025932 Bacteria 1052
160 Ga0207706_10003481 3300025933 Bacteria 15024
161 Ga0207669_10082646 3300025937 Bacteria 2063
162 Ga0207704_10034335 3300025938 Bacteria 2893
163 Ga0207665_10001739 3300025939 Bacteria 14635
164 Ga0207665_10220419 3300025939 Bacteria 1390
165 Ga0207661_10053719 3300025944 Bacteria 3225
166 Ga0207667_10496902 3300025949 Bacteria 1238
167 Ga0207640_10227564 3300025981 Bacteria 1432
168 Ga0207677_10016103 3300026023 Bacteria 4419
169 Ga0207678_10005632 3300026067 Bacteria 11200
170 Ga0207708_10012342 3300026075 Bacteria 6367
171 Ga0207648_10001649 3300026089 Bacteria 24470
172 Ga0207674_10048406 3300026116 Bacteria 4351
173 Ga0207674_10216259 3300026116 Bacteria 1865
174 Ga0207675_100021066 3300026118 Bacteria 6076
175 Ga0207698_10386657 3300026142 Bacteria 1333
176 Ga0268266_10263881 3300028379 Bacteria 1597
177 Ga0265337_1000062 3300028556 Bacteria 49473
178 Ga0265326_10003835 3300028558 Bacteria 4894
179 Ga0265319_1003472 3300028563 Bacteria 8202
180 Ga0265334_10001673 3300028573 Bacteria 10600
181 Ga0265323_10007860 3300028653 Bacteria 4411
182 Ga0265336_10009655 3300028666 Bacteria 3329
183 Ga0307517_10005899 3300028786 Bacteria 18280
184 Ga0265338_10000791 3300028800 Bacteria 53584
185 Ga0265338_10004837 3300028800 Bacteria 17971
186 Ga0265338_10044746 3300028800 Bacteria 4081
187 Ga0265338_10046862 3300028800 Bacteria 3955
188 Ga0265338_10098117 3300028800 Bacteria 2398
189 Ga0265324_10009261 3300029957 Bacteria 3853
190 Ga0265332_10010283 3300031238 Bacteria 4165
191 Ga0265320_10023937 3300031240 Bacteria 3239
192 Ga0265340_10014602 3300031247 Bacteria 4096
193 Ga0265316_10155532 3300031344 Bacteria 1711
194 Ga0265313_10080181 3300031595 Bacteria 1484
195 Ga0307508_10047196 3300031616 Bacteria 3842
196 Ga0265342_10015180 3300031712 Bacteria 5077
197 Ga0307516_10050072 3300031730 Bacteria 4100
198 Ga0307507_10034718 3300033179 Bacteria 5200
199 Ga0316212_1000422 3300033547 Bacteria 5135
200 Ga0373934_0006193 3300035086 Bacteria 4433
201 Ga0373934_0108190 3300035086 Bacteria 1127
202 Ga0373940_0005971 3300035088 Bacteria 2674
203 Ga0373949_0019591 3300035090 Bacteria 1542
204 Ga0373923_0027163 3300035111 Bacteria 2281
205 Ga0373936_0023589 3300035113 Bacteria 2398
206 Ga0373953_0020510 3300035117 Bacteria 2470
207 Ga0373956_0030772 3300035119 Bacteria 2348
208 Ga0373957_0010836 3300035120 Bacteria 3025
209 Ga0373946_0246460 3300035171 Bacteria 870
210 Ga0373946_0343721 3300035171 Bacteria 745
211 Ga0373955_0133531 3300035172 Bacteria 1450
212 Ga0373931_0005903 3300035691 Bacteria 5693
213 Ga0373947_0226549 3300035725 Bacteria 1230
214 Ga0372808_001697 3300036459 Bacteria 2364
215 Ga0372808_003100 3300036459 Bacteria 2000
216 Ga0373925_0000348 3300037068 Bacteria 48026
217 Ga0373925_0213201 3300037068 Bacteria 1539
218 Ga0373925_0332856 3300037068 Bacteria 1230
219 Ga0436364_0616054 3300037853 Bacteria 6095
220 Ga0436364_0635143 3300037853 Bacteria 45186
221 Ga0436364_0918714 3300037853 Bacteria 1717
222 Ga0436364_1242950 3300037853 Bacteria 2666
223 Ga0395901_0109497 3300038443 Bacteria 2900
224 Ga0395901_0151973 3300038443 Bacteria 2432
225 Ga0436365_0395422 3300039437 Bacteria 4920
226 Ga0436365_0776657 3300039437 Bacteria 2493
227 Ga0436365_1234754 3300039437 Bacteria 12455
228 Ga0436365_1532082 3300039437 Bacteria 6699
229 Ga0436365_1567051 3300039437 Bacteria 1233
230 Ga0436365_1775349 3300039437 Bacteria 7843
231 Ga0436360_0342892 3300039438 Bacteria 1615
232 Ga0436361_1196869 3300039447 Bacteria 1180
233 Ga0436363_0064177 3300039450 Bacteria 10777
234 Ga0436363_0444266 3300039450 Bacteria 988
235 Ga0436363_0862621 3300039450 Bacteria 2184
236 Ga0436363_1206965 3300039450 Bacteria 26289
237 Ga0436363_1367767 3300039450 Bacteria 7447
238 Ga0436362_0038653 3300039453 Bacteria 3593
239 Ga0436362_0107205 3300039453 Unclassified 2200
240 Ga0436362_0777498 3300039453 Bacteria 2153
241 Ga0466969_0122603 3300044656 Bacteria 1209
242 Ga0466963_0002752 3300044694 Bacteria 9921
243 Ga0466963_0143593 3300044694 Bacteria 1655
244 Ga0466963_0149065 3300044694 Bacteria 1624
245 Ga0466964_0148846 3300044706 Bacteria 1083
246 Ga0466957_0185114 3300044842 Bacteria 1362
247 Ga0466960_0016899 3300044901 Bacteria 3173
248 Ga0466959_0094823 3300045049 Bacteria 2140
249 Ga0466959_0274450 3300045049 Bacteria 1158
250 Ga0466958_0230568 3300045836 Bacteria 1182
251 Ga0466967_0000490 3300045976 Bacteria 19257
252 Ga0466967_0015488 3300045976 Bacteria 5977
253 Ga0466967_0551055 3300045976 Bacteria 1135
254 Ga0495592_0087407 3300046454 Bacteria 2242
255 Ga0495629_0004698 3300046459 Bacteria 10235
256 Ga0495629_0106046 3300046459 Bacteria 1960
257 Ga0495629_0202503 3300046459 Bacteria 1372
258 Ga0495638_0078285 3300046460 Bacteria 2012
259 Ga0495651_0007812 3300046462 Bacteria 8188
260 Ga0495651_0125566 3300046462 Bacteria 1879
261 Ga0495582_0081419 3300046473 Bacteria 1798
262 Ga0495605_0007208 3300046474 Bacteria 6323
263 Ga0495639_0175400 3300046475 Bacteria 1042
264 Ga0495662_0002433 3300046476 Bacteria 9358
265 Ga0495664_0000400 3300046477 Bacteria 21208
266 Ga0495584_0119777 3300046491 Bacteria 1333
267 Ga0495585_0006439 3300046492 Bacteria 7286
268 Ga0495594_0105671 3300046499 Bacteria 1585
269 Ga0495607_0029888 3300046501 Bacteria 3352
270 Ga0495583_0032945 3300046506 Bacteria 2496
271 Ga0495608_0095055 3300046511 Bacteria 1925
272 Ga0495616_0065498 3300046513 Bacteria 1770
273 Ga0495618_0020370 3300046514 Bacteria 4082
274 Ga0495620_0003443 3300046515 Bacteria 9054
275 Ga0495628_0047670 3300046516 Bacteria 3398
276 Ga0495630_0028789 3300046517 Bacteria 4128
277 Ga0495630_0034603 3300046517 Bacteria 3773
278 Ga0495630_0105365 3300046517 Bacteria 2135
279 Ga0495632_0021245 3300046519 Bacteria 3501
280 Ga0495643_0011886 3300046522 Bacteria 5273
281 Ga0495643_0037557 3300046522 Bacteria 2655
282 Ga0495652_0049690 3300046529 Bacteria 3589
283 Ga0495652_0197134 3300046529 Bacteria 1531
284 Ga0495665_0199634 3300046531 Bacteria 1037
285 Ga0495640_0046918 3300046533 Bacteria 2991
286 Ga0495586_0014857 3300046535 Bacteria 4139
287 Ga0495587_0004174 3300046536 Bacteria 9564
288 Ga0495645_0119098 3300046543 Bacteria 1860
289 Ga0495645_0188064 3300046543 Bacteria 1409
290 Ga0495633_0114910 3300046558 Bacteria 1247
291 Ga0495667_0123338 3300046559 Bacteria 1672
292 Ga0495668_0043377 3300046616 Bacteria 2502
293 Ga0495634_0001317 3300046642 Bacteria 22654
294 Ga0495634_0107040 3300046642 Bacteria 1801
295 Ga0495635_0001732 3300046663 Bacteria 14695
296 Ga0495635_0174485 3300046663 Bacteria 1461
297 Ga0495588_0003346 3300046674 Bacteria 6966
298 Ga0495657_0016102 3300046675 Bacteria 5453
299 Ga0495657_0119110 3300046675 Bacteria 1664
300 Ga0495623_0023565 3300046679 Bacteria 3972
301 Ga0495646_0003922 3300046680 Bacteria 9305
302 Ga0495646_0073023 3300046680 Bacteria 2016
303 Ga0495658_0035513 3300046683 Bacteria 2743
304 Ga0495658_0055742 3300046683 Bacteria 2252
305 Ga0495658_0142859 3300046683 Bacteria 1465
306 Ga0495613_0065345 3300046689 Bacteria 2658
307 Ga0495613_0345781 3300046689 Bacteria 1022
308 Ga0495670_0003769 3300046691 Bacteria 7452
309 Ga0495589_0113573 3300046794 Bacteria 1306
310 Ga0495600_0003619 3300046809 Bacteria 9110
311 Ga0495660_0026834 3300046810 Bacteria 3260
312 Ga0495581_0008913 3300047315 Bacteria 5809
313 Ga0495604_0001180 3300047317 Bacteria 21589
314 Ga0495636_0022532 3300047318 Bacteria 2547
315 Ga0495674_0077021 3300047319 Bacteria 2868
316 Ga0495674_0089892 3300047319 Bacteria 2625
317 Ga0495676_0043953 3300047321 Bacteria 3651
318 Ga0495680_0178777 3300047322 Bacteria 1532
319 Ga0495683_0057988 3300047323 Bacteria 1923
320 Ga0495687_060404 3300047443 Bacteria 1563
321 Ga0495687_075946 3300047443 Bacteria 1331
322 Ga0495675_0065782 3300047444 Bacteria 2292
323 Ga0495685_000633 3300047447 Bacteria 10773
324 Ga0495685_057658 3300047447 Bacteria 1311
325 Ga0495681_0004138 3300047470 Bacteria 9959
326 Ga0495684_0006975 3300047471 Bacteria 8775
327 Ga0495684_0112127 3300047471 Bacteria 2057
328 Ga0495593_0006546 3300047673 Bacteria 6819
329 Ga0495602_0047319 3300048088 Bacteria 3876
330 Ga0495602_0076770 3300048088 Bacteria 2829
331 Ga0495614_0007392 3300048089 Bacteria 4892
332 Ga0495626_0211216 3300048091 Bacteria 792
333 Ga0496100_0007365 3300048903 Bacteria 6066
334 Ga0496101_0002168 3300048904 Bacteria 11998
335 Ga0496102_0068582 3300048905 Bacteria 3254
336 Ga0496102_0194524 3300048905 Bacteria 1911
337 Ga0496103_0068669 3300048906 Bacteria 2215
338 Ga0496104_0004870 3300048907 Bacteria 11703
339 Ga0496104_0080646 3300048907 Bacteria 3102
340 Ga0496104_0083285 3300048907 Bacteria 3050
341 Ga0496104_0106122 3300048907 Unclassified 2692
342 Ga0496104_0141759 3300048907 Bacteria 2309
343 Ga0496105_0008903 3300048908 Bacteria 7822
344 Ga0496105_0023847 3300048908 Bacteria 4968
345 Ga0496106_0073551 3300048909 Bacteria 2615
346 Ga0496106_0078172 3300048909 Bacteria 2538
347 Ga0496106_0245204 3300048909 Bacteria 1432
348 Ga0496107_0015854 3300048910 Bacteria 5287
349 Ga0496107_0071382 3300048910 Bacteria 2523
350 Ga0496108_0007279 3300048911 Bacteria 8972
351 Ga0496108_0158455 3300048911 Bacteria 1955
352 Ga0496108_0406565 3300048911 Bacteria 1189
353 Ga0496109_0002612 3300048912 Bacteria 15106
354 Ga0496110_0019526 3300048913 Bacteria 5705
355 Ga0496110_0204772 3300048913 Bacteria 1793
356 Ga0496111_0020513 3300048914 Bacteria 4602
357 Ga0496112_0193384 3300048915 Bacteria 1995
358 Ga0496112_0264663 3300048915 Bacteria 1668
359 Ga0496112_0654780 3300048915 Bacteria 980
360 Ga0496113_0035929 3300048916 Bacteria 3627
361 Ga0496113_0098063 3300048916 Unclassified 2268
362 Ga0496113_0102983 3300048916 Bacteria 2214
363 Ga0496114_0051666 3300048917 Bacteria 3423
364 Ga0496114_0095531 3300048917 Bacteria 2530
365 Ga0496115_0301812 3300048918 Bacteria 1312
366 Ga0496126_0035786 3300048929 Bacteria 4648
367 Ga0496126_0086524 3300048929 Bacteria 2762
368 Ga0501033_0230307 3300049570 Bacteria 1316
369 Ga0501034_0191438 3300049571 Bacteria 2007
370 Ga0501036_0001860 3300049572 Bacteria 16362
371 Ga0501037_0042303 3300049573 Bacteria 3348
372 Ga0501039_0001552 3300049575 Bacteria 16901
373 Ga0501042_0026185 3300049578 Bacteria 4100
374 Ga0501043_0055829 3300049579 Bacteria 3102
375 Ga0501046_0026266 3300049580 Bacteria 4755
376 Ga0501047_0095764 3300049581 Bacteria 2847
377 Ga0501047_0359194 3300049581 Bacteria 1292
378 Ga0501048_0000411 3300049582 Bacteria 29941
379 Ga0501068_0279687 3300049584 Bacteria 1066
380 Ga0501080_0219843 3300049742 Bacteria 1739
381 Ga0501080_0463938 3300049742 Bacteria 1134
382 Ga0501035_0078116 3300049822 Bacteria 2925
383 Ga0501035_0202291 3300049822 Bacteria 1702
384 Ga0501045_0074691 3300049824 Bacteria 2496
385 nmdc:mga05p37_575494_c1 3300050507 Bacteria 1276
386 nmdc:mga06r32_179049_c1 3300050510 Bacteria 2105
387 nmdc:mga0n895_31029_c1 3300050512 Bacteria 5113
388 nmdc:mga0n895_33921_c1 3300050512 Bacteria 4909
389 nmdc:mga0n895_364852_c1 3300050512 Bacteria 1462
390 nmdc:mga0rr50_322332_c1 3300050513 Unclassified 1296
391 nmdc:mga0rr50_372340_c1 3300050513 Bacteria 1203
392 nmdc:mga0rr50_9982_c1 3300050513 Bacteria 6004
393 nmdc:mga08x19_176638_c1 3300050514 Bacteria 1456
394 nmdc:mga0a205_281326_c1 3300050515 Bacteria 1539
395 Ga0495601_0140444 3300053077 Bacteria 1575
396 Ga0495601_0152074 3300053077 Bacteria 1511
397 Ga0495612_0081583 3300053078 Bacteria 1359
398 Ga0495619_0177244 3300053085 Bacteria 1474
399 Ga0500578_0024336 3300053086 Bacteria 3889
400 Ga0500654_067765 3300053099 Bacteria 1766
401 Ga0500553_075529 3300053101 Bacteria 1535
402 Ga0500621_115866 3300053126 Bacteria 1042
403 Ga0500628_000824 3300053129 Bacteria 5504
404 Ga0500652_011370 3300053131 Bacteria 3081
405 Ga0500658_0008513 3300053134 Bacteria 3788
406 Ga0500561_0001666 3300053137 Bacteria 3640
407 Ga0500600_0027856 3300053149 Bacteria 3346
408 Ga0500616_0013014 3300053153 Bacteria 4845
409 Ga0500624_002786 3300053157 Bacteria 2326
410 Ga0500633_0002840 3300053160 Bacteria 3655
411 Ga0500634_0012802 3300053161 Bacteria 4380
412 Ga0500656_001478 3300053732 Bacteria 2030
413 Ga0500587_001253 3300053739 Bacteria 3541
414 Ga0436364_0361718
415 Ga0070658_10153543
416 Ga0070683_100060318
417 Ga0070683_100061424
418 Ga0070680_100075391
419 Ga0070682_100361318
420 Ga0070691_10015072
421 Ga0070661_100432211
422 Ga0070659_100203920
423 Ga0070667_100442317
424 Ga0070709_10003251
425 Ga0070709_10203782
426 Ga0070714_100004207
427 Ga0070714_100009603
428 Ga0070714_100052840
429 Ga0070714_100055942
430 Ga0070714_100066924
431 Ga0070714_100121438
432 Ga0070714_100131433
433 Ga0070714_100136333
434 Ga0070714_100378271
435 Ga0070714_100387327
436 Ga0070714_100574046
437 Ga0070713_100003265
438 Ga0070713_100030095
439 Ga0070713_100378366
440 Ga0070713_100422066
441 Ga0070713_100450216
442 Ga0070713_100490033
443 Ga0070710_10080786
444 Ga0070701_10053684
445 Ga0070711_100046169
446 Ga0070711_100077207
447 Ga0070711_100489094
448 Ga0070700_100068752
449 Ga0070708_100181446
450 Ga0070708_100329506
451 Ga0070662_100079950
452 Ga0070681_10173776
453 Ga0070706_100000417
454 Ga0070706_100048843
455 Ga0070706_100065363
456 Ga0070706_100104809
457 Ga0070706_100278914
458 Ga0070707_100000094
459 Ga0070707_100020082
460 Ga0070707_100059408
461 Ga0070698_100011598
462 Ga0070698_100022487
463 Ga0070699_100002188
464 Ga0070699_100012495
465 Ga0070679_100039937
466 Ga0070679_100480463
467 Ga0070684_100108176
468 Ga0070686_100087182
469 Ga0070695_100104602
470 Ga0070665_100575298
471 Ga0070665_100643588
472 Ga0070704_100160113
473 Ga0068855_100098820
474 Ga0068855_100377489
475 Ga0068857_100097731
476 Ga0068854_100119063
477 Ga0068854_100374204
478 Ga0068856_100086713
479 Ga0068856_100209859
480 Ga0068856_100464780
481 Ga0068852_100288406
482 Ga0068866_10020780
483 Ga0068861_100251291
484 Ga0081540_1000498
485 Ga0081540_1070041
486 Ga0081539_10000624
487 Ga0081539_10006201
488 Ga0070717_10042930
489 Ga0070717_10112182
490 Ga0070717_10215316
491 Ga0070716_100002768
492 Ga0070716_100142000
493 Ga0070712_100152526
494 Ga0070712_100365392
495 Ga0070712_100420502
496 Ga0070712_100421838
497 Ga0070712_100671823
498 Ga0075434_100040476
499 Ga0075434_100072642
500 Ga0075434_100218075
501 Ga0075435_100080790
502 Ga0075435_100224490
503 Ga0075435_100536919
504 Ga0105240_10329637
505 Ga0105245_10067491
506 Ga0105248_10779370
507 Ga0105249_10160764
508 Ga0105239_10243568
509 Ga0157370_10398128
510 Ga0157370_10505442
511 Ga0157369_10083537
512 Ga0157369_10097453
513 Ga0157378_10140356
514 Ga0157378_10465433
515 Ga0157372_10440422
516 Ga0163163_10269438
517 Ga0157380_10169724
518 Ga0157376_10084691
519 Ga0197907_10385276
520 Ga0206349_1339926
521 Ga0206354_11155897
522 Ga0206354_11450649
523 Ga0206353_10849918
524 Ga0206353_11843674
525 Ga0213873_10008648
526 Ga0213874_10001484
527 Ga0213874_10036992
528 Ga0213876_10012461
529 Ga0213876_10051305
530 Ga0213876_10279387
531 Ga0213875_10032308
532 Ga0213875_10065252
533 Ga0213875_10131682
534 Ga0224712_10006615
535 Ga0207653_10005610
536 Ga0207692_10005454
537 Ga0207692_10011884
538 Ga0207692_10115892
539 Ga0207685_10142063
540 Ga0207699_10003205
541 Ga0207699_10021201
542 Ga0207699_10037455
543 Ga0207705_10223481
544 Ga0207684_10000246
545 Ga0207684_10041242
546 Ga0207684_10070624
547 Ga0207684_10257651
548 Ga0207707_10042275
549 Ga0207693_10042656
550 Ga0207693_10073878
551 Ga0207693_10245888
552 Ga0207693_10278122
553 Ga0207663_10011768
554 Ga0207660_10311470
555 Ga0207657_10031193
556 Ga0207646_10000204
557 Ga0207646_10032195
558 Ga0207687_10285928
559 Ga0207700_10002590
560 Ga0207700_10006843
561 Ga0207700_10020607
562 Ga0207700_10051415
563 Ga0207700_10069513
564 Ga0207700_10108566
565 Ga0207700_10115671
566 Ga0207700_10159509
567 Ga0207700_10327408
568 Ga0207664_10013339
569 Ga0207664_10041741
570 Ga0207664_10074823
571 Ga0207664_10098345
572 Ga0207690_10435033
573 Ga0207706_10003481
574 Ga0207669_10082646
575 Ga0207704_10034335
576 Ga0207665_10001739
577 Ga0207665_10220419
578 Ga0207661_10053719
579 Ga0207667_10496902
580 Ga0207640_10227564
581 Ga0207677_10016103
582 Ga0207678_10005632
583 Ga0207708_10012342
584 Ga0207648_10001649
585 Ga0207674_10048406
586 Ga0207674_10216259
587 Ga0207675_100021066
588 Ga0207698_10386657
589 Ga0268266_10263881
590 Ga0265337_1000062
591 Ga0265326_10003835
592 Ga0265319_1003472
593 Ga0265334_10001673
594 Ga0265323_10007860
595 Ga0265336_10009655
596 Ga0307517_10005899
597 Ga0265338_10000791
598 Ga0265338_10004837
599 Ga0265338_10044746
600 Ga0265338_10046862
601 Ga0265338_10098117
602 Ga0265324_10009261
603 Ga0265332_10010283
604 Ga0265320_10023937
605 Ga0265340_10014602
606 Ga0265316_10155532
607 Ga0265313_10080181
608 Ga0307508_10047196
609 Ga0265342_10015180
610 Ga0307516_10050072
611 Ga0307507_10034718
612 Ga0316212_1000422
613 Ga0373934_0006193
614 Ga0373934_0108190
615 Ga0373940_0005971
616 Ga0373949_0019591
617 Ga0373923_0027163
618 Ga0373936_0023589
619 Ga0373953_0020510
620 Ga0373956_0030772
621 Ga0373957_0010836
622 Ga0373946_0246460
623 Ga0373946_0343721
624 Ga0373955_0133531
625 Ga0373931_0005903
626 Ga0373947_0226549
627 Ga0372808_001697
628 Ga0372808_003100
629 Ga0373925_0000348
630 Ga0373925_0213201
631 Ga0373925_0332856
632 Ga0436364_0616054
633 Ga0436364_0635143
634 Ga0436364_0918714
635 Ga0436364_1242950
636 Ga0395901_0109497
637 Ga0395901_0151973
638 Ga0436365_0395422
639 Ga0436365_0776657
640 Ga0436365_1234754
641 Ga0436365_1532082
642 Ga0436365_1567051
643 Ga0436365_1775349
644 Ga0436360_0342892
645 Ga0436361_1196869
646 Ga0436363_0064177
647 Ga0436363_0444266
648 Ga0436363_0862621
649 Ga0436363_1206965
650 Ga0436363_1367767
651 Ga0436362_0038653
652 Ga0436362_0107205
653 Ga0436362_0777498
654 Ga0466969_0122603
655 Ga0466963_0002752
656 Ga0466963_0143593
657 Ga0466963_0149065
658 Ga0466964_0148846
659 Ga0466957_0185114
660 Ga0466960_0016899
661 Ga0466959_0094823
662 Ga0466959_0274450
663 Ga0466958_0230568
664 Ga0466967_0000490
665 Ga0466967_0015488
666 Ga0466967_0551055
667 Ga0495592_0087407
668 Ga0495629_0004698
669 Ga0495629_0106046
670 Ga0495629_0202503
671 Ga0495638_0078285
672 Ga0495651_0007812
673 Ga0495651_0125566
674 Ga0495582_0081419
675 Ga0495605_0007208
676 Ga0495639_0175400
677 Ga0495662_0002433
678 Ga0495664_0000400
679 Ga0495584_0119777
680 Ga0495585_0006439
681 Ga0495594_0105671
682 Ga0495607_0029888
683 Ga0495583_0032945
684 Ga0495608_0095055
685 Ga0495616_0065498
686 Ga0495618_0020370
687 Ga0495620_0003443
688 Ga0495628_0047670
689 Ga0495630_0028789
690 Ga0495630_0034603
691 Ga0495630_0105365
692 Ga0495632_0021245
693 Ga0495643_0011886
694 Ga0495643_0037557
695 Ga0495652_0049690
696 Ga0495652_0197134
697 Ga0495665_0199634
698 Ga0495640_0046918
699 Ga0495586_0014857
700 Ga0495587_0004174
701 Ga0495645_0119098
702 Ga0495645_0188064
703 Ga0495633_0114910
704 Ga0495667_0123338
705 Ga0495668_0043377
706 Ga0495634_0001317
707 Ga0495634_0107040
708 Ga0495635_0001732
709 Ga0495635_0174485
710 Ga0495588_0003346
711 Ga0495657_0016102
712 Ga0495657_0119110
713 Ga0495623_0023565
714 Ga0495646_0003922
715 Ga0495646_0073023
716 Ga0495658_0035513
717 Ga0495658_0055742
718 Ga0495658_0142859
719 Ga0495613_0065345
720 Ga0495613_0345781
721 Ga0495670_0003769
722 Ga0495589_0113573
723 Ga0495600_0003619
724 Ga0495660_0026834
725 Ga0495581_0008913
726 Ga0495604_0001180
727 Ga0495636_0022532
728 Ga0495674_0077021
729 Ga0495674_0089892
730 Ga0495676_0043953
731 Ga0495680_0178777
732 Ga0495683_0057988
733 Ga0495687_060404
734 Ga0495687_075946
735 Ga0495675_0065782
736 Ga0495685_000633
737 Ga0495685_057658
738 Ga0495681_0004138
739 Ga0495684_0006975
740 Ga0495684_0112127
741 Ga0495593_0006546
742 Ga0495602_0047319
743 Ga0495602_0076770
744 Ga0495614_0007392
745 Ga0495626_0211216
746 Ga0496100_0007365
747 Ga0496101_0002168
748 Ga0496102_0068582
749 Ga0496102_0194524
750 Ga0496103_0068669
751 Ga0496104_0004870
752 Ga0496104_0080646
753 Ga0496104_0083285
754 Ga0496104_0106122
755 Ga0496104_0141759
756 Ga0496105_0008903
757 Ga0496105_0023847
758 Ga0496106_0073551
759 Ga0496106_0078172
760 Ga0496106_0245204
761 Ga0496107_0015854
762 Ga0496107_0071382
763 Ga0496108_0007279
764 Ga0496108_0158455
765 Ga0496108_0406565
766 Ga0496109_0002612
767 Ga0496110_0019526
768 Ga0496110_0204772
769 Ga0496111_0020513
770 Ga0496112_0193384
771 Ga0496112_0264663
772 Ga0496112_0654780
773 Ga0496113_0035929
774 Ga0496113_0098063
775 Ga0496113_0102983
776 Ga0496114_0051666
777 Ga0496114_0095531
778 Ga0496115_0301812
779 Ga0496126_0035786
780 Ga0496126_0086524
781 Ga0501033_0230307
782 Ga0501034_0191438
783 Ga0501036_0001860
784 Ga0501037_0042303
785 Ga0501039_0001552
786 Ga0501042_0026185
787 Ga0501043_0055829
788 Ga0501046_0026266
789 Ga0501047_0095764
790 Ga0501047_0359194
791 Ga0501048_0000411
792 Ga0501068_0279687
793 Ga0501080_0219843
794 Ga0501080_0463938
795 Ga0501035_0078116
796 Ga0501035_0202291
797 Ga0501045_0074691
798 nmdc:mga05p37_575494_c1
799 nmdc:mga06r32_179049_c1
800 nmdc:mga0n895_31029_c1
801 nmdc:mga0n895_33921_c1
802 nmdc:mga0n895_364852_c1
803 nmdc:mga0rr50_322332_c1
804 nmdc:mga0rr50_372340_c1
805 nmdc:mga0rr50_9982_c1
806 nmdc:mga08x19_176638_c1
807 nmdc:mga0a205_281326_c1
808 Ga0495601_0140444
809 Ga0495601_0152074
810 Ga0495612_0081583
811 Ga0495619_0177244
812 Ga0500578_0024336
813 Ga0500654_067765
814 Ga0500553_075529
815 Ga0500621_115866
816 Ga0500628_000824
817 Ga0500652_011370
818 Ga0500658_0008513
819 Ga0500561_0001666
820 Ga0500600_0027856
821 Ga0500616_0013014
822 Ga0500624_002786
823 Ga0500633_0002840
824 Ga0500634_0012802
825 Ga0500656_001478
826 Ga0500587_001253

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

23

262

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g5d-assembly2.cif.gz_B x-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to nadph 0.9781 3 253
3f7j-assembly2.cif.gz_B b.subtilis yvgn 0.9779 2 254
4fzi-assembly2.cif.gz_B crystal structure of prostaglandin f synthase from trypanosoma cruzi 0.9688 1 254
3o0k-assembly1.cif.gz_A crystal structure of aldo/keto reductase from brucella melitensis 0.9675 2 253
4fzi-assembly1.cif.gz_A crystal structure of prostaglandin f synthase from trypanosoma cruzi 0.9664 1 254
ID Description Score Start End Superfamily
af_A0A0R0I9K3_1_172_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9765 117 254 3.20.20.100
af_Q4DJ07_1_282_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9738 2 254 3.20.20.100
af_Q2FXE2_1_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9706 1 254 3.20.20.100
af_B9FKK0_56_240_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9569 113 254 3.20.20.100
af_I1LNU9_3_315_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9568 1 254 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A538L0K3-F1-model_v4 Aldo/keto reductase 0.9972 4 267 GO:0004033
GO:0044281
AF-A0A3M2M2U4-F1-model_v4 Aldo/keto reductase 0.996 3 267 GO:0004033
GO:0044281
AF-A0A534Z3A0-F1-model_v4 Aldo/keto reductase 0.9958 28 267 GO:0004033
GO:0044281
AF-A0A7C9K0C8-F1-model_v4 Aldo/keto reductase 0.9938 3 267 GO:0004033
GO:0044281
AF-A0A6I9PBK9-F1-model_v4 Prostaglandin F synthase-like 0.9938 113 253 GO:0004033

Map