F438096

General Info

Members Datasets Scaffolds Average Seq Length
413 254 413 155

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10586614|Ga0265338_105866141
Length 154
Sequence MIETGATAPQFTLPDQDGNPVSLADYAGKTVVLYFYPKADTPGCTVQACGVRDHLPNYAEARAVDISPDPVRAVKKFADKQSLDFTLLADEDHAVCEQYGVWAEKSMYGRKYWGALRATFVIDGSGTVAHVIPRVTPRTHDDEVLAVLEQLAAA

Samples

Sample ID Description Type Environment
1 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
76 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
126 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
148 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
149 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
150 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
151 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
212 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.35
Metatranscriptomes 10.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 7.51
Rhizosphere 90.56
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_10100709 3300004800 Bacteria 582
2 Ga0070658_10701994 3300005327 Bacteria 878
3 Ga0070676_10074798 3300005328 Bacteria 2041
4 Ga0070683_100043704 3300005329 Bacteria 4130
5 Ga0070683_100077495 3300005329 Bacteria 3108
6 Ga0070683_100173524 3300005329 Unclassified 2047
7 Ga0070683_100420714 3300005329 Bacteria 1274
8 Ga0070683_100502202 3300005329 Bacteria 1159
9 Ga0070690_100837585 3300005330 Bacteria 716
10 Ga0070670_100235173 3300005331 Bacteria 1595
11 Ga0070666_11169819 3300005335 Bacteria 572
12 Ga0070682_100449228 3300005337 Bacteria 987
13 Ga0070682_100685892 3300005337 Bacteria 820
14 Ga0068868_100143209 3300005338 Bacteria 1964
15 Ga0070691_10028462 3300005341 Bacteria 2611
16 Ga0070668_100059926 3300005347 Bacteria 2947
17 Ga0070669_100020891 3300005353 Bacteria 4677
18 Ga0070671_100081358 3300005355 Bacteria 2708
19 Ga0070659_100000051 3300005366 Bacteria 97520
20 Ga0070659_100304450 3300005366 Bacteria 1330
21 Ga0070667_100252707 3300005367 Unclassified 1576
22 Ga0070709_10137324 3300005434 Bacteria 1676
23 Ga0070714_100000208 3300005435 Bacteria 47330
24 Ga0070714_100117053 3300005435 Bacteria 2366
25 Ga0070714_100198153 3300005435 Bacteria 1836
26 Ga0070710_10000013 3300005437 Bacteria 117825
27 Ga0070705_100002323 3300005440 Bacteria 9596
28 Ga0070700_100034450 3300005441 Bacteria 3059
29 Ga0070700_100852187 3300005441 Bacteria 738
30 Ga0070662_100025945 3300005457 Bacteria 4052
31 Ga0070706_100574791 3300005467 Bacteria 1048
32 Ga0070684_100256020 3300005535 Bacteria 1600
33 Ga0070684_100298410 3300005535 Bacteria 1478
34 Ga0070684_100628651 3300005535 Bacteria 999
35 Ga0070672_100263455 3300005543 Bacteria 1454
36 Ga0070695_100040980 3300005545 Bacteria 2934
37 Ga0070696_100103917 3300005546 Bacteria 2039
38 Ga0070665_100105535 3300005548 Bacteria 2820
39 Ga0070665_101361681 3300005548 Bacteria 719
40 Ga0068855_100130767 3300005563 Bacteria 2867
41 Ga0068855_100275556 3300005563 Bacteria 1870
42 Ga0068855_100282490 3300005563 Unclassified 1843
43 Ga0068855_100909558 3300005563 Bacteria 929
44 Ga0070664_100120858 3300005564 Bacteria 2293
45 Ga0068857_100042421 3300005577 Bacteria 4036
46 Ga0068857_100916161 3300005577 Unclassified 841
47 Ga0068854_101474366 3300005578 Bacteria 617
48 Ga0068856_100273813 3300005614 Bacteria 1704
49 Ga0068856_101075128 3300005614 Unclassified 822
50 Ga0068852_100288530 3300005616 Bacteria 1584
51 Ga0068864_100772257 3300005618 Bacteria 943
52 Ga0068861_100001054 3300005719 Bacteria 16968
53 Ga0068861_101266088 3300005719 Bacteria 716
54 Ga0068851_10188701 3300005834 Bacteria 1145
55 Ga0068870_10062915 3300005840 Bacteria 2000
56 Ga0068870_10129130 3300005840 Bacteria 1466
57 Ga0068862_100195659 3300005844 Bacteria 1821
58 Ga0081538_10006164 3300005981 Bacteria 10632
59 Ga0070717_10000028 3300006028 Bacteria 144976
60 Ga0070712_100000005 3300006175 Bacteria 177449
61 Ga0075428_101357359 3300006844 Bacteria 747
62 Ga0075430_100612285 3300006846 Bacteria 898
63 Ga0075431_100043579 3300006847 Bacteria 4628
64 Ga0075431_100427352 3300006847 Bacteria 1323
65 Ga0075431_101657440 3300006847 Bacteria 597
66 Ga0075434_101609489 3300006871 Bacteria 658
67 Ga0068865_100261932 3300006881 Bacteria 1369
68 Ga0068865_100437217 3300006881 Bacteria 1079
69 Ga0105240_10041411 3300009093 Bacteria 5879
70 Ga0105240_10337836 3300009093 Bacteria 1712
71 Ga0105240_10430557 3300009093 Archaea 1480
72 Ga0111539_10015656 3300009094 Bacteria 9426
73 Ga0105245_10007235 3300009098 Bacteria 9723
74 Ga0105245_10039258 3300009098 Bacteria 4214
75 Ga0105245_10135712 3300009098 Bacteria 2312
76 Ga0105245_10420352 3300009098 Bacteria 1340
77 Ga0105247_10261018 3300009101 Bacteria 1188
78 Ga0114129_12683755 3300009147 Bacteria 594
79 Ga0105243_10840357 3300009148 Bacteria 908
80 Ga0105243_11179008 3300009148 Bacteria 778
81 Ga0105241_10015054 3300009174 Bacteria 5666
82 Ga0105242_10721447 3300009176 Bacteria 978
83 Ga0105248_10195306 3300009177 Bacteria 2280
84 Ga0105248_11022640 3300009177 Bacteria 934
85 Ga0105248_11698874 3300009177 Bacteria 716
86 Ga0105248_13337808 3300009177 Bacteria 510
87 Ga0105238_10140391 3300009551 Bacteria 2393
88 Ga0105238_10448240 3300009551 Bacteria 1287
89 Ga0105238_11358170 3300009551 Bacteria 737
90 Ga0105249_10005517 3300009553 Bacteria 10927
91 Ga0105249_10608506 3300009553 Bacteria 1148
92 Ga0105249_10824693 3300009553 Bacteria 992
93 Ga0105239_10036177 3300010375 Bacteria 5422
94 Ga0105239_10036902 3300010375 Bacteria 5362
95 Ga0105239_10093346 3300010375 Bacteria 3323
96 Ga0105239_10683351 3300010375 Bacteria 1173
97 Ga0105246_10014744 3300011119 Bacteria 4921
98 Ga0105246_10124922 3300011119 Bacteria 1913
99 Ga0105246_10492399 3300011119 Bacteria 1039
100 Ga0157329_1020449 3300012491 Bacteria 616
101 Ga0157373_10244842 3300013100 Bacteria 1268
102 Ga0157371_10063739 3300013102 Bacteria 2612
103 Ga0157370_10090508 3300013104 Bacteria 2873
104 Ga0157369_10418003 3300013105 Bacteria 1390
105 Ga0157369_10515435 3300013105 Bacteria 1237
106 Ga0157369_11799317 3300013105 Bacteria 622
107 Ga0157374_12213297 3300013296 Bacteria 577
108 Ga0163162_10469974 3300013306 Bacteria 1389
109 Ga0163162_11528161 3300013306 Bacteria 761
110 Ga0157372_10098828 3300013307 Bacteria 3329
111 Ga0157372_10163807 3300013307 Bacteria 2571
112 Ga0157372_10236895 3300013307 Bacteria 2117
113 Ga0157372_10272566 3300013307 Bacteria 1967
114 Ga0157372_10307215 3300013307 Bacteria 1846
115 Ga0157372_10987832 3300013307 Bacteria 975
116 Ga0157372_11585109 3300013307 Unclassified 754
117 Ga0157375_10062665 3300013308 Bacteria 3696
118 Ga0157375_11148134 3300013308 Bacteria 910
119 Ga0163163_10750165 3300014325 Bacteria 1039
120 Ga0157380_10655832 3300014326 Bacteria 1048
121 Ga0157377_10065819 3300014745 Bacteria 2083
122 Ga0157376_10054487 3300014969 Bacteria 3334
123 Ga0157376_12372027 3300014969 Bacteria 570
124 Ga0197907_11047776 3300020069 Bacteria 916
125 Ga0206356_11229144 3300020070 Bacteria 781
126 Ga0206355_1209021 3300020076 Bacteria 852
127 Ga0206351_10635610 3300020077 Bacteria 776
128 Ga0206352_10500736 3300020078 Bacteria 918
129 Ga0154015_1001563 3300020610 Bacteria 800
130 Ga0207426_1019287 3300025302 Bacteria 2387
131 Ga0207656_10190583 3300025321 Bacteria 987
132 Ga0207692_10000003 3300025898 Bacteria 431531
133 Ga0207710_10159488 3300025900 Bacteria 1098
134 Ga0207688_10020911 3300025901 Bacteria 3572
135 Ga0207688_10526258 3300025901 Bacteria 742
136 Ga0207643_10094068 3300025908 Bacteria 1750
137 Ga0207705_10296401 3300025909 Bacteria 1240
138 Ga0207705_11217334 3300025909 Bacteria 577
139 Ga0207695_10127917 3300025913 Bacteria 2500
140 Ga0207693_10000023 3300025915 Bacteria 127876
141 Ga0207662_10549052 3300025918 Bacteria 800
142 Ga0207649_10127552 3300025920 Bacteria 1724
143 Ga0207649_10334487 3300025920 Bacteria 1116
144 Ga0207649_10346351 3300025920 Bacteria 1098
145 Ga0207681_10060818 3300025923 Bacteria 2594
146 Ga0207694_10326995 3300025924 Bacteria 1266
147 Ga0207694_11026859 3300025924 Bacteria 698
148 Ga0207650_10043722 3300025925 Bacteria 3290
149 Ga0207687_10014471 3300025927 Bacteria 5162
150 Ga0207687_10023124 3300025927 Bacteria 4140
151 Ga0207700_11057457 3300025928 Bacteria 726
152 Ga0207664_10000174 3300025929 Bacteria 50477
153 Ga0207664_10001581 3300025929 Bacteria 14964
154 Ga0207664_10211330 3300025929 Bacteria 1679
155 Ga0207690_10000054 3300025932 Bacteria 104097
156 Ga0207690_10738688 3300025932 Bacteria 811
157 Ga0207706_10004795 3300025933 Bacteria 12670
158 Ga0207709_10101822 3300025935 Bacteria 1900
159 Ga0207709_10229139 3300025935 Bacteria 1345
160 Ga0207669_10721963 3300025937 Bacteria 821
161 Ga0207704_10335339 3300025938 Bacteria 1172
162 Ga0207665_10542422 3300025939 Bacteria 903
163 Ga0207711_10728538 3300025941 Bacteria 925
164 Ga0207711_11017838 3300025941 Bacteria 768
165 Ga0207689_10295969 3300025942 Bacteria 1341
166 Ga0207661_10088892 3300025944 Bacteria 2569
167 Ga0207661_10112194 3300025944 Unclassified 2308
168 Ga0207679_10193926 3300025945 Bacteria 1691
169 Ga0207679_10599278 3300025945 Bacteria 993
170 Ga0207667_10224134 3300025949 Bacteria 1926
171 Ga0207651_11412041 3300025960 Archaea 627
172 Ga0207712_10020593 3300025961 Bacteria 4322
173 Ga0207668_10026749 3300025972 Bacteria 3750
174 Ga0207640_10966021 3300025981 Bacteria 748
175 Ga0207658_10226430 3300025986 Unclassified 1576
176 Ga0207677_10211746 3300026023 Bacteria 1548
177 Ga0207678_10170866 3300026067 Bacteria 1856
178 Ga0207678_10188999 3300026067 Bacteria 1760
179 Ga0207708_10055136 3300026075 Bacteria 3030
180 Ga0207708_11630839 3300026075 Bacteria 567
181 Ga0207702_10399881 3300026078 Bacteria 1325
182 Ga0207641_10317727 3300026088 Bacteria 1476
183 Ga0207648_11502818 3300026089 Bacteria 633
184 Ga0207676_10680632 3300026095 Bacteria 995
185 Ga0207676_11150148 3300026095 Bacteria 768
186 Ga0207674_10022920 3300026116 Bacteria 6699
187 Ga0207674_10354633 3300026116 Bacteria 1418
188 Ga0207675_100006729 3300026118 Bacteria 10869
189 Ga0207675_100684199 3300026118 Bacteria 1034
190 Ga0207675_101678376 3300026118 Bacteria 655
191 Ga0207683_10685147 3300026121 Bacteria 950
192 Ga0207683_10783317 3300026121 Bacteria 885
193 Ga0207698_10014102 3300026142 Bacteria 5299
194 Ga0207698_10097247 3300026142 Bacteria 2429
195 Ga0207698_10684037 3300026142 Bacteria 1019
196 Ga0207698_11101113 3300026142 Bacteria 807
197 Ga0207428_10093182 3300027907 Bacteria 2337
198 Ga0268266_11054738 3300028379 Bacteria 786
199 Ga0268266_11371139 3300028379 Bacteria 683
200 Ga0265326_10000005 3300028558 Bacteria 257124
201 Ga0265319_1000614 3300028563 Bacteria 23559
202 Ga0265319_1176197 3300028563 Bacteria 659
203 Ga0265334_10000001 3300028573 Bacteria 343037
204 Ga0265334_10108467 3300028573 Bacteria 999
205 Ga0265318_10040201 3300028577 Bacteria 1781
206 Ga0265322_10050420 3300028654 Bacteria 1182
207 Ga0265338_10002112 3300028800 Bacteria 30624
208 Ga0265338_10341765 3300028800 Bacteria 1078
209 Ga0265338_10586614 3300028800 Bacteria 777
210 Ga0265338_11124087 3300028800 Bacteria 529
211 Ga0265324_10009825 3300029957 Bacteria 3717
212 Ga0265340_10039984 3300031247 Bacteria 2311
213 Ga0265316_10176454 3300031344 Bacteria 1592
214 Ga0265314_10136075 3300031711 Bacteria 1525
215 Ga0307405_10156056 3300031731 Bacteria 1611
216 Ga0307405_10309270 3300031731 Bacteria 1202
217 Ga0307405_10956243 3300031731 Bacteria 728
218 Ga0307413_10168376 3300031824 Bacteria 1548
219 Ga0307413_10337327 3300031824 Bacteria 1158
220 Ga0307410_10375779 3300031852 Bacteria 1142
221 Ga0307407_10071090 3300031903 Bacteria 2071
222 Ga0307407_10541903 3300031903 Bacteria 859
223 Ga0307409_100011950 3300031995 Bacteria 5504
224 Ga0307409_100016426 3300031995 Bacteria 4897
225 Ga0307409_100296047 3300031995 Bacteria 1503
226 Ga0307409_100489910 3300031995 Bacteria 1195
227 Ga0307409_100773085 3300031995 Bacteria 966
228 Ga0307416_100005121 3300032002 Bacteria 8004
229 Ga0307416_100042252 3300032002 Bacteria 3558
230 Ga0307416_101248423 3300032002 Unclassified 849
231 Ga0307411_10040419 3300032005 Bacteria 2959
232 Ga0307411_11231336 3300032005 Bacteria 680
233 Ga0307411_11478465 3300032005 Bacteria 624
234 Ga0307415_100043297 3300032126 Bacteria 3003
235 Ga0307415_100439424 3300032126 Bacteria 1125
236 Ga0307415_100592016 3300032126 Bacteria 985
237 Ga0307415_100718310 3300032126 Bacteria 904
238 Ga0307415_100802418 3300032126 Bacteria 859
239 Ga0307415_101125741 3300032126 Bacteria 736
240 Ga0395900_0503925 3300037418 Bacteria 1161
241 Ga0395900_1367932 3300037418 Bacteria 621
242 Ga0395898_0345486 3300037466 Bacteria 1419
243 Ga0395898_0798422 3300037466 Bacteria 884
244 Ga0395905_1186343 3300037471 Bacteria 667
245 Ga0395901_0014752 3300038443 Bacteria 7941
246 Ga0395901_0133879 3300038443 Bacteria 2605
247 Ga0395901_0527231 3300038443 Bacteria 1199
248 Ga0395901_1623752 3300038443 Bacteria 599
249 Ga0451791_0910948 3300041451 Bacteria 1159
250 Ga0451793_0018934 3300041452 Bacteria 907
251 Ga0451804_1044021 3300041463 Bacteria 632
252 Ga0451807_0431266 3300041486 Bacteria 542
253 Ga0451837_1801188 3300041494 Bacteria 715
254 Ga0451849_1014958 3300041505 Bacteria 780
255 Ga0451853_0809806 3300041512 Bacteria 766
256 Ga0466972_0390873 3300044658 Bacteria 652
257 Ga0466972_0431407 3300044658 Bacteria 618
258 Ga0466965_0305351 3300044683 Bacteria 864
259 Ga0466964_0025680 3300044706 Bacteria 2302
260 Ga0466964_0363691 3300044706 Bacteria 747
261 Ga0466964_0517923 3300044706 Bacteria 643
262 Ga0466964_0656833 3300044706 Bacteria 580
263 Ga0466971_0054456 3300044719 Bacteria 1803
264 Ga0466971_0083419 3300044719 Bacteria 1459
265 Ga0466970_0079083 3300044765 Bacteria 1775
266 Ga0466960_0074055 3300044901 Bacteria 1701
267 Ga0466960_0105827 3300044901 Bacteria 1455
268 Ga0466958_0273148 3300045836 Bacteria 1083
269 Ga0466958_0621770 3300045836 Bacteria 703
270 Ga0466967_0041636 3300045976 Bacteria 3963
271 Ga0466967_0042564 3300045976 Bacteria 3925
272 Ga0466967_0103678 3300045976 Bacteria 2603
273 Ga0466967_0163989 3300045976 Bacteria 2088
274 Ga0466967_0259001 3300045976 Bacteria 1664
275 Ga0466967_0316084 3300045976 Bacteria 1505
276 Ga0466967_0667247 3300045976 Bacteria 1029
277 Ga0466967_1040413 3300045976 Bacteria 815
278 Ga0466967_1581038 3300045976 Bacteria 653
279 Ga0495580_0187110 3300046472 Bacteria 1429
280 Ga0495582_0035958 3300046473 Bacteria 2724
281 Ga0495639_0032544 3300046475 Bacteria 2326
282 Ga0495662_0049202 3300046476 Bacteria 2035
283 Ga0495608_0495771 3300046511 Bacteria 740
284 Ga0495630_0002310 3300046517 Bacteria 13259
285 Ga0495652_0148683 3300046529 Bacteria 1833
286 Ga0495665_0069516 3300046531 Bacteria 1856
287 Ga0495597_0377809 3300046542 Bacteria 541
288 Ga0495668_0396109 3300046616 Bacteria 759
289 Ga0495635_0312848 3300046663 Bacteria 1052
290 Ga0495588_0044558 3300046674 Bacteria 2273
291 Ga0495588_0307237 3300046674 Unclassified 835
292 Ga0495646_0043764 3300046680 Bacteria 2740
293 Ga0495624_0011675 3300046690 Bacteria 6032
294 Ga0495674_0003185 3300047319 Bacteria 15947
295 Ga0495672_0003254 3300047320 Bacteria 14084
296 Ga0495672_0016814 3300047320 Bacteria 4909
297 Ga0495676_0179692 3300047321 Bacteria 1484
298 Ga0495675_0129273 3300047444 Bacteria 1571
299 Ga0495684_0006747 3300047471 Bacteria 8913
300 Ga0495614_0175101 3300048089 Bacteria 964
301 Ga0496100_0672644 3300048903 Bacteria 807
302 Ga0496101_0001252 3300048904 Bacteria 15196
303 Ga0496101_0178431 3300048904 Bacteria 1635
304 Ga0496101_0439751 3300048904 Bacteria 1029
305 Ga0496104_0000006 3300048907 Bacteria 536446
306 Ga0496104_0046931 3300048907 Bacteria 4070
307 Ga0496104_1151396 3300048907 Bacteria 679
308 Ga0496105_0089651 3300048908 Bacteria 2540
309 Ga0496106_0211353 3300048909 Bacteria 1546
310 Ga0496106_0405519 3300048909 Bacteria 1096
311 Ga0496108_0041847 3300048911 Bacteria 3825
312 Ga0496108_0096964 3300048911 Bacteria 2512
313 Ga0496108_0790863 3300048911 Bacteria 819
314 Ga0496108_1541722 3300048911 Bacteria 552
315 Ga0496109_0013927 3300048912 Bacteria 6993
316 Ga0496109_0017372 3300048912 Bacteria 6305
317 Ga0496110_0000044 3300048913 Bacteria 61218
318 Ga0496110_0052122 3300048913 Bacteria 3596
319 Ga0496110_0377822 3300048913 Bacteria 1291
320 Ga0496110_0801639 3300048913 Bacteria 846
321 Ga0496111_0000304 3300048914 Bacteria 24108
322 Ga0496111_0077459 3300048914 Bacteria 2424
323 Ga0496111_0134973 3300048914 Bacteria 1827
324 Ga0496112_0000865 3300048915 Bacteria 21683
325 Ga0496112_0047984 3300048915 Bacteria 4188
326 Ga0496112_0613469 3300048915 Bacteria 1019
327 Ga0496113_0097877 3300048916 Bacteria 2270
328 Ga0496124_0101505 3300048927 Bacteria 2331
329 Ga0501031_0231240 3300049568 Bacteria 1203
330 Ga0501033_0872553 3300049570 Bacteria 606
331 Ga0501036_0038846 3300049572 Bacteria 4030
332 Ga0501036_0259993 3300049572 Bacteria 1454
333 Ga0501038_0780915 3300049574 Bacteria 711
334 Ga0501039_0720686 3300049575 Bacteria 779
335 Ga0501040_1284980 3300049576 Bacteria 531
336 Ga0501041_0017659 3300049577 Bacteria 4246
337 Ga0501041_0021418 3300049577 Bacteria 3874
338 Ga0501042_0301735 3300049578 Bacteria 1157
339 Ga0501042_0408371 3300049578 Bacteria 984
340 Ga0501042_0853009 3300049578 Bacteria 663
341 Ga0501043_0060315 3300049579 Bacteria 2978
342 Ga0501048_0125454 3300049582 Bacteria 1815
343 Ga0501048_0145018 3300049582 Bacteria 1679
344 Ga0501068_0194798 3300049584 Bacteria 1285
345 Ga0501068_0763072 3300049584 Bacteria 633
346 Ga0501069_0001703 3300049585 Bacteria 10945
347 Ga0501071_0016062 3300049587 Bacteria 5145
348 Ga0501072_0245835 3300049588 Bacteria 1425
349 Ga0501074_0310737 3300049590 Bacteria 1120
350 Ga0501075_0107023 3300049591 Bacteria 2125
351 Ga0501076_1202946 3300049592 Bacteria 624
352 Ga0501207_109774 3300049654 Bacteria 562
353 Ga0501243_114332 3300049675 Bacteria 555
354 Ga0501079_0268388 3300049741 Bacteria 1334
355 Ga0501081_0253228 3300049743 Bacteria 1286
356 Ga0501035_0160412 3300049822 Bacteria 1947
357 Ga0501035_1359458 3300049822 Bacteria 546
358 Ga0501045_0191517 3300049824 Bacteria 1524
359 nmdc:mga00v17_401296_c1 3300050491 Bacteria 891
360 nmdc:mga09592_1982_c1 3300050508 Bacteria 16507
361 nmdc:mga09592_901701_c1 3300050508 Bacteria 743
362 nmdc:mga0qj67_508770_c1 3300050509 Bacteria 968
363 nmdc:mga06r32_638501_c1 3300050510 Bacteria 1033
364 nmdc:mga08y16_71341_c1 3300050511 Bacteria 3620
365 nmdc:mga0n895_669624_c1 3300050512 Bacteria 1035
366 nmdc:mga0a205_179920_c1 3300050515 Bacteria 2009
367 nmdc:mga0a205_696921_c1 3300050515 Bacteria 865
368 Ga0500568_0049479 3300053139 Bacteria 1659
369 Ga0500616_0031899 3300053153 Bacteria 2882
370 Ga0501084_0207861 3300054114 Bacteria 1652
371 Ga0501084_0393353 3300054114 Bacteria 1171
372 Ga0501084_1071684 3300054114 Bacteria 677
373 Ga0587084_047229 3300059477 Bacteria 752
374 Ga0587084_066410 3300059477 Bacteria 672
375 Ga0587084_067337 3300059477 Bacteria 669
376 Ga0587093_049731 3300059478 Bacteria 659
377 Ga0587066_019227 3300059490 Bacteria 1109
378 Ga0587066_028794 3300059490 Bacteria 975
379 Ga0587066_071355 3300059490 Bacteria 732
380 Ga0587073_0047115 3300059492 Bacteria 963
381 Ga0587073_0112071 3300059492 Bacteria 724
382 Ga0587077_106201 3300059493 Bacteria 682
383 Ga0587077_136152 3300059493 Bacteria 628
384 Ga0587080_038021 3300059503 Bacteria 866
385 Ga0587080_071094 3300059503 Bacteria 696
386 Ga0587085_051254 3300059506 Bacteria 753
387 Ga0587086_037892 3300059507 Bacteria 735
388 Ga0587088_134838 3300059508 Bacteria 584
389 Ga0587089_042933 3300059509 Bacteria 705
390 Ga0587090_021634 3300059510 Bacteria 1010
391 Ga0587091_074101 3300059511 Bacteria 751
392 Ga0587092_024185 3300059512 Bacteria 962
393 Ga0587094_037442 3300059513 Bacteria 777
394 Ga0587095_018925 3300059514 Bacteria 649
395 Ga0587101_044955 3300059623 Bacteria 742
396 Ga0587115_021711 3300059626 Bacteria 899
397 Ga0587117_060867 3300059627 Bacteria 648
398 Ga0587128_048869 3300059630 Bacteria 766
399 Ga0587128_071595 3300059630 Bacteria 676
400 Ga0587062_032648 3300059639 Bacteria 806
401 Ga0587068_071328 3300059641 Bacteria 686
402 Ga0587068_072872 3300059641 Bacteria 681
403 Ga0587069_062349 3300059642 Bacteria 690
404 Ga0587075_051885 3300059644 Bacteria 718
405 Ga0587079_066821 3300059647 Bacteria 793
406 Ga0587124_015215 3300059660 Bacteria 738
407 Ga0587111_0019749 3300060346 Bacteria 1282
408 Ga0587111_0023934 3300060346 Bacteria 1198
409 Ga0587111_0074973 3300060346 Bacteria 797
410 Ga0501082_0079125 3300060353 Bacteria 2836
411 Ga0501082_0749224 3300060353 Bacteria 855
412 Ga0530510_0028131 3300061734 Bacteria 4031
413 Ga0530510_0453040 3300061734 Bacteria 970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100043704 Ga0070683_1000437047 137
2 3300005535 Ga0070684_100298410 Ga0070684_1002984101 137
3 3300005563 Ga0068855_100130767 Ga0068855_1001307672 137
4 3300005577 Ga0068857_100042421 Ga0068857_1000424212 137
5 3300009093 Ga0105240_10337836 Ga0105240_103378363 137
6 3300009174 Ga0105241_10015054 Ga0105241_100150546 137
7 3300009551 Ga0105238_10140391 Ga0105238_101403912 137
8 3300010375 Ga0105239_10036902 Ga0105239_100369022 137
9 3300013105 Ga0157369_10418003 Ga0157369_104180031 137
10 3300013307 Ga0157372_10098828 Ga0157372_100988283 137
11 3300025924 Ga0207694_10326995 Ga0207694_103269952 137
12 3300025944 Ga0207661_10088892 Ga0207661_100888924 137
13 3300026116 Ga0207674_10022920 Ga0207674_100229204 137
14 3300025918 Ga0207662_10549052 Ga0207662_105490521 138
15 3300026089 Ga0207648_11502818 Ga0207648_115028181 139
16 3300045976 Ga0466967_0667247 Ga0466967_0667247_34_507 139
17 3300005329 Ga0070683_100420714 Ga0070683_1004207142 141
18 3300005331 Ga0070670_100235173 Ga0070670_1002351733 141
19 3300005337 Ga0070682_100449228 Ga0070682_1004492282 141
20 3300005535 Ga0070684_100256020 Ga0070684_1002560203 141
21 3300005564 Ga0070664_100120858 Ga0070664_1001208584 141
22 3300005618 Ga0068864_100772257 Ga0068864_1007722572 141
23 3300025925 Ga0207650_10043722 Ga0207650_100437222 141
24 3300025945 Ga0207679_10193926 Ga0207679_101939263 141
25 3300026095 Ga0207676_10680632 Ga0207676_106806322 141
26 3300026067 Ga0207678_10188999 Ga0207678_101889993 144
27 3300005330 Ga0070690_100837585 Ga0070690_1008375852 147
28 3300005335 Ga0070666_11169819 Ga0070666_111698191 147
29 3300005355 Ga0070671_100081358 Ga0070671_1000813583 147
30 3300005367 Ga0070667_100252707 Ga0070667_1002527074 147
31 3300006881 Ga0068865_100261932 Ga0068865_1002619322 147
32 3300009177 Ga0105248_10195306 Ga0105248_101953065 147
33 3300025941 Ga0207711_11017838 Ga0207711_110178381 147
34 3300025986 Ga0207658_10226430 Ga0207658_102264301 147
35 3300026088 Ga0207641_10317727 Ga0207641_103177272 147
36 3300028800 Ga0265338_10586614 Ga0265338_105866141 147
37 3300005434 Ga0070709_10137324 Ga0070709_101373242 148
38 3300004800 Ga0058861_10100709 Ga0058861_101007091 149
39 3300005327 Ga0070658_10701994 Ga0070658_107019942 149
40 3300005328 Ga0070676_10074798 Ga0070676_100747981 149
41 3300005329 Ga0070683_100077495 Ga0070683_1000774953 149
42 3300005329 Ga0070683_100173524 Ga0070683_1001735242 149
43 3300005329 Ga0070683_100502202 Ga0070683_1005022022 149
44 3300005337 Ga0070682_100685892 Ga0070682_1006858922 149
45 3300005338 Ga0068868_100143209 Ga0068868_1001432092 149
46 3300005341 Ga0070691_10028462 Ga0070691_100284623 149
47 3300005347 Ga0070668_100059926 Ga0070668_1000599263 149
48 3300005353 Ga0070669_100020891 Ga0070669_1000208919 149
49 3300005366 Ga0070659_100000051 Ga0070659_10000005183 149
50 3300005366 Ga0070659_100304450 Ga0070659_1003044502 149
51 3300005435 Ga0070714_100000208 Ga0070714_10000020838 149
52 3300005435 Ga0070714_100117053 Ga0070714_1001170532 149
53 3300005435 Ga0070714_100198153 Ga0070714_1001981533 149
54 3300005437 Ga0070710_10000013 Ga0070710_1000001373 149
55 3300005440 Ga0070705_100002323 Ga0070705_1000023232 149
56 3300005441 Ga0070700_100034450 Ga0070700_1000344501 149
57 3300005441 Ga0070700_100852187 Ga0070700_1008521872 149
58 3300005457 Ga0070662_100025945 Ga0070662_1000259457 149
59 3300005467 Ga0070706_100574791 Ga0070706_1005747912 149
60 3300005535 Ga0070684_100628651 Ga0070684_1006286512 149
61 3300005543 Ga0070672_100263455 Ga0070672_1002634552 149
62 3300005545 Ga0070695_100040980 Ga0070695_1000409805 149
63 3300005546 Ga0070696_100103917 Ga0070696_1001039173 149
64 3300005548 Ga0070665_100105535 Ga0070665_1001055352 149
65 3300005548 Ga0070665_101361681 Ga0070665_1013616812 149
66 3300005563 Ga0068855_100275556 Ga0068855_1002755562 149
67 3300005563 Ga0068855_100282490 Ga0068855_1002824902 149
68 3300005563 Ga0068855_100909558 Ga0068855_1009095581 149
69 3300005577 Ga0068857_100916161 Ga0068857_1009161612 149
70 3300005578 Ga0068854_101474366 Ga0068854_1014743662 149
71 3300005614 Ga0068856_100273813 Ga0068856_1002738133 149
72 3300005614 Ga0068856_101075128 Ga0068856_1010751281 149
73 3300005616 Ga0068852_100288530 Ga0068852_1002885301 149
74 3300005719 Ga0068861_100001054 Ga0068861_10000105413 149
75 3300005719 Ga0068861_101266088 Ga0068861_1012660882 149
76 3300005834 Ga0068851_10188701 Ga0068851_101887011 149
77 3300005840 Ga0068870_10062915 Ga0068870_100629152 149
78 3300005840 Ga0068870_10129130 Ga0068870_101291301 149
79 3300005844 Ga0068862_100195659 Ga0068862_1001956592 149
80 3300005981 Ga0081538_10006164 Ga0081538_100061642 149
81 3300006028 Ga0070717_10000028 Ga0070717_1000002813 149
82 3300006175 Ga0070712_100000005 Ga0070712_100000005151 149
83 3300006844 Ga0075428_101357359 Ga0075428_1013573592 149
84 3300006846 Ga0075430_100612285 Ga0075430_1006122852 149
85 3300006847 Ga0075431_100043579 Ga0075431_1000435797 149
86 3300006847 Ga0075431_100427352 Ga0075431_1004273522 149
87 3300006847 Ga0075431_101657440 Ga0075431_1016574402 149
88 3300006871 Ga0075434_101609489 Ga0075434_1016094891 149
89 3300006881 Ga0068865_100437217 Ga0068865_1004372172 149
90 3300009093 Ga0105240_10041411 Ga0105240_100414113 149
91 3300009093 Ga0105240_10430557 Ga0105240_104305572 149
92 3300009094 Ga0111539_10015656 Ga0111539_100156563 149
93 3300009098 Ga0105245_10007235 Ga0105245_1000723512 149
94 3300009098 Ga0105245_10039258 Ga0105245_100392583 149
95 3300009098 Ga0105245_10135712 Ga0105245_101357122 149
96 3300009098 Ga0105245_10420352 Ga0105245_104203522 149
97 3300009101 Ga0105247_10261018 Ga0105247_102610182 149
98 3300009147 Ga0114129_12683755 Ga0114129_126837552 149
99 3300009148 Ga0105243_10840357 Ga0105243_108403572 149
100 3300009148 Ga0105243_11179008 Ga0105243_111790082 149
101 3300009176 Ga0105242_10721447 Ga0105242_107214472 149
102 3300009177 Ga0105248_11022640 Ga0105248_110226402 149
103 3300009177 Ga0105248_11698874 Ga0105248_116988742 149
104 3300009177 Ga0105248_13337808 Ga0105248_133378081 149
105 3300009551 Ga0105238_10448240 Ga0105238_104482402 149
106 3300009551 Ga0105238_11358170 Ga0105238_113581701 149
107 3300009553 Ga0105249_10005517 Ga0105249_1000551711 149
108 3300009553 Ga0105249_10608506 Ga0105249_106085062 149
109 3300009553 Ga0105249_10824693 Ga0105249_108246931 149
110 3300010375 Ga0105239_10036177 Ga0105239_100361775 149
111 3300010375 Ga0105239_10093346 Ga0105239_100933465 149
112 3300010375 Ga0105239_10683351 Ga0105239_106833512 149
113 3300011119 Ga0105246_10014744 Ga0105246_100147442 149
114 3300011119 Ga0105246_10124922 Ga0105246_101249222 149
115 3300011119 Ga0105246_10492399 Ga0105246_104923992 149
116 3300012491 Ga0157329_1020449 Ga0157329_10204491 149
117 3300013100 Ga0157373_10244842 Ga0157373_102448422 149
118 3300013102 Ga0157371_10063739 Ga0157371_100637394 149
119 3300013104 Ga0157370_10090508 Ga0157370_100905082 149
120 3300013105 Ga0157369_10515435 Ga0157369_105154352 149
121 3300013105 Ga0157369_11799317 Ga0157369_117993172 149
122 3300013296 Ga0157374_12213297 Ga0157374_122132971 149
123 3300013306 Ga0163162_10469974 Ga0163162_104699742 149
124 3300013306 Ga0163162_11528161 Ga0163162_115281612 149
125 3300013307 Ga0157372_10163807 Ga0157372_101638072 149
126 3300013307 Ga0157372_10236895 Ga0157372_102368951 149
127 3300013307 Ga0157372_10272566 Ga0157372_102725662 149
128 3300013307 Ga0157372_10307215 Ga0157372_103072153 149
129 3300013307 Ga0157372_10987832 Ga0157372_109878321 149
130 3300013307 Ga0157372_11585109 Ga0157372_115851091 149
131 3300013308 Ga0157375_10062665 Ga0157375_100626655 149
132 3300013308 Ga0157375_11148134 Ga0157375_111481342 149
133 3300014325 Ga0163163_10750165 Ga0163163_107501652 149
134 3300014326 Ga0157380_10655832 Ga0157380_106558322 149
135 3300014745 Ga0157377_10065819 Ga0157377_100658191 149
136 3300014969 Ga0157376_10054487 Ga0157376_100544872 149
137 3300014969 Ga0157376_12372027 Ga0157376_123720271 149
138 3300020069 Ga0197907_11047776 Ga0197907_110477761 149
139 3300020070 Ga0206356_11229144 Ga0206356_112291442 149
140 3300020076 Ga0206355_1209021 Ga0206355_12090211 149
141 3300020077 Ga0206351_10635610 Ga0206351_106356101 149
142 3300020078 Ga0206352_10500736 Ga0206352_105007362 149
143 3300020610 Ga0154015_1001563 Ga0154015_10015632 149
144 3300025302 Ga0207426_1019287 Ga0207426_10192872 149
145 3300025321 Ga0207656_10190583 Ga0207656_101905832 149
146 3300025898 Ga0207692_10000003 Ga0207692_10000003105 149
147 3300025900 Ga0207710_10159488 Ga0207710_101594882 149
148 3300025901 Ga0207688_10020911 Ga0207688_100209113 149
149 3300025901 Ga0207688_10526258 Ga0207688_105262581 149
150 3300025908 Ga0207643_10094068 Ga0207643_100940682 149
151 3300025909 Ga0207705_10296401 Ga0207705_102964011 149
152 3300025909 Ga0207705_11217334 Ga0207705_112173341 149
153 3300025913 Ga0207695_10127917 Ga0207695_101279172 149
154 3300025915 Ga0207693_10000023 Ga0207693_1000002323 149
155 3300025920 Ga0207649_10127552 Ga0207649_101275522 149
156 3300025920 Ga0207649_10334487 Ga0207649_103344872 149
157 3300025920 Ga0207649_10346351 Ga0207649_103463512 149
158 3300025923 Ga0207681_10060818 Ga0207681_100608185 149
159 3300025924 Ga0207694_11026859 Ga0207694_110268591 149
160 3300025927 Ga0207687_10014471 Ga0207687_100144714 149
161 3300025927 Ga0207687_10023124 Ga0207687_100231244 149
162 3300025928 Ga0207700_11057457 Ga0207700_110574572 149
163 3300025929 Ga0207664_10000174 Ga0207664_1000017440 149
164 3300025929 Ga0207664_10001581 Ga0207664_100015812 149
165 3300025929 Ga0207664_10211330 Ga0207664_102113302 149
166 3300025932 Ga0207690_10000054 Ga0207690_1000005466 149
167 3300025932 Ga0207690_10738688 Ga0207690_107386882 149
168 3300025933 Ga0207706_10004795 Ga0207706_100047956 149
169 3300025935 Ga0207709_10101822 Ga0207709_101018222 149
170 3300025935 Ga0207709_10229139 Ga0207709_102291393 149
171 3300025937 Ga0207669_10721963 Ga0207669_107219631 149
172 3300025938 Ga0207704_10335339 Ga0207704_103353392 149
173 3300025939 Ga0207665_10542422 Ga0207665_105424221 149
174 3300025941 Ga0207711_10728538 Ga0207711_107285382 149
175 3300025942 Ga0207689_10295969 Ga0207689_102959691 149
176 3300025944 Ga0207661_10112194 Ga0207661_101121944 149
177 3300025945 Ga0207679_10599278 Ga0207679_105992781 149
178 3300025949 Ga0207667_10224134 Ga0207667_102241342 149
179 3300025960 Ga0207651_11412041 Ga0207651_114120412 149
180 3300025961 Ga0207712_10020593 Ga0207712_100205935 149
181 3300025972 Ga0207668_10026749 Ga0207668_100267494 149
182 3300025981 Ga0207640_10966021 Ga0207640_109660212 149
183 3300026023 Ga0207677_10211746 Ga0207677_102117462 149
184 3300026067 Ga0207678_10170866 Ga0207678_101708661 149
185 3300026075 Ga0207708_10055136 Ga0207708_100551361 149
186 3300026075 Ga0207708_11630839 Ga0207708_116308391 149
187 3300026078 Ga0207702_10399881 Ga0207702_103998812 149
188 3300026095 Ga0207676_11150148 Ga0207676_111501481 149
189 3300026116 Ga0207674_10354633 Ga0207674_103546331 149
190 3300026118 Ga0207675_100006729 Ga0207675_10000672916 149
191 3300026118 Ga0207675_100684199 Ga0207675_1006841992 149
192 3300026118 Ga0207675_101678376 Ga0207675_1016783761 149
193 3300026121 Ga0207683_10685147 Ga0207683_106851472 149
194 3300026121 Ga0207683_10783317 Ga0207683_107833171 149
195 3300026142 Ga0207698_10014102 Ga0207698_100141024 149
196 3300026142 Ga0207698_10097247 Ga0207698_100972471 149
197 3300026142 Ga0207698_10684037 Ga0207698_106840372 149
198 3300026142 Ga0207698_11101113 Ga0207698_111011131 149
199 3300027907 Ga0207428_10093182 Ga0207428_100931823 149
200 3300028379 Ga0268266_11054738 Ga0268266_110547382 149
201 3300028379 Ga0268266_11371139 Ga0268266_113711392 149
202 3300028558 Ga0265326_10000005 Ga0265326_1000000517 149
203 3300028563 Ga0265319_1000614 Ga0265319_100061420 149
204 3300028563 Ga0265319_1176197 Ga0265319_11761971 149
205 3300028573 Ga0265334_10000001 Ga0265334_1000000122 149
206 3300028573 Ga0265334_10108467 Ga0265334_101084672 149
207 3300028577 Ga0265318_10040201 Ga0265318_100402013 149
208 3300028654 Ga0265322_10050420 Ga0265322_100504202 149
209 3300028800 Ga0265338_10002112 Ga0265338_1000211217 149
210 3300028800 Ga0265338_10341765 Ga0265338_103417652 149
211 3300028800 Ga0265338_11124087 Ga0265338_111240871 149
212 3300029957 Ga0265324_10009825 Ga0265324_100098252 149
213 3300031247 Ga0265340_10039984 Ga0265340_100399841 149
214 3300031344 Ga0265316_10176454 Ga0265316_101764543 149
215 3300031711 Ga0265314_10136075 Ga0265314_101360752 149
216 3300031731 Ga0307405_10156056 Ga0307405_101560562 149
217 3300031731 Ga0307405_10309270 Ga0307405_103092702 149
218 3300031731 Ga0307405_10956243 Ga0307405_109562432 149
219 3300031824 Ga0307413_10168376 Ga0307413_101683761 149
220 3300031824 Ga0307413_10337327 Ga0307413_103373272 149
221 3300031852 Ga0307410_10375779 Ga0307410_103757792 149
222 3300031903 Ga0307407_10071090 Ga0307407_100710901 149
223 3300031903 Ga0307407_10541903 Ga0307407_105419032 149
224 3300031995 Ga0307409_100011950 Ga0307409_1000119507 149
225 3300031995 Ga0307409_100016426 Ga0307409_1000164263 149
226 3300031995 Ga0307409_100296047 Ga0307409_1002960472 149
227 3300031995 Ga0307409_100489910 Ga0307409_1004899102 149
228 3300031995 Ga0307409_100773085 Ga0307409_1007730852 149
229 3300032002 Ga0307416_100005121 Ga0307416_1000051213 149
230 3300032002 Ga0307416_100042252 Ga0307416_1000422524 149
231 3300032002 Ga0307416_101248423 Ga0307416_1012484231 149
232 3300032005 Ga0307411_10040419 Ga0307411_100404192 149
233 3300032005 Ga0307411_11231336 Ga0307411_112313361 149
234 3300032005 Ga0307411_11478465 Ga0307411_114784652 149
235 3300032126 Ga0307415_100043297 Ga0307415_1000432973 149
236 3300032126 Ga0307415_100439424 Ga0307415_1004394242 149
237 3300032126 Ga0307415_100592016 Ga0307415_1005920162 149
238 3300032126 Ga0307415_100718310 Ga0307415_1007183101 149
239 3300032126 Ga0307415_100802418 Ga0307415_1008024181 149
240 3300032126 Ga0307415_101125741 Ga0307415_1011257411 149
241 3300037418 Ga0395900_0503925 Ga0395900_0503925_504_956 149
242 3300037418 Ga0395900_1367932 Ga0395900_1367932_138_611 149
243 3300037466 Ga0395898_0345486 Ga0395898_0345486_942_1394 149
244 3300037466 Ga0395898_0798422 Ga0395898_0798422_56_508 149
245 3300037471 Ga0395905_1186343 Ga0395905_1186343_137_628 149
246 3300038443 Ga0395901_0014752 Ga0395901_0014752_5418_5870 149
247 3300038443 Ga0395901_0133879 Ga0395901_0133879_166_639 149
248 3300038443 Ga0395901_0527231 Ga0395901_0527231_483_935 149
249 3300038443 Ga0395901_1623752 Ga0395901_1623752_59_511 149
250 3300041451 Ga0451791_0910948 Ga0451791_0910948_218_688 149
251 3300041452 Ga0451793_0018934 Ga0451793_0018934_169_678 149
252 3300041463 Ga0451804_1044021 Ga0451804_1044021_49_522 149
253 3300041486 Ga0451807_0431266 Ga0451807_0431266_66_518 149
254 3300041494 Ga0451837_1801188 Ga0451837_1801188_62_700 149
255 3300041505 Ga0451849_1014958 Ga0451849_1014958_46_516 149
256 3300041512 Ga0451853_0809806 Ga0451853_0809806_154_630 149
257 3300044658 Ga0466972_0390873 Ga0466972_0390873_100_594 149
258 3300044658 Ga0466972_0431407 Ga0466972_0431407_76_567 149
259 3300044683 Ga0466965_0305351 Ga0466965_0305351_367_837 149
260 3300044706 Ga0466964_0025680 Ga0466964_0025680_1246_1716 149
261 3300044706 Ga0466964_0363691 Ga0466964_0363691_84_572 149
262 3300044706 Ga0466964_0517923 Ga0466964_0517923_35_505 149
263 3300044706 Ga0466964_0656833 Ga0466964_0656833_26_496 149
264 3300044719 Ga0466971_0054456 Ga0466971_0054456_961_1455 149
265 3300044719 Ga0466971_0083419 Ga0466971_0083419_151_627 149
266 3300044765 Ga0466970_0079083 Ga0466970_0079083_878_1348 149
267 3300044901 Ga0466960_0074055 Ga0466960_0074055_206_754 149
268 3300044901 Ga0466960_0105827 Ga0466960_0105827_129_599 149
269 3300045836 Ga0466958_0273148 Ga0466958_0273148_262_756 149
270 3300045836 Ga0466958_0621770 Ga0466958_0621770_18_491 149
271 3300045976 Ga0466967_0041636 Ga0466967_0041636_2380_2859 149
272 3300045976 Ga0466967_0042564 Ga0466967_0042564_2976_3446 149
273 3300045976 Ga0466967_0103678 Ga0466967_0103678_1649_2119 149
274 3300045976 Ga0466967_0163989 Ga0466967_0163989_140_601 149
275 3300045976 Ga0466967_0259001 Ga0466967_0259001_216_686 149
276 3300045976 Ga0466967_0316084 Ga0466967_0316084_913_1383 149
277 3300045976 Ga0466967_1040413 Ga0466967_1040413_81_551 149
278 3300045976 Ga0466967_1581038 Ga0466967_1581038_169_639 149
279 3300046472 Ga0495580_0187110 Ga0495580_0187110_494_952 149
280 3300046473 Ga0495582_0035958 Ga0495582_0035958_1122_1607 149
281 3300046475 Ga0495639_0032544 Ga0495639_0032544_388_873 149
282 3300046476 Ga0495662_0049202 Ga0495662_0049202_117_602 149
283 3300046511 Ga0495608_0495771 Ga0495608_0495771_123_608 149
284 3300046517 Ga0495630_0002310 Ga0495630_0002310_3527_4012 149
285 3300046529 Ga0495652_0148683 Ga0495652_0148683_388_858 149
286 3300046531 Ga0495665_0069516 Ga0495665_0069516_417_902 149
287 3300046542 Ga0495597_0377809 Ga0495597_0377809_37_516 149
288 3300046616 Ga0495668_0396109 Ga0495668_0396109_20_517 149
289 3300046663 Ga0495635_0312848 Ga0495635_0312848_390_875 149
290 3300046674 Ga0495588_0044558 Ga0495588_0044558_1501_1959 149
291 3300046674 Ga0495588_0307237 Ga0495588_0307237_320_808 149
292 3300046680 Ga0495646_0043764 Ga0495646_0043764_2213_2698 149
293 3300046690 Ga0495624_0011675 Ga0495624_0011675_3283_3768 149
294 3300047319 Ga0495674_0003185 Ga0495674_0003185_2835_3320 149
295 3300047320 Ga0495672_0003254 Ga0495672_0003254_8774_9244 149
296 3300047320 Ga0495672_0016814 Ga0495672_0016814_3373_3861 149
297 3300047321 Ga0495676_0179692 Ga0495676_0179692_147_632 149
298 3300047444 Ga0495675_0129273 Ga0495675_0129273_869_1354 149
299 3300047471 Ga0495684_0006747 Ga0495684_0006747_6544_7029 149
300 3300048089 Ga0495614_0175101 Ga0495614_0175101_86_571 149
301 3300048903 Ga0496100_0672644 Ga0496100_0672644_150_620 149
302 3300048904 Ga0496101_0001252 Ga0496101_0001252_6584_7054 149
303 3300048904 Ga0496101_0178431 Ga0496101_0178431_45_512 149
304 3300048904 Ga0496101_0439751 Ga0496101_0439751_100_552 149
305 3300048907 Ga0496104_0000006 Ga0496104_0000006_400786_401256 149
306 3300048907 Ga0496104_0046931 Ga0496104_0046931_1145_1606 149
307 3300048907 Ga0496104_1151396 Ga0496104_1151396_43_513 149
308 3300048908 Ga0496105_0089651 Ga0496105_0089651_378_830 149
309 3300048909 Ga0496106_0211353 Ga0496106_0211353_717_1178 149
310 3300048909 Ga0496106_0405519 Ga0496106_0405519_603_1070 149
311 3300048911 Ga0496108_0041847 Ga0496108_0041847_3057_3524 149
312 3300048911 Ga0496108_0096964 Ga0496108_0096964_373_843 149
313 3300048911 Ga0496108_0790863 Ga0496108_0790863_335_805 149
314 3300048911 Ga0496108_1541722 Ga0496108_1541722_17_490 149
315 3300048912 Ga0496109_0013927 Ga0496109_0013927_1999_2469 149
316 3300048912 Ga0496109_0017372 Ga0496109_0017372_2011_2478 149
317 3300048913 Ga0496110_0000044 Ga0496110_0000044_18724_19194 149
318 3300048913 Ga0496110_0052122 Ga0496110_0052122_2993_3460 149
319 3300048913 Ga0496110_0377822 Ga0496110_0377822_104_574 149
320 3300048913 Ga0496110_0801639 Ga0496110_0801639_310_762 149
321 3300048914 Ga0496111_0000304 Ga0496111_0000304_8156_8626 149
322 3300048914 Ga0496111_0077459 Ga0496111_0077459_661_1131 149
323 3300048914 Ga0496111_0134973 Ga0496111_0134973_658_1125 149
324 3300048915 Ga0496112_0000865 Ga0496112_0000865_13718_14188 149
325 3300048915 Ga0496112_0047984 Ga0496112_0047984_3598_4059 149
326 3300048915 Ga0496112_0613469 Ga0496112_0613469_279_746 149
327 3300048916 Ga0496113_0097877 Ga0496113_0097877_1439_1909 149
328 3300048927 Ga0496124_0101505 Ga0496124_0101505_1361_1831 149
329 3300049568 Ga0501031_0231240 Ga0501031_0231240_162_632 149
330 3300049570 Ga0501033_0872553 Ga0501033_0872553_10_480 149
331 3300049572 Ga0501036_0038846 Ga0501036_0038846_1911_2381 149
332 3300049572 Ga0501036_0259993 Ga0501036_0259993_395_856 149
333 3300049574 Ga0501038_0780915 Ga0501038_0780915_135_596 149
334 3300049575 Ga0501039_0720686 Ga0501039_0720686_81_551 149
335 3300049576 Ga0501040_1284980 Ga0501040_1284980_30_503 149
336 3300049577 Ga0501041_0017659 Ga0501041_0017659_1276_1737 149
337 3300049577 Ga0501041_0021418 Ga0501041_0021418_2145_2615 149
338 3300049578 Ga0501042_0301735 Ga0501042_0301735_60_530 149
339 3300049578 Ga0501042_0408371 Ga0501042_0408371_44_514 149
340 3300049578 Ga0501042_0853009 Ga0501042_0853009_140_610 149
341 3300049579 Ga0501043_0060315 Ga0501043_0060315_1064_1531 149
342 3300049582 Ga0501048_0125454 Ga0501048_0125454_682_1143 149
343 3300049582 Ga0501048_0145018 Ga0501048_0145018_65_535 149
344 3300049584 Ga0501068_0194798 Ga0501068_0194798_138_596 149
345 3300049584 Ga0501068_0763072 Ga0501068_0763072_123_608 149
346 3300049585 Ga0501069_0001703 Ga0501069_0001703_1111_1569 149
347 3300049587 Ga0501071_0016062 Ga0501071_0016062_3726_4187 149
348 3300049588 Ga0501072_0245835 Ga0501072_0245835_456_926 149
349 3300049590 Ga0501074_0310737 Ga0501074_0310737_634_1095 149
350 3300049591 Ga0501075_0107023 Ga0501075_0107023_225_695 149
351 3300049592 Ga0501076_1202946 Ga0501076_1202946_21_482 149
352 3300049654 Ga0501207_109774 Ga0501207_109774_54_512 149
353 3300049675 Ga0501243_114332 Ga0501243_114332_52_510 149
354 3300049741 Ga0501079_0268388 Ga0501079_0268388_196_666 149
355 3300049743 Ga0501081_0253228 Ga0501081_0253228_796_1266 149
356 3300049822 Ga0501035_0160412 Ga0501035_0160412_177_644 149
357 3300049822 Ga0501035_1359458 Ga0501035_1359458_21_491 149
358 3300049824 Ga0501045_0191517 Ga0501045_0191517_838_1308 149
359 3300050491 nmdc:mga00v17_401296_c1 nmdc:mga00v17_401296_c1_373_843 149
360 3300050508 nmdc:mga09592_1982_c1 nmdc:mga09592_1982_c1_15009_15479 149
361 3300050508 nmdc:mga09592_901701_c1 nmdc:mga09592_901701_c1_38_499 149
362 3300050509 nmdc:mga0qj67_508770_c1 nmdc:mga0qj67_508770_c1_333_809 149
363 3300050510 nmdc:mga06r32_638501_c1 nmdc:mga06r32_638501_c1_240_701 149
364 3300050511 nmdc:mga08y16_71341_c1 nmdc:mga08y16_71341_c1_1542_2015 149
365 3300050512 nmdc:mga0n895_669624_c1 nmdc:mga0n895_669624_c1_106_579 149
366 3300050515 nmdc:mga0a205_179920_c1 nmdc:mga0a205_179920_c1_805_1278 149
367 3300050515 nmdc:mga0a205_696921_c1 nmdc:mga0a205_696921_c1_233_709 149
368 3300053139 Ga0500568_0049479 Ga0500568_0049479_447_917 149
369 3300053153 Ga0500616_0031899 Ga0500616_0031899_2116_2586 149
370 3300054114 Ga0501084_0207861 Ga0501084_0207861_997_1458 149
371 3300054114 Ga0501084_0393353 Ga0501084_0393353_538_1008 149
372 3300054114 Ga0501084_1071684 Ga0501084_1071684_75_554 149
373 3300059477 Ga0587084_047229 Ga0587084_047229_144_605 149
374 3300059477 Ga0587084_066410 Ga0587084_066410_148_609 149
375 3300059477 Ga0587084_067337 Ga0587084_067337_154_606 149
376 3300059478 Ga0587093_049731 Ga0587093_049731_36_515 149
377 3300059490 Ga0587066_019227 Ga0587066_019227_406_858 149
378 3300059490 Ga0587066_028794 Ga0587066_028794_371_832 149
379 3300059490 Ga0587066_071355 Ga0587066_071355_144_596 149
380 3300059492 Ga0587073_0047115 Ga0587073_0047115_226_678 149
381 3300059492 Ga0587073_0112071 Ga0587073_0112071_147_608 149
382 3300059493 Ga0587077_106201 Ga0587077_106201_147_608 149
383 3300059493 Ga0587077_136152 Ga0587077_136152_134_586 149
384 3300059503 Ga0587080_038021 Ga0587080_038021_81_533 149
385 3300059503 Ga0587080_071094 Ga0587080_071094_105_557 149
386 3300059506 Ga0587085_051254 Ga0587085_051254_157_618 149
387 3300059507 Ga0587086_037892 Ga0587086_037892_139_591 149
388 3300059508 Ga0587088_134838 Ga0587088_134838_70_522 149
389 3300059509 Ga0587089_042933 Ga0587089_042933_143_595 149
390 3300059510 Ga0587090_021634 Ga0587090_021634_146_598 149
391 3300059511 Ga0587091_074101 Ga0587091_074101_172_633 149
392 3300059512 Ga0587092_024185 Ga0587092_024185_365_817 149
393 3300059513 Ga0587094_037442 Ga0587094_037442_145_606 149
394 3300059514 Ga0587095_018925 Ga0587095_018925_109_573 149
395 3300059623 Ga0587101_044955 Ga0587101_044955_144_596 149
396 3300059626 Ga0587115_021711 Ga0587115_021711_172_633 149
397 3300059627 Ga0587117_060867 Ga0587117_060867_133_585 149
398 3300059630 Ga0587128_048869 Ga0587128_048869_168_620 149
399 3300059630 Ga0587128_071595 Ga0587128_071595_70_531 149
400 3300059639 Ga0587062_032648 Ga0587062_032648_219_671 149
401 3300059641 Ga0587068_071328 Ga0587068_071328_144_605 149
402 3300059641 Ga0587068_072872 Ga0587068_072872_75_536 149
403 3300059642 Ga0587069_062349 Ga0587069_062349_146_598 149
404 3300059644 Ga0587075_051885 Ga0587075_051885_79_540 149
405 3300059647 Ga0587079_066821 Ga0587079_066821_144_605 149
406 3300059660 Ga0587124_015215 Ga0587124_015215_223_684 149
407 3300060346 Ga0587111_0019749 Ga0587111_0019749_536_988 149
408 3300060346 Ga0587111_0023934 Ga0587111_0023934_252_704 149
409 3300060346 Ga0587111_0074973 Ga0587111_0074973_147_608 149
410 3300060353 Ga0501082_0079125 Ga0501082_0079125_802_1263 149
411 3300060353 Ga0501082_0749224 Ga0501082_0749224_100_594 149
412 3300061734 Ga0530510_0028131 Ga0530510_0028131_3531_4001 149
413 3300061734 Ga0530510_0453040 Ga0530510_0453040_46_507 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

4

131

0.97

PF08534

Redoxin

Redoxin

3

148

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9536 10 148
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9497 10 148
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9496 10 148
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9469 1 147
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9417 1 148
ID Description Score Start End Superfamily
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9856 1 147 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9746 2 148 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9661 1 147 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9569 1 145 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9258 1 145 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A538CXM6-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 1.001 20 149 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A3N5YXX7-F1-model_v4 deleted 0.9959 1 101
AF-A0A2E4LEB1-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9904 1 147 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A0S4S0M6-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9879 1 147 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2D7MGB0-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9875 1 147 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454

Feature Viewer

pLDDT pTM Quality
96.98 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map