F438035

General Info

Members Datasets Scaffolds Average Seq Length
413 272 826 106

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100470898|Ga0068871_1004708982
Length 120
Sequence MRRTGKDKTTRESALFMPWIYLLLAGILEAVWAVGLKYTNGFTRPWPSILVGAAIAGSMFLLALALKSIPVGTGYAVWVSVGILGAALSGPLLFDQPLRPIQLVFLGLLLVAIIGLKVTS

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
138 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
139 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
143 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
260 2738541307 Variovorax sp. GV008 Isolate Unclassified
261 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
262 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
263 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
264 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
265 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
266 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
267 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
268 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
269 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
270 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
271 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
272 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.85
Metatranscriptomes 0
Isolates 3.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0.24
Rhizoplane 5.08
Rhizosphere 89.83
Stem 0
Stem Tuber 0
Unclassified 3.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100470898 3300006358 Unclassified 1129
2 JGI24739J22299_10015538 3300001989 Bacteria 2766
3 JGI24738J21930_10003669 3300002075 Bacteria 3847
4 JGI24742J22300_10027344 3300002244 Bacteria 988
5 JGI24742J22300_10071037 3300002244 Bacteria 649
6 rootH2_10169277 3300003320 Bacteria 3401
7 Ga0065707_10105919 3300005295 Bacteria 2623
8 Ga0070658_10263181 3300005327 Bacteria 1465
9 Ga0070676_10012048 3300005328 Bacteria 4713
10 Ga0070676_11227168 3300005328 Bacteria 571
11 Ga0070683_100163325 3300005329 Bacteria 2113
12 Ga0070690_100015405 3300005330 Bacteria 4559
13 Ga0070690_100195274 3300005330 Bacteria 1405
14 Ga0070670_100004902 3300005331 Bacteria 11258
15 Ga0070677_10027087 3300005333 Bacteria 2155
16 Ga0070666_10000528 3300005335 Bacteria 23148
17 Ga0070680_100065542 3300005336 Bacteria 2977
18 Ga0068868_100002863 3300005338 Bacteria 11963
19 Ga0070660_100021363 3300005339 Bacteria 4773
20 Ga0070689_100095736 3300005340 Bacteria 2345
21 Ga0070689_100521942 3300005340 Bacteria 1020
22 Ga0070691_10231324 3300005341 Bacteria 984
23 Ga0070661_100057643 3300005344 Bacteria 2846
24 Ga0070668_100010594 3300005347 Bacteria 6856
25 Ga0070668_101340673 3300005347 Bacteria 651
26 Ga0070669_100459609 3300005353 Bacteria 1050
27 Ga0070675_100194771 3300005354 Bacteria 1757
28 Ga0070671_100027746 3300005355 Bacteria 4661
29 Ga0070674_100000806 3300005356 Bacteria 16138
30 Ga0070674_100361878 3300005356 Bacteria 1175
31 Ga0070673_100000321 3300005364 Bacteria 25304
32 Ga0070688_100231943 3300005365 Bacteria 1306
33 Ga0070659_100084124 3300005366 Unclassified 2544
34 Ga0070667_100012194 3300005367 Bacteria 7112
35 Ga0070703_10322957 3300005406 Bacteria 650
36 Ga0070703_10361910 3300005406 Bacteria 622
37 Ga0070711_100909791 3300005439 Bacteria 751
38 Ga0070700_100002518 3300005441 Bacteria 9342
39 Ga0070694_100528136 3300005444 Bacteria 942
40 Ga0070663_100135125 3300005455 Bacteria 1877
41 Ga0070678_100005842 3300005456 Bacteria 7158
42 Ga0070662_100042263 3300005457 Bacteria 3256
43 Ga0070662_100377125 3300005457 Bacteria 1167
44 Ga0068867_100000522 3300005459 Bacteria 25489
45 Ga0068867_100019935 3300005459 Bacteria 4780
46 Ga0068867_100810295 3300005459 Bacteria 836
47 Ga0070679_101970017 3300005530 Bacteria 533
48 Ga0070672_100000335 3300005543 Bacteria 26997
49 Ga0070672_100138912 3300005543 Bacteria 2003
50 Ga0070672_101595726 3300005543 Bacteria 585
51 Ga0070686_100184080 3300005544 Bacteria 1486
52 Ga0070695_101452595 3300005545 Bacteria 570
53 Ga0070665_100005479 3300005548 Bacteria 13080
54 Ga0070704_101330627 3300005549 Bacteria 658
55 Ga0068855_102178854 3300005563 Bacteria 557
56 Ga0070664_100046052 3300005564 Bacteria 3684
57 Ga0068854_100127273 3300005578 Bacteria 1941
58 Ga0068852_100563094 3300005616 Bacteria 1141
59 Ga0068852_102298104 3300005616 Bacteria 560
60 Ga0068866_10136365 3300005718 Bacteria 1403
61 Ga0068866_10154090 3300005718 Bacteria 1334
62 Ga0068861_100000643 3300005719 Bacteria 20757
63 Ga0068851_10277130 3300005834 Bacteria 958
64 Ga0068870_10025515 3300005840 Bacteria 2934
65 Ga0068858_100533594 3300005842 Bacteria 1135
66 Ga0068862_100009779 3300005844 Bacteria 7928
67 Ga0075362_10207955 3300006177 Bacteria 954
68 Ga0097621_100001828 3300006237 Bacteria 14580
69 Ga0097621_100448431 3300006237 Bacteria 1162
70 Ga0068871_100025778 3300006358 Bacteria 4579
71 Ga0075430_100128694 3300006846 Bacteria 2111
72 Ga0075430_100523969 3300006846 Bacteria 978
73 Ga0075431_100000810 3300006847 Bacteria 27353
74 Ga0075431_100119300 3300006847 Bacteria 2722
75 Ga0075431_101245359 3300006847 Bacteria 706
76 Ga0075429_100184527 3300006880 Bacteria 1828
77 Ga0075429_100480077 3300006880 Bacteria 1089
78 Ga0068865_100008006 3300006881 Bacteria 6525
79 Ga0068865_100029632 3300006881 Bacteria 3634
80 Ga0105251_10083305 3300009011 Bacteria 1476
81 Ga0105240_10826070 3300009093 Bacteria 1002
82 Ga0111539_10000035 3300009094 Bacteria 148657
83 Ga0111539_10021289 3300009094 Bacteria 7984
84 Ga0111539_10206460 3300009094 Bacteria 2290
85 Ga0114129_11635148 3300009147 Bacteria 788
86 Ga0105243_10005965 3300009148 Bacteria 9439
87 Ga0105241_11584008 3300009174 Bacteria 633
88 Ga0105242_10318983 3300009176 Bacteria 1425
89 Ga0105248_10369019 3300009177 Bacteria 1616
90 Ga0105248_11160244 3300009177 Bacteria 873
91 Ga0105249_10000709 3300009553 Bacteria 30226
92 Ga0105249_11208224 3300009553 Bacteria 827
93 Ga0157373_10086229 3300013100 Bacteria 2213
94 Ga0157371_10021898 3300013102 Bacteria 4690
95 Ga0157369_12386614 3300013105 Bacteria 536
96 Ga0157378_10001395 3300013297 Bacteria 21723
97 Ga0163162_10013377 3300013306 Bacteria 8015
98 Ga0163162_10211307 3300013306 Unclassified 2070
99 Ga0163162_11327096 3300013306 Bacteria 818
100 Ga0157375_10000142 3300013308 Bacteria 71529
101 Ga0157375_10000583 3300013308 Bacteria 32520
102 Ga0157375_10028973 3300013308 Bacteria 5201
103 Ga0157375_10743975 3300013308 Bacteria 1132
104 Ga0157380_10004906 3300014326 Bacteria 9322
105 Ga0182008_10708765 3300014497 Bacteria 576
106 Ga0157376_10001143 3300014969 Bacteria 17408
107 Ga0182006_1050736 3300015261 Bacteria 1598
108 Ga0163161_12039870 3300017792 Bacteria 510
109 Ga0207656_10142849 3300025321 Bacteria 1129
110 Ga0207653_10381214 3300025885 Bacteria 552
111 Ga0207682_10025250 3300025893 Bacteria 2356
112 Ga0207642_10105865 3300025899 Bacteria 1422
113 Ga0207642_10345333 3300025899 Bacteria 876
114 Ga0207688_10039112 3300025901 Bacteria 2634
115 Ga0207680_10002342 3300025903 Bacteria 8810
116 Ga0207680_10177410 3300025903 Bacteria 1439
117 Ga0207647_10774957 3300025904 Bacteria 517
118 Ga0207645_10006440 3300025907 Bacteria 8424
119 Ga0207645_10145087 3300025907 Bacteria 1547
120 Ga0207643_10022868 3300025908 Bacteria 3445
121 Ga0207705_10212749 3300025909 Unclassified 1467
122 Ga0207660_10150704 3300025917 Bacteria 1786
123 Ga0207662_11131945 3300025918 Bacteria 556
124 Ga0207657_10040457 3300025919 Bacteria 4130
125 Ga0207649_10053757 3300025920 Bacteria 2504
126 Ga0207681_10001649 3300025923 Bacteria 14372
127 Ga0207681_10030433 3300025923 Bacteria 3520
128 Ga0207650_10010540 3300025925 Bacteria 6344
129 Ga0207659_10000577 3300025926 Bacteria 22079
130 Ga0207664_10278414 3300025929 Bacteria 1467
131 Ga0207690_10342669 3300025932 Unclassified 1180
132 Ga0207706_10007324 3300025933 Bacteria 10203
133 Ga0207706_10151252 3300025933 Bacteria 2041
134 Ga0207686_10500294 3300025934 Bacteria 943
135 Ga0207670_10156921 3300025936 Bacteria 1695
136 Ga0207669_11672647 3300025937 Bacteria 543
137 Ga0207704_10000406 3300025938 Bacteria 19598
138 Ga0207704_10014460 3300025938 Bacteria 3985
139 Ga0207691_10000211 3300025940 Bacteria 56473
140 Ga0207691_10051744 3300025940 Bacteria 3754
141 Ga0207691_11736287 3300025940 Bacteria 504
142 Ga0207711_10127187 3300025941 Bacteria 2281
143 Ga0207689_10298681 3300025942 Bacteria 1335
144 Ga0207661_11571065 3300025944 Bacteria 602
145 Ga0207651_10001188 3300025960 Bacteria 11680
146 Ga0207712_10002554 3300025961 Bacteria 11690
147 Ga0207668_10084645 3300025972 Bacteria 2311
148 Ga0207658_10142568 3300025986 Bacteria 1941
149 Ga0207677_10027668 3300026023 Bacteria 3575
150 Ga0207703_11044268 3300026035 Bacteria 784
151 Ga0207708_10087897 3300026075 Bacteria 2394
152 Ga0207708_10128102 3300026075 Bacteria 1982
153 Ga0207648_10006784 3300026089 Bacteria 11352
154 Ga0207648_10051855 3300026089 Bacteria 3586
155 Ga0207675_100004841 3300026118 Bacteria 12969
156 Ga0207683_10000270 3300026121 Bacteria 46366
157 Ga0207698_10497325 3300026142 Bacteria 1186
158 Ga0207428_10012053 3300027907 Bacteria 7608
159 Ga0207428_10028414 3300027907 Bacteria 4647
160 Ga0207428_11070944 3300027907 Bacteria 564
161 Ga0268266_10056089 3300028379 Bacteria 3389
162 Ga0268265_10003602 3300028380 Bacteria 11062
163 Ga0316183_1052664 3300030742 Bacteria 8674
164 Ga0307513_10000256 3300031456 Bacteria 76296
165 Ga0307408_100063981 3300031548 Bacteria 2693
166 Ga0307408_100127670 3300031548 Bacteria 1980
167 Ga0307408_100136376 3300031548 Bacteria 1921
168 Ga0307408_101021196 3300031548 Bacteria 763
169 Ga0307408_101619254 3300031548 Bacteria 615
170 Ga0307408_101983577 3300031548 Bacteria 559
171 Ga0307508_10001866 3300031616 Bacteria 23226
172 Ga0307508_10382625 3300031616 Bacteria 998
173 Ga0307516_10062810 3300031730 Bacteria 3598
174 Ga0307405_10142649 3300031731 Bacteria 1673
175 Ga0307405_10597786 3300031731 Unclassified 900
176 Ga0307405_11881006 3300031731 Bacteria 533
177 Ga0307410_10707705 3300031852 Bacteria 850
178 Ga0307410_11021546 3300031852 Bacteria 714
179 Ga0307407_10803483 3300031903 Bacteria 716
180 Ga0307412_10000005 3300031911 Bacteria 526194
181 Ga0307412_10372992 3300031911 Unclassified 1153
182 Ga0307412_11548824 3300031911 Bacteria 604
183 Ga0307412_12101607 3300031911 Unclassified 524
184 Ga0307409_100762035 3300031995 Unclassified 972
185 Ga0307416_100054336 3300032002 Bacteria 3219
186 Ga0307416_100059824 3300032002 Bacteria 3098
187 Ga0307416_100118127 3300032002 Unclassified 2356
188 Ga0307416_100901957 3300032002 Bacteria 984
189 Ga0307416_101682521 3300032002 Bacteria 739
190 Ga0307416_102531872 3300032002 Bacteria 611
191 Ga0307411_11936519 3300032005 Bacteria 549
192 Ga0373926_0001237 3300035083 Bacteria 7689
193 Ga0373944_0057412 3300035089 Bacteria 1240
194 Ga0373962_0204066 3300035242 Bacteria 670
195 Ga0373937_1158066 3300036401 Bacteria 722
196 Ga0451797_0002198 3300041453 Bacteria 802
197 Ga0451843_0598058 3300041509 Bacteria 605
198 Ga0450894_033870 3300042131 Bacteria 719
199 Ga0466967_1180588 3300045976 Bacteria 763
200 Ga0495627_000285 3300046453 Bacteria 51019
201 Ga0495590_0008667 3300046457 Bacteria 3872
202 Ga0495591_000253 3300046458 Bacteria 51314
203 Ga0495629_0331300 3300046459 Bacteria 1040
204 Ga0495638_0298201 3300046460 Unclassified 869
205 Ga0495651_0513939 3300046462 Bacteria 765
206 Ga0495653_0005021 3300046463 Bacteria 10737
207 Ga0495580_0753500 3300046472 Bacteria 634
208 Ga0495664_0000738 3300046477 Bacteria 16711
209 Ga0495664_0050950 3300046477 Bacteria 2458
210 Ga0495584_0431269 3300046491 Bacteria 670
211 Ga0495596_0217406 3300046500 Bacteria 742
212 Ga0495607_0011544 3300046501 Bacteria 5874
213 Ga0495606_0000354 3300046507 Bacteria 78470
214 Ga0495606_0020666 3300046507 Bacteria 4845
215 Ga0495606_0078163 3300046507 Bacteria 2064
216 Ga0495606_0204886 3300046507 Bacteria 1122
217 Ga0495610_0009243 3300046512 Bacteria 6251
218 Ga0495620_0000594 3300046515 Bacteria 22665
219 Ga0495628_0290146 3300046516 Bacteria 1213
220 Ga0495630_0006654 3300046517 Bacteria 8237
221 Ga0495630_0009209 3300046517 Bacteria 7100
222 Ga0495632_0000518 3300046519 Bacteria 36310
223 Ga0495643_0044388 3300046522 Bacteria 2416
224 Ga0495644_0145422 3300046523 Bacteria 906
225 Ga0495648_0059711 3300046524 Bacteria 2273
226 Ga0495666_0520818 3300046526 Bacteria 531
227 Ga0495642_0107149 3300046528 Bacteria 1193
228 Ga0495652_0005050 3300046529 Bacteria 12490
229 Ga0495654_0007865 3300046530 Bacteria 5929
230 Ga0495665_0000030 3300046531 Bacteria 54150
231 Ga0495665_0018635 3300046531 Bacteria 3728
232 Ga0495645_0315146 3300046543 Bacteria 1017
233 Ga0495622_0000017 3300046557 Bacteria 176313
234 Ga0495656_0007482 3300046615 Bacteria 3859
235 Ga0495635_0002433 3300046663 Bacteria 12699
236 Ga0495661_0000228 3300046665 Bacteria 64689
237 Ga0495599_0245351 3300046678 Bacteria 1091
238 Ga0495623_0000660 3300046679 Bacteria 22917
239 Ga0495646_0000611 3300046680 Bacteria 19461
240 Ga0495669_0055252 3300046684 Bacteria 1788
241 Ga0495624_0000848 3300046690 Bacteria 24238
242 Ga0495624_0007293 3300046690 Bacteria 7767
243 Ga0495670_0439949 3300046691 Bacteria 706
244 Ga0495649_0006213 3300046694 Bacteria 7453
245 Ga0495649_0201877 3300046694 Bacteria 1032
246 Ga0495589_0001651 3300046794 Bacteria 12775
247 Ga0495589_0128074 3300046794 Bacteria 1220
248 Ga0495600_0018736 3300046809 Bacteria 4415
249 Ga0495660_0074634 3300046810 Bacteria 1791
250 Ga0495581_0499271 3300047315 Bacteria 707
251 Ga0495604_0004262 3300047317 Bacteria 11324
252 Ga0495674_0000146 3300047319 Bacteria 54437
253 Ga0495674_0020845 3300047319 Bacteria 6068
254 Ga0495674_0982563 3300047319 Bacteria 648
255 Ga0495674_1111756 3300047319 Bacteria 601
256 Ga0495672_0367540 3300047320 Bacteria 664
257 Ga0495676_0069445 3300047321 Bacteria 2718
258 Ga0495680_0006265 3300047322 Bacteria 11086
259 Ga0495683_0004301 3300047323 Bacteria 8116
260 Ga0495683_0165142 3300047323 Bacteria 1021
261 Ga0495687_153133 3300047443 Bacteria 785
262 Ga0495675_0046105 3300047444 Bacteria 2776
263 Ga0495677_0348737 3300047445 Bacteria 584
264 Ga0495679_002185 3300047446 Bacteria 10253
265 Ga0495673_0168416 3300047469 Bacteria 836
266 Ga0495681_0004156 3300047470 Bacteria 9945
267 Ga0495681_0007188 3300047470 Bacteria 7158
268 Ga0495681_0018773 3300047470 Bacteria 3796
269 Ga0495686_0018562 3300047472 Bacteria 4665
270 Ga0495593_0000525 3300047673 Bacteria 21741
271 Ga0495593_0165724 3300047673 Bacteria 1115
272 Ga0495602_0001755 3300048088 Bacteria 21647
273 Ga0495614_0135538 3300048089 Bacteria 1092
274 Ga0495614_0297439 3300048089 Bacteria 745
275 Ga0495626_0043164 3300048091 Bacteria 2116
276 Ga0496100_0059459 3300048903 Bacteria 2512
277 Ga0496100_0084551 3300048903 Bacteria 2151
278 Ga0496101_0089544 3300048904 Bacteria 2287
279 Ga0496101_0488014 3300048904 Bacteria 973
280 Ga0496102_0101514 3300048905 Bacteria 2673
281 Ga0496102_1927012 3300048905 Unclassified 507
282 Ga0496103_0852216 3300048906 Bacteria 573
283 Ga0496104_0305820 3300048907 Bacteria 1502
284 Ga0496105_0224527 3300048908 Bacteria 1528
285 Ga0496105_0423845 3300048908 Bacteria 1053
286 Ga0496106_0106668 3300048909 Bacteria 2178
287 Ga0496107_0240289 3300048910 Bacteria 1348
288 Ga0496108_0222456 3300048911 Bacteria 1640
289 Ga0496110_0163391 3300048913 Bacteria 2019
290 Ga0496112_0327551 3300048915 Bacteria 1476
291 Ga0496113_0305129 3300048916 Bacteria 1275
292 Ga0496114_0027879 3300048917 Bacteria 4629
293 Ga0496115_0465243 3300048918 Bacteria 1020
294 Ga0496115_0786761 3300048918 Bacteria 741
295 Ga0496120_0361923 3300048923 Bacteria 649
296 Ga0496121_0000436 3300048924 Bacteria 82397
297 Ga0496122_0281814 3300048925 Bacteria 908
298 Ga0496123_0098155 3300048926 Bacteria 1714
299 Ga0496124_0357356 3300048927 Bacteria 1031
300 Ga0496126_0002953 3300048929 Bacteria 22097
301 Ga0501031_0035591 3300049568 Bacteria 3248
302 Ga0501031_0086921 3300049568 Bacteria 2038
303 Ga0501031_0125752 3300049568 Bacteria 1675
304 Ga0501031_0441550 3300049568 Bacteria 841
305 Ga0501031_0693197 3300049568 Bacteria 654
306 Ga0501031_0973478 3300049568 Bacteria 542
307 Ga0501032_0706248 3300049569 Bacteria 639
308 Ga0501032_0709999 3300049569 Bacteria 637
309 Ga0501033_0059437 3300049570 Bacteria 2823
310 Ga0501033_0362413 3300049570 Bacteria 1014
311 Ga0501034_0467989 3300049571 Bacteria 1177
312 Ga0501036_0025603 3300049572 Bacteria 4979
313 Ga0501036_0041865 3300049572 Bacteria 3876
314 Ga0501036_0048491 3300049572 Bacteria 3596
315 Ga0501037_0019771 3300049573 Bacteria 4969
316 Ga0501037_0286709 3300049573 Bacteria 1146
317 Ga0501038_0012943 3300049574 Bacteria 7610
318 Ga0501038_0075945 3300049574 Bacteria 2839
319 Ga0501038_0115951 3300049574 Bacteria 2214
320 Ga0501039_0051144 3300049575 Bacteria 3198
321 Ga0501039_0115976 3300049575 Bacteria 2096
322 Ga0501039_0133507 3300049575 Bacteria 1948
323 Ga0501039_0210502 3300049575 Bacteria 1529
324 Ga0501039_0614944 3300049575 Bacteria 851
325 Ga0501041_0002149 3300049577 Bacteria 11121
326 Ga0501041_0025072 3300049577 Bacteria 3583
327 Ga0501041_0037372 3300049577 Bacteria 2943
328 Ga0501042_0029866 3300049578 Bacteria 3845
329 Ga0501042_0070820 3300049578 Bacteria 2494
330 Ga0501042_0869506 3300049578 Bacteria 656
331 Ga0501043_0115776 3300049579 Bacteria 2104
332 Ga0501043_0239919 3300049579 Unclassified 1398
333 Ga0501043_0368574 3300049579 Bacteria 1089
334 Ga0501046_0084693 3300049580 Bacteria 2445
335 Ga0501046_0359324 3300049580 Bacteria 1056
336 Ga0501046_0610433 3300049580 Bacteria 773
337 Ga0501048_0001956 3300049582 Bacteria 15664
338 Ga0501048_0045601 3300049582 Unclassified 3131
339 Ga0501048_0239080 3300049582 Bacteria 1289
340 Ga0501048_0260974 3300049582 Bacteria 1231
341 Ga0501068_0576690 3300049584 Bacteria 732
342 Ga0501069_0276094 3300049585 Bacteria 983
343 Ga0501070_0282956 3300049586 Bacteria 1353
344 Ga0501071_0001616 3300049587 Bacteria 13231
345 Ga0501071_0016987 3300049587 Bacteria 5010
346 Ga0501071_0697891 3300049587 Bacteria 781
347 Ga0501071_0805638 3300049587 Bacteria 724
348 Ga0501072_0005298 3300049588 Bacteria 9819
349 Ga0501072_0036482 3300049588 Bacteria 3854
350 Ga0501073_1025202 3300049589 Bacteria 568
351 Ga0501074_0034917 3300049590 Bacteria 3644
352 Ga0501074_0053869 3300049590 Bacteria 2902
353 Ga0501075_0000678 3300049591 Bacteria 21036
354 Ga0501075_0052147 3300049591 Bacteria 3076
355 Ga0501076_0000568 3300049592 Bacteria 23594
356 Ga0501076_0218172 3300049592 Bacteria 1559
357 Ga0501076_0938766 3300049592 Bacteria 713
358 Ga0501077_0005009 3300049593 Bacteria 8034
359 Ga0501077_0008754 3300049593 Bacteria 6280
360 Ga0501077_0138122 3300049593 Bacteria 1545
361 Ga0501249_083517 3300049679 Bacteria 753
362 Ga0501258_047243 3300049687 Bacteria 591
363 Ga0501079_0000363 3300049741 Bacteria 29190
364 Ga0501079_0076663 3300049741 Bacteria 2586
365 Ga0501079_0077465 3300049741 Bacteria 2572
366 Ga0501079_0130543 3300049741 Bacteria 1955
367 Ga0501080_0001162 3300049742 Bacteria 21747
368 Ga0501080_0014515 3300049742 Bacteria 7257
369 Ga0501080_0676799 3300049742 Bacteria 911
370 Ga0501081_0000739 3300049743 Bacteria 19079
371 Ga0501081_0139120 3300049743 Bacteria 1739
372 Ga0501083_0123828 3300049744 Bacteria 1695
373 Ga0501083_0133052 3300049744 Bacteria 1630
374 Ga0501035_0140843 3300049822 Unclassified 2097
375 Ga0501035_0520756 3300049822 Bacteria 977
376 Ga0501044_0662187 3300049823 Bacteria 932
377 Ga0501045_0005540 3300049824 Bacteria 8731
378 Ga0501045_0018551 3300049824 Bacteria 4950
379 Ga0501045_0045980 3300049824 Bacteria 3179
380 Ga0501045_0266779 3300049824 Bacteria 1275
381 Ga0501045_0542090 3300049824 Bacteria 863
382 nmdc:mga09592_1012375_c1 3300050508 Bacteria 694
383 nmdc:mga09592_176818_c1 3300050508 Bacteria 1846
384 nmdc:mga0qj67_10963_c1 3300050509 Bacteria 6784
385 nmdc:mga0qj67_695010_c1 3300050509 Bacteria 809
386 nmdc:mga06r32_169079_c1 3300050510 Bacteria 2169
387 nmdc:mga06r32_4697_c1 3300050510 Bacteria 12270
388 nmdc:mga08y16_103536_c1 3300050511 Bacteria 2964
389 nmdc:mga08y16_1366585_c1 3300050511 Bacteria 673
390 nmdc:mga08y16_335_c1 3300050511 Bacteria 42666
391 Ga0501084_0005936 3300054114 Bacteria 10055
392 Ga0501084_0800093 3300054114 Bacteria 794
393 Ga0501084_0879162 3300054114 Bacteria 754
394 Ga0590071_150719 3300059421 Bacteria 602
395 Ga0501082_0000476 3300060353 Bacteria 35465
396 Ga0501082_0368168 3300060353 Bacteria 1254
397 Ga0501082_0602412 3300060353 Bacteria 961
398 Ga0530510_0000124 3300061734 Bacteria 44414
399 Ga0530510_0006347 3300061734 Bacteria 8226
400 Ga0530510_0120467 3300061734 Bacteria 1926
401 2738879969 2738541307 Bacteria 8606193
402 2748017394 2747842501 Bacteria 5293829
403 2862709577 2862705112 Bacteria 6563286
404 2866612526 2866612099 Bacteria 7543886
405 2904489934 2904483920 Bacteria 7545285
406 2945937044 2945934425 Bacteria 7444609
407 2945964477 2945961074 Bacteria 7342064
408 2990045577 2990044586 Bacteria 6603797
409 2990706224 2990703756 Bacteria 7715990
410 642423053 641736151 Bacteria 7477263
411 8008485871 8008485437 Bacteria 7198341
412 8025524955 8025524527 Bacteria 7197316
413 8055273815 8055266321 Bacteria 7999742
414 Ga0068871_100470898
415 JGI24739J22299_10015538
416 JGI24738J21930_10003669
417 JGI24742J22300_10027344
418 JGI24742J22300_10071037
419 rootH2_10169277
420 Ga0065707_10105919
421 Ga0070658_10263181
422 Ga0070676_10012048
423 Ga0070676_11227168
424 Ga0070683_100163325
425 Ga0070690_100015405
426 Ga0070690_100195274
427 Ga0070670_100004902
428 Ga0070677_10027087
429 Ga0070666_10000528
430 Ga0070680_100065542
431 Ga0068868_100002863
432 Ga0070660_100021363
433 Ga0070689_100095736
434 Ga0070689_100521942
435 Ga0070691_10231324
436 Ga0070661_100057643
437 Ga0070668_100010594
438 Ga0070668_101340673
439 Ga0070669_100459609
440 Ga0070675_100194771
441 Ga0070671_100027746
442 Ga0070674_100000806
443 Ga0070674_100361878
444 Ga0070673_100000321
445 Ga0070688_100231943
446 Ga0070659_100084124
447 Ga0070667_100012194
448 Ga0070703_10322957
449 Ga0070703_10361910
450 Ga0070711_100909791
451 Ga0070700_100002518
452 Ga0070694_100528136
453 Ga0070663_100135125
454 Ga0070678_100005842
455 Ga0070662_100042263
456 Ga0070662_100377125
457 Ga0068867_100000522
458 Ga0068867_100019935
459 Ga0068867_100810295
460 Ga0070679_101970017
461 Ga0070672_100000335
462 Ga0070672_100138912
463 Ga0070672_101595726
464 Ga0070686_100184080
465 Ga0070695_101452595
466 Ga0070665_100005479
467 Ga0070704_101330627
468 Ga0068855_102178854
469 Ga0070664_100046052
470 Ga0068854_100127273
471 Ga0068852_100563094
472 Ga0068852_102298104
473 Ga0068866_10136365
474 Ga0068866_10154090
475 Ga0068861_100000643
476 Ga0068851_10277130
477 Ga0068870_10025515
478 Ga0068858_100533594
479 Ga0068862_100009779
480 Ga0075362_10207955
481 Ga0097621_100001828
482 Ga0097621_100448431
483 Ga0068871_100025778
484 Ga0075430_100128694
485 Ga0075430_100523969
486 Ga0075431_100000810
487 Ga0075431_100119300
488 Ga0075431_101245359
489 Ga0075429_100184527
490 Ga0075429_100480077
491 Ga0068865_100008006
492 Ga0068865_100029632
493 Ga0105251_10083305
494 Ga0105240_10826070
495 Ga0111539_10000035
496 Ga0111539_10021289
497 Ga0111539_10206460
498 Ga0114129_11635148
499 Ga0105243_10005965
500 Ga0105241_11584008
501 Ga0105242_10318983
502 Ga0105248_10369019
503 Ga0105248_11160244
504 Ga0105249_10000709
505 Ga0105249_11208224
506 Ga0157373_10086229
507 Ga0157371_10021898
508 Ga0157369_12386614
509 Ga0157378_10001395
510 Ga0163162_10013377
511 Ga0163162_10211307
512 Ga0163162_11327096
513 Ga0157375_10000142
514 Ga0157375_10000583
515 Ga0157375_10028973
516 Ga0157375_10743975
517 Ga0157380_10004906
518 Ga0182008_10708765
519 Ga0157376_10001143
520 Ga0182006_1050736
521 Ga0163161_12039870
522 Ga0207656_10142849
523 Ga0207653_10381214
524 Ga0207682_10025250
525 Ga0207642_10105865
526 Ga0207642_10345333
527 Ga0207688_10039112
528 Ga0207680_10002342
529 Ga0207680_10177410
530 Ga0207647_10774957
531 Ga0207645_10006440
532 Ga0207645_10145087
533 Ga0207643_10022868
534 Ga0207705_10212749
535 Ga0207660_10150704
536 Ga0207662_11131945
537 Ga0207657_10040457
538 Ga0207649_10053757
539 Ga0207681_10001649
540 Ga0207681_10030433
541 Ga0207650_10010540
542 Ga0207659_10000577
543 Ga0207664_10278414
544 Ga0207690_10342669
545 Ga0207706_10007324
546 Ga0207706_10151252
547 Ga0207686_10500294
548 Ga0207670_10156921
549 Ga0207669_11672647
550 Ga0207704_10000406
551 Ga0207704_10014460
552 Ga0207691_10000211
553 Ga0207691_10051744
554 Ga0207691_11736287
555 Ga0207711_10127187
556 Ga0207689_10298681
557 Ga0207661_11571065
558 Ga0207651_10001188
559 Ga0207712_10002554
560 Ga0207668_10084645
561 Ga0207658_10142568
562 Ga0207677_10027668
563 Ga0207703_11044268
564 Ga0207708_10087897
565 Ga0207708_10128102
566 Ga0207648_10006784
567 Ga0207648_10051855
568 Ga0207675_100004841
569 Ga0207683_10000270
570 Ga0207698_10497325
571 Ga0207428_10012053
572 Ga0207428_10028414
573 Ga0207428_11070944
574 Ga0268266_10056089
575 Ga0268265_10003602
576 Ga0316183_1052664
577 Ga0307513_10000256
578 Ga0307408_100063981
579 Ga0307408_100127670
580 Ga0307408_100136376
581 Ga0307408_101021196
582 Ga0307408_101619254
583 Ga0307408_101983577
584 Ga0307508_10001866
585 Ga0307508_10382625
586 Ga0307516_10062810
587 Ga0307405_10142649
588 Ga0307405_10597786
589 Ga0307405_11881006
590 Ga0307410_10707705
591 Ga0307410_11021546
592 Ga0307407_10803483
593 Ga0307412_10000005
594 Ga0307412_10372992
595 Ga0307412_11548824
596 Ga0307412_12101607
597 Ga0307409_100762035
598 Ga0307416_100054336
599 Ga0307416_100059824
600 Ga0307416_100118127
601 Ga0307416_100901957
602 Ga0307416_101682521
603 Ga0307416_102531872
604 Ga0307411_11936519
605 Ga0373926_0001237
606 Ga0373944_0057412
607 Ga0373962_0204066
608 Ga0373937_1158066
609 Ga0451797_0002198
610 Ga0451843_0598058
611 Ga0450894_033870
612 Ga0466967_1180588
613 Ga0495627_000285
614 Ga0495590_0008667
615 Ga0495591_000253
616 Ga0495629_0331300
617 Ga0495638_0298201
618 Ga0495651_0513939
619 Ga0495653_0005021
620 Ga0495580_0753500
621 Ga0495664_0000738
622 Ga0495664_0050950
623 Ga0495584_0431269
624 Ga0495596_0217406
625 Ga0495607_0011544
626 Ga0495606_0000354
627 Ga0495606_0020666
628 Ga0495606_0078163
629 Ga0495606_0204886
630 Ga0495610_0009243
631 Ga0495620_0000594
632 Ga0495628_0290146
633 Ga0495630_0006654
634 Ga0495630_0009209
635 Ga0495632_0000518
636 Ga0495643_0044388
637 Ga0495644_0145422
638 Ga0495648_0059711
639 Ga0495666_0520818
640 Ga0495642_0107149
641 Ga0495652_0005050
642 Ga0495654_0007865
643 Ga0495665_0000030
644 Ga0495665_0018635
645 Ga0495645_0315146
646 Ga0495622_0000017
647 Ga0495656_0007482
648 Ga0495635_0002433
649 Ga0495661_0000228
650 Ga0495599_0245351
651 Ga0495623_0000660
652 Ga0495646_0000611
653 Ga0495669_0055252
654 Ga0495624_0000848
655 Ga0495624_0007293
656 Ga0495670_0439949
657 Ga0495649_0006213
658 Ga0495649_0201877
659 Ga0495589_0001651
660 Ga0495589_0128074
661 Ga0495600_0018736
662 Ga0495660_0074634
663 Ga0495581_0499271
664 Ga0495604_0004262
665 Ga0495674_0000146
666 Ga0495674_0020845
667 Ga0495674_0982563
668 Ga0495674_1111756
669 Ga0495672_0367540
670 Ga0495676_0069445
671 Ga0495680_0006265
672 Ga0495683_0004301
673 Ga0495683_0165142
674 Ga0495687_153133
675 Ga0495675_0046105
676 Ga0495677_0348737
677 Ga0495679_002185
678 Ga0495673_0168416
679 Ga0495681_0004156
680 Ga0495681_0007188
681 Ga0495681_0018773
682 Ga0495686_0018562
683 Ga0495593_0000525
684 Ga0495593_0165724
685 Ga0495602_0001755
686 Ga0495614_0135538
687 Ga0495614_0297439
688 Ga0495626_0043164
689 Ga0496100_0059459
690 Ga0496100_0084551
691 Ga0496101_0089544
692 Ga0496101_0488014
693 Ga0496102_0101514
694 Ga0496102_1927012
695 Ga0496103_0852216
696 Ga0496104_0305820
697 Ga0496105_0224527
698 Ga0496105_0423845
699 Ga0496106_0106668
700 Ga0496107_0240289
701 Ga0496108_0222456
702 Ga0496110_0163391
703 Ga0496112_0327551
704 Ga0496113_0305129
705 Ga0496114_0027879
706 Ga0496115_0465243
707 Ga0496115_0786761
708 Ga0496120_0361923
709 Ga0496121_0000436
710 Ga0496122_0281814
711 Ga0496123_0098155
712 Ga0496124_0357356
713 Ga0496126_0002953
714 Ga0501031_0035591
715 Ga0501031_0086921
716 Ga0501031_0125752
717 Ga0501031_0441550
718 Ga0501031_0693197
719 Ga0501031_0973478
720 Ga0501032_0706248
721 Ga0501032_0709999
722 Ga0501033_0059437
723 Ga0501033_0362413
724 Ga0501034_0467989
725 Ga0501036_0025603
726 Ga0501036_0041865
727 Ga0501036_0048491
728 Ga0501037_0019771
729 Ga0501037_0286709
730 Ga0501038_0012943
731 Ga0501038_0075945
732 Ga0501038_0115951
733 Ga0501039_0051144
734 Ga0501039_0115976
735 Ga0501039_0133507
736 Ga0501039_0210502
737 Ga0501039_0614944
738 Ga0501041_0002149
739 Ga0501041_0025072
740 Ga0501041_0037372
741 Ga0501042_0029866
742 Ga0501042_0070820
743 Ga0501042_0869506
744 Ga0501043_0115776
745 Ga0501043_0239919
746 Ga0501043_0368574
747 Ga0501046_0084693
748 Ga0501046_0359324
749 Ga0501046_0610433
750 Ga0501048_0001956
751 Ga0501048_0045601
752 Ga0501048_0239080
753 Ga0501048_0260974
754 Ga0501068_0576690
755 Ga0501069_0276094
756 Ga0501070_0282956
757 Ga0501071_0001616
758 Ga0501071_0016987
759 Ga0501071_0697891
760 Ga0501071_0805638
761 Ga0501072_0005298
762 Ga0501072_0036482
763 Ga0501073_1025202
764 Ga0501074_0034917
765 Ga0501074_0053869
766 Ga0501075_0000678
767 Ga0501075_0052147
768 Ga0501076_0000568
769 Ga0501076_0218172
770 Ga0501076_0938766
771 Ga0501077_0005009
772 Ga0501077_0008754
773 Ga0501077_0138122
774 Ga0501249_083517
775 Ga0501258_047243
776 Ga0501079_0000363
777 Ga0501079_0076663
778 Ga0501079_0077465
779 Ga0501079_0130543
780 Ga0501080_0001162
781 Ga0501080_0014515
782 Ga0501080_0676799
783 Ga0501081_0000739
784 Ga0501081_0139120
785 Ga0501083_0123828
786 Ga0501083_0133052
787 Ga0501035_0140843
788 Ga0501035_0520756
789 Ga0501044_0662187
790 Ga0501045_0005540
791 Ga0501045_0018551
792 Ga0501045_0045980
793 Ga0501045_0266779
794 Ga0501045_0542090
795 nmdc:mga09592_1012375_c1
796 nmdc:mga09592_176818_c1
797 nmdc:mga0qj67_10963_c1
798 nmdc:mga0qj67_695010_c1
799 nmdc:mga06r32_169079_c1
800 nmdc:mga06r32_4697_c1
801 nmdc:mga08y16_103536_c1
802 nmdc:mga08y16_1366585_c1
803 nmdc:mga08y16_335_c1
804 Ga0501084_0005936
805 Ga0501084_0800093
806 Ga0501084_0879162
807 Ga0590071_150719
808 Ga0501082_0000476
809 Ga0501082_0368168
810 Ga0501082_0602412
811 Ga0530510_0000124
812 Ga0530510_0006347
813 Ga0530510_0120467
814 2738879969
815 2748017394
816 2862709577
817 2866612526
818 2904489934
819 2945937044
820 2945964477
821 2990045577
822 2990706224
823 642423053
824 8008485871
825 8025524955
826 8055273815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

17

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.9544 1 101
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.928 1 101
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8949 1 98
7mgx-assembly2.cif.gz_F structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.8711 1 98
7svx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and harmane 0.8657 1 98
ID Description Score Start End Superfamily
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9943 1 102 1.10.3730.20
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9753 1 102 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8967 3 102 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8898 2 98 1.10.3730.20
af_Q4DEW8_2_121_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8689 5 102 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A3A5JHG6-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9978 2 102 GO:0005886
GO:0022857
AF-A0A561VJF6-F1-model_v4 Quaternary ammonium compound-resistance protein SugE 0.9943 1 102 GO:0005886
GO:0022857
AF-A0A4R7PG08-F1-model_v4 deleted 0.9942 1 102
AF-A0A1Z7YW16-F1-model_v4 Guanidinium exporter 0.9917 1 102 GO:0005886
GO:0022857
AF-I6Z3E1-F1-model_v4 Cation membrane transporter 0.9917 1 103 GO:0005886
GO:0022857

Map