F438029

General Info

Members Datasets Scaffolds Average Seq Length
413 208 826 212

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10093789|Ga0075365_100937892
Length 214
Sequence VEFTGFPVAALDFYDDLEVDNTKSYWEKNKPVYDECVKAPMVALIDALSAEFAADGQSAKIFRPYRDVRFAKDKTPYKTHQGAFVRVADATGWYVEVSPRGVRTGGGFYHAEAPRLAALRRAIDHDRTGPELEKLLRKLERAGFSIDGDVLKTTPRGYDKDHPRIGLLRHKSIFAGRQLGFEPVIHTPELLDQVRKDWRATRPLVEWSAEHGGH

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
108 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
111 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
185 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 2643221561 Nocardioides sp. Root151 Isolate Unclassified
190 2643221576 Nocardioides sp. Root614 Isolate Unclassified
191 2643221590 Nocardioides sp. Root682 Isolate Unclassified
192 2643221615 Nocardioides sp. Root224 Isolate Unclassified
193 2643221617 Nocardioides sp. Root79 Isolate Unclassified
194 2643221620 Nocardioides sp. Root240 Isolate Unclassified
195 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
196 2643221696 Nocardioides sp. Root140 Isolate Unclassified
197 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
198 2738541305 Nocardioides sp. CF167 Isolate Unclassified
199 2739367898 Nocardioides sp. CF479 Isolate Unclassified
200 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
201 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
202 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
203 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
204 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
205 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
206 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
207 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
208 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.16
Metatranscriptomes 0
Isolates 4.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 11.14
Nodule 0.24
Rhizoplane 10.65
Rhizosphere 72.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10093789 3300006038 Bacteria 2048
2 JGI24744J21845_10055498 3300002077 Bacteria 727
3 Ga0070658_10019367 3300005327 Bacteria 5451
4 Ga0070683_100006487 3300005329 Bacteria 9822
5 Ga0070683_100016962 3300005329 Bacteria 6427
6 Ga0070690_100098850 3300005330 Bacteria 1932
7 Ga0068869_100027649 3300005334 Bacteria 3957
8 Ga0070682_100152796 3300005337 Bacteria 1586
9 Ga0070660_100024058 3300005339 Bacteria 4518
10 Ga0070691_10028043 3300005341 Bacteria 2629
11 Ga0070692_10003823 3300005345 Bacteria 6193
12 Ga0070692_10003896 3300005345 Bacteria 6149
13 Ga0070669_100236692 3300005353 Bacteria 1449
14 Ga0070675_100044656 3300005354 Bacteria 3623
15 Ga0070674_100008530 3300005356 Bacteria 6109
16 Ga0070673_100564782 3300005364 Bacteria 1035
17 Ga0070659_100095223 3300005366 Bacteria 2391
18 Ga0070701_10010009 3300005438 Bacteria 4178
19 Ga0070700_100026080 3300005441 Bacteria 3447
20 Ga0068867_100023893 3300005459 Bacteria 4378
21 Ga0070685_10049849 3300005466 Bacteria 2417
22 Ga0070679_100673715 3300005530 Bacteria 977
23 Ga0070679_100787390 3300005530 Bacteria 894
24 Ga0070684_100083196 3300005535 Bacteria 2835
25 Ga0070684_100097590 3300005535 Bacteria 2621
26 Ga0070684_100310624 3300005535 Bacteria 1448
27 Ga0070672_100032542 3300005543 Bacteria 3937
28 Ga0070672_100207886 3300005543 Bacteria 1639
29 Ga0070693_100131353 3300005547 Bacteria 1566
30 Ga0068855_100049091 3300005563 Bacteria 4978
31 Ga0068857_100007436 3300005577 Bacteria 9428
32 Ga0068854_100023437 3300005578 Bacteria 4217
33 Ga0068856_100221612 3300005614 Bacteria 1907
34 Ga0070702_100025861 3300005615 Bacteria 3150
35 Ga0070702_100065421 3300005615 Bacteria 2130
36 Ga0068852_100011385 3300005616 Bacteria 6693
37 Ga0068864_100161489 3300005618 Bacteria 2037
38 Ga0068866_10029300 3300005718 Bacteria 2632
39 Ga0068870_10003383 3300005840 Bacteria 6755
40 Ga0068858_100135700 3300005842 Bacteria 2309
41 Ga0068860_100034161 3300005843 Bacteria 4877
42 Ga0068860_100288562 3300005843 Bacteria 1605
43 Ga0081539_10039287 3300005985 Bacteria 2795
44 Ga0075365_10002096 3300006038 Bacteria 9540
45 Ga0075365_10046365 3300006038 Bacteria 2854
46 Ga0075365_10047627 3300006038 Bacteria 2818
47 Ga0075365_10056919 3300006038 Bacteria 2600
48 Ga0075365_10132252 3300006038 Bacteria 1727
49 Ga0075365_10484044 3300006038 Bacteria 874
50 Ga0075365_10511632 3300006038 Bacteria 849
51 Ga0075368_10015759 3300006042 Bacteria 2809
52 Ga0075368_10038913 3300006042 Bacteria 1863
53 Ga0075364_10015156 3300006051 Bacteria 4774
54 Ga0075364_10030937 3300006051 Bacteria 3438
55 Ga0075364_10153405 3300006051 Bacteria 1553
56 Ga0075364_10357397 3300006051 Bacteria 996
57 Ga0075367_10014665 3300006178 Bacteria 4243
58 Ga0075367_10034951 3300006178 Bacteria 2906
59 Ga0075367_10082948 3300006178 Bacteria 1941
60 Ga0075367_10339520 3300006178 Bacteria 947
61 Ga0075369_10196932 3300006186 Bacteria 929
62 Ga0075370_10046555 3300006353 Bacteria 2454
63 Ga0075370_10145337 3300006353 Bacteria 1388
64 Ga0075370_10150285 3300006353 Bacteria 1365
65 Ga0068865_100005498 3300006881 Bacteria 7689
66 Ga0068865_100017658 3300006881 Bacteria 4592
67 Ga0105245_10014708 3300009098 Bacteria 6814
68 Ga0105245_10045396 3300009098 Bacteria 3924
69 Ga0105245_10339055 3300009098 Bacteria 1486
70 Ga0105243_10017861 3300009148 Bacteria 5366
71 Ga0105243_10228009 3300009148 Bacteria 1651
72 Ga0105242_10069272 3300009176 Bacteria 2921
73 Ga0105249_10037339 3300009553 Bacteria 4409
74 Ga0105239_10017700 3300010375 Bacteria 7884
75 Ga0105246_11087633 3300011119 Bacteria 729
76 Ga0157369_10055363 3300013105 Bacteria 4282
77 Ga0163162_10006115 3300013306 Bacteria 11651
78 Ga0157372_10001336 3300013307 Bacteria 26658
79 Ga0157372_10023967 3300013307 Bacteria 6621
80 Ga0157375_10009759 3300013308 Bacteria 8438
81 Ga0157375_10649479 3300013308 Bacteria 1211
82 Ga0163163_10008528 3300014325 Bacteria 9108
83 Ga0163163_10392677 3300014325 Bacteria 1445
84 Ga0163163_10810353 3300014325 Bacteria 1000
85 Ga0157380_10089535 3300014326 Bacteria 2535
86 Ga0157377_10102563 3300014745 Bacteria 1707
87 Ga0157377_10137983 3300014745 Bacteria 1496
88 Ga0157377_10705206 3300014745 Bacteria 733
89 Ga0157379_10028659 3300014968 Bacteria 4952
90 Ga0157379_10638871 3300014968 Bacteria 996
91 Ga0157376_10162003 3300014969 Bacteria 2029
92 Ga0157376_10614573 3300014969 Bacteria 1083
93 Ga0163161_10083734 3300017792 Bacteria 2351
94 Ga0163161_10376028 3300017792 Bacteria 1134
95 Ga0213876_10076971 3300021384 Bacteria 1762
96 Ga0207697_10046876 3300025315 Bacteria 1781
97 Ga0207642_10178605 3300025899 Bacteria 1155
98 Ga0207688_10022224 3300025901 Bacteria 3469
99 Ga0207688_10052502 3300025901 Bacteria 2284
100 Ga0207647_10143386 3300025904 Bacteria 1399
101 Ga0207643_10034084 3300025908 Bacteria 2851
102 Ga0207705_10024921 3300025909 Bacteria 4269
103 Ga0207657_10010327 3300025919 Bacteria 9322
104 Ga0207652_10573623 3300025921 Bacteria 1013
105 Ga0207694_10070765 3300025924 Bacteria 2726
106 Ga0207687_10005433 3300025927 Bacteria 8428
107 Ga0207687_10027823 3300025927 Bacteria 3795
108 Ga0207687_10325274 3300025927 Bacteria 1246
109 Ga0207709_10087452 3300025935 Bacteria 2026
110 Ga0207670_10542384 3300025936 Bacteria 949
111 Ga0207704_10029888 3300025938 Bacteria 3047
112 Ga0207704_10040596 3300025938 Bacteria 2721
113 Ga0207691_10035230 3300025940 Bacteria 4648
114 Ga0207689_10374714 3300025942 Bacteria 1185
115 Ga0207661_10007301 3300025944 Bacteria 7861
116 Ga0207661_10116046 3300025944 Bacteria 2272
117 Ga0207661_10594439 3300025944 Bacteria 1015
118 Ga0207679_10114999 3300025945 Bacteria 2131
119 Ga0207667_10030492 3300025949 Bacteria 5833
120 Ga0207651_10797067 3300025960 Bacteria 837
121 Ga0207640_10070563 3300025981 Bacteria 2350
122 Ga0207677_10336734 3300026023 Bacteria 1259
123 Ga0207703_10040595 3300026035 Bacteria 3724
124 Ga0207639_10023013 3300026041 Bacteria 4494
125 Ga0207639_10139280 3300026041 Bacteria 2019
126 Ga0207708_10004071 3300026075 Bacteria 10753
127 Ga0207702_10442110 3300026078 Bacteria 1260
128 Ga0207648_10024276 3300026089 Bacteria 5415
129 Ga0207676_10396099 3300026095 Bacteria 1289
130 Ga0207674_10005580 3300026116 Bacteria 14916
131 Ga0207675_100244115 3300026118 Bacteria 1736
132 Ga0207683_10322890 3300026121 Bacteria 1414
133 Ga0207698_10004609 3300026142 Bacteria 8421
134 Ga0209813_10037990 3300027866 Bacteria 1453
135 Ga0209813_10051491 3300027866 Bacteria 1288
136 Ga0268265_10262373 3300028380 Bacteria 1537
137 Ga0268264_10001092 3300028381 Bacteria 26779
138 Ga0268264_10387682 3300028381 Bacteria 1339
139 Ga0265327_10000001 3300031251 Bacteria 894475
140 Ga0307405_10197421 3300031731 Bacteria 1458
141 Ga0307410_10137170 3300031852 Bacteria 1805
142 Ga0307410_10155102 3300031852 Bacteria 1709
143 Ga0307410_10486056 3300031852 Bacteria 1014
144 Ga0307410_10708929 3300031852 Bacteria 849
145 Ga0307407_10150746 3300031903 Bacteria 1511
146 Ga0307412_10023903 3300031911 Bacteria 3767
147 Ga0307409_100114050 3300031995 Bacteria 2273
148 Ga0307409_100115402 3300031995 Bacteria 2261
149 Ga0307409_100123805 3300031995 Bacteria 2195
150 Ga0307409_100173368 3300031995 Bacteria 1901
151 Ga0307414_10593115 3300032004 Bacteria 993
152 Ga0307411_10404761 3300032005 Bacteria 1129
153 Ga0307415_100073958 3300032126 Bacteria 2406
154 Ga0307415_100079889 3300032126 Bacteria 2331
155 Ga0307415_100143037 3300032126 Bacteria 1830
156 Ga0395900_0025478 3300037418 Bacteria 6055
157 Ga0395900_0223825 3300037418 Bacteria 1895
158 Ga0395905_0061400 3300037471 Bacteria 3516
159 Ga0436364_0995536 3300037853 Bacteria 887
160 Ga0395901_0064174 3300038443 Bacteria 3823
161 Ga0395901_0185148 3300038443 Bacteria 2184
162 Ga0395901_0276765 3300038443 Bacteria 1745
163 Ga0395901_0830603 3300038443 Bacteria 911
164 Ga0436365_1808658 3300039437 Bacteria 2840
165 Ga0439461_0017726 3300041410 Bacteria 1387
166 Ga0451791_1585186 3300041451 Bacteria 766
167 Ga0451853_2806752 3300041512 Bacteria 2544
168 Ga0439434_0004931 3300042435 Bacteria 3901
169 Ga0439460_0104607 3300042461 Bacteria 913
170 Ga0466972_0028753 3300044658 Bacteria 2740
171 Ga0466972_0067749 3300044658 Bacteria 1705
172 Ga0466972_0136982 3300044658 Bacteria 1152
173 Ga0466965_0024609 3300044683 Bacteria 2913
174 Ga0466965_0048360 3300044683 Bacteria 2107
175 Ga0466961_0050648 3300044693 Bacteria 2652
176 Ga0466961_0235045 3300044693 Bacteria 1127
177 Ga0466961_0274098 3300044693 Bacteria 1033
178 Ga0466963_0023888 3300044694 Bacteria 3887
179 Ga0466963_0030600 3300044694 Bacteria 3476
180 Ga0466963_0189360 3300044694 Bacteria 1437
181 Ga0466963_0198267 3300044694 Bacteria 1404
182 Ga0466963_0428738 3300044694 Bacteria 932
183 Ga0466963_0611465 3300044694 Bacteria 769
184 Ga0466964_0066696 3300044706 Bacteria 1511
185 Ga0466964_0088212 3300044706 Bacteria 1345
186 Ga0466968_0061359 3300044735 Bacteria 1622
187 Ga0466968_0268370 3300044735 Bacteria 814
188 Ga0466970_0001545 3300044765 Bacteria 11078
189 Ga0466970_0004348 3300044765 Bacteria 6976
190 Ga0466970_0028110 3300044765 Bacteria 2953
191 Ga0466970_0032932 3300044765 Bacteria 2739
192 Ga0466970_0080094 3300044765 Bacteria 1764
193 Ga0466970_0155729 3300044765 Bacteria 1263
194 Ga0466970_0406603 3300044765 Bacteria 777
195 Ga0466957_0009711 3300044842 Bacteria 5495
196 Ga0466957_0015775 3300044842 Bacteria 4413
197 Ga0466957_0622269 3300044842 Bacteria 757
198 Ga0466960_0001774 3300044901 Bacteria 7918
199 Ga0466960_0008261 3300044901 Bacteria 4258
200 Ga0466960_0010477 3300044901 Bacteria 3852
201 Ga0466960_0112048 3300044901 Bacteria 1419
202 Ga0466960_0252639 3300044901 Bacteria 980
203 Ga0466958_0353258 3300045836 Bacteria 946
204 Ga0466967_0001916 3300045976 Bacteria 12574
205 Ga0466967_0094535 3300045976 Bacteria 2722
206 Ga0466967_0118566 3300045976 Bacteria 2441
207 Ga0466967_0135179 3300045976 Bacteria 2292
208 Ga0466967_0192615 3300045976 Bacteria 1927
209 Ga0466967_0245377 3300045976 Bacteria 1709
210 Ga0466967_0248362 3300045976 Bacteria 1699
211 Ga0466967_0357313 3300045976 Bacteria 1415
212 Ga0466967_0454088 3300045976 Bacteria 1253
213 Ga0466967_1530187 3300045976 Bacteria 664
214 Ga0495603_0055341 3300046455 Bacteria 2351
215 Ga0495667_0415955 3300046559 Bacteria 846
216 Ga0495657_0087869 3300046675 Bacteria 2000
217 Ga0495658_0035526 3300046683 Bacteria 2743
218 Ga0495658_0067104 3300046683 Bacteria 2074
219 Ga0495624_0226793 3300046690 Bacteria 1132
220 Ga0496100_0075684 3300048903 Bacteria 2258
221 Ga0496100_0716505 3300048903 Bacteria 781
222 Ga0496101_0189453 3300048904 Bacteria 1587
223 Ga0496101_0269934 3300048904 Bacteria 1328
224 Ga0496102_0009379 3300048905 Bacteria 8406
225 Ga0496102_0122796 3300048905 Bacteria 2426
226 Ga0496102_0186290 3300048905 Bacteria 1956
227 Ga0496102_0816230 3300048905 Bacteria 855
228 Ga0496103_0120869 3300048906 Bacteria 1668
229 Ga0496104_0006936 3300048907 Bacteria 9994
230 Ga0496104_0103104 3300048907 Bacteria 2733
231 Ga0496105_0509001 3300048908 Bacteria 944
232 Ga0496106_0104086 3300048909 Bacteria 2204
233 Ga0496106_0688631 3300048909 Bacteria 815
234 Ga0496107_0002679 3300048910 Bacteria 11668
235 Ga0496107_0087054 3300048910 Bacteria 2281
236 Ga0496108_0059300 3300048911 Bacteria 3218
237 Ga0496108_0189429 3300048911 Bacteria 1783
238 Ga0496109_0016874 3300048912 Bacteria 6389
239 Ga0496109_0020463 3300048912 Bacteria 5845
240 Ga0496109_0027077 3300048912 Bacteria 5116
241 Ga0496109_0030424 3300048912 Bacteria 4839
242 Ga0496109_0066395 3300048912 Bacteria 3303
243 Ga0496109_0251694 3300048912 Bacteria 1664
244 Ga0496109_0346525 3300048912 Bacteria 1403
245 Ga0496109_0367301 3300048912 Bacteria 1359
246 Ga0496109_0753825 3300048912 Bacteria 911
247 Ga0496110_0084067 3300048913 Bacteria 2840
248 Ga0496111_0145661 3300048914 Bacteria 1756
249 Ga0496111_0314171 3300048914 Bacteria 1161
250 Ga0496112_0694266 3300048915 Bacteria 946
251 Ga0496113_0077385 3300048916 Bacteria 2543
252 Ga0496113_0276029 3300048916 Bacteria 1344
253 Ga0496114_0034218 3300048917 Bacteria 4190
254 Ga0496114_0047079 3300048917 Bacteria 3585
255 Ga0496114_0057939 3300048917 Bacteria 3234
256 Ga0496114_0180811 3300048917 Bacteria 1842
257 Ga0496114_0264885 3300048917 Bacteria 1514
258 Ga0496114_0282407 3300048917 Bacteria 1464
259 Ga0496114_0430214 3300048917 Bacteria 1169
260 Ga0496114_0520872 3300048917 Bacteria 1051
261 Ga0496115_0015169 3300048918 Bacteria 5839
262 Ga0496115_0052119 3300048918 Bacteria 3282
263 Ga0496121_0063500 3300048924 Bacteria 3017
264 Ga0501031_0006465 3300049568 Bacteria 7640
265 Ga0501032_0000101 3300049569 Bacteria 72620
266 Ga0501032_0006799 3300049569 Bacteria 8391
267 Ga0501033_0000373 3300049570 Bacteria 42856
268 Ga0501033_0000498 3300049570 Bacteria 37039
269 Ga0501033_0229765 3300049570 Bacteria 1318
270 Ga0501034_0006023 3300049571 Bacteria 13109
271 Ga0501034_0010672 3300049571 Bacteria 9547
272 Ga0501034_0062985 3300049571 Bacteria 3723
273 Ga0501034_0090386 3300049571 Bacteria 3060
274 Ga0501036_0001450 3300049572 Bacteria 18230
275 Ga0501036_0027548 3300049572 Bacteria 4801
276 Ga0501036_0086111 3300049572 Bacteria 2656
277 Ga0501036_0164653 3300049572 Bacteria 1869
278 Ga0501036_0250953 3300049572 Bacteria 1483
279 Ga0501036_0773685 3300049572 Bacteria 791
280 Ga0501037_0000287 3300049573 Bacteria 42841
281 Ga0501037_0006438 3300049573 Bacteria 8593
282 Ga0501037_0093681 3300049573 Bacteria 2172
283 Ga0501037_0117885 3300049573 Bacteria 1910
284 Ga0501038_0000125 3300049574 Bacteria 64770
285 Ga0501038_0001110 3300049574 Bacteria 24386
286 Ga0501038_0007033 3300049574 Bacteria 10392
287 Ga0501038_0273869 3300049574 Bacteria 1330
288 Ga0501039_0000086 3300049575 Bacteria 70210
289 Ga0501039_0023887 3300049575 Bacteria 4694
290 Ga0501040_0250940 3300049576 Bacteria 1262
291 Ga0501040_0264137 3300049576 Bacteria 1228
292 Ga0501042_0012607 3300049578 Bacteria 5733
293 Ga0501042_0171948 3300049578 Bacteria 1563
294 Ga0501043_0000098 3300049579 Bacteria 79426
295 Ga0501043_0043937 3300049579 Bacteria 3512
296 Ga0501043_0105517 3300049579 Bacteria 2214
297 Ga0501043_0297481 3300049579 Bacteria 1234
298 Ga0501046_0000160 3300049580 Bacteria 70083
299 Ga0501046_0002550 3300049580 Bacteria 17037
300 Ga0501046_0008574 3300049580 Bacteria 8896
301 Ga0501046_0454366 3300049580 Bacteria 921
302 Ga0501047_0000496 3300049581 Bacteria 42628
303 Ga0501047_0007112 3300049581 Bacteria 10511
304 Ga0501047_0017434 3300049581 Bacteria 6877
305 Ga0501047_0109137 3300049581 Bacteria 2650
306 Ga0501048_0000364 3300049582 Bacteria 31338
307 Ga0501048_0000400 3300049582 Bacteria 30181
308 Ga0501048_0375308 3300049582 Bacteria 1015
309 Ga0501048_0578942 3300049582 Bacteria 806
310 Ga0501067_0001901 3300049583 Bacteria 11485
311 Ga0501067_0010681 3300049583 Bacteria 5080
312 Ga0501067_0134394 3300049583 Bacteria 1377
313 Ga0501067_0237250 3300049583 Bacteria 1015
314 Ga0501068_0013701 3300049584 Bacteria 4617
315 Ga0501068_0036121 3300049584 Bacteria 2953
316 Ga0501068_0074271 3300049584 Bacteria 2078
317 Ga0501069_0000178 3300049585 Bacteria 28624
318 Ga0501070_0000306 3300049586 Bacteria 45155
319 Ga0501070_0012947 3300049586 Bacteria 7030
320 Ga0501070_0014385 3300049586 Bacteria 6658
321 Ga0501070_0032591 3300049586 Bacteria 4361
322 Ga0501070_0042836 3300049586 Bacteria 3769
323 Ga0501070_0071446 3300049586 Bacteria 2873
324 Ga0501072_0036096 3300049588 Bacteria 3874
325 Ga0501072_0068324 3300049588 Bacteria 2805
326 Ga0501072_0261442 3300049588 Bacteria 1377
327 Ga0501072_0369856 3300049588 Bacteria 1138
328 Ga0501072_0748726 3300049588 Bacteria 767
329 Ga0501073_0004562 3300049589 Bacteria 10415
330 Ga0501073_0055351 3300049589 Bacteria 2776
331 Ga0501073_0069568 3300049589 Bacteria 2452
332 Ga0501073_0082203 3300049589 Bacteria 2240
333 Ga0501073_0139533 3300049589 Bacteria 1680
334 Ga0501074_0000058 3300049590 Bacteria 55082
335 Ga0501074_0003581 3300049590 Bacteria 11019
336 Ga0501074_0005477 3300049590 Bacteria 9132
337 Ga0501074_0005837 3300049590 Bacteria 8880
338 Ga0501074_0090048 3300049590 Bacteria 2197
339 Ga0501074_0737912 3300049590 Bacteria 695
340 Ga0501076_0113298 3300049592 Bacteria 2194
341 Ga0501077_0021504 3300049593 Bacteria 4082
342 Ga0501079_0037492 3300049741 Bacteria 3736
343 Ga0501079_0129904 3300049741 Bacteria 1960
344 Ga0501079_0165624 3300049741 Bacteria 1724
345 Ga0501080_0006532 3300049742 Bacteria 10478
346 Ga0501080_0017680 3300049742 Bacteria 6596
347 Ga0501080_0043952 3300049742 Bacteria 4159
348 Ga0501080_0061455 3300049742 Bacteria 3497
349 Ga0501081_0246234 3300049743 Bacteria 1304
350 Ga0501083_0012541 3300049744 Bacteria 5929
351 Ga0501083_0027712 3300049744 Bacteria 3907
352 Ga0501035_0001535 3300049822 Bacteria 23505
353 Ga0501035_0014030 3300049822 Bacteria 7392
354 Ga0501035_0014924 3300049822 Bacteria 7168
355 Ga0501035_0422910 3300049822 Bacteria 1106
356 Ga0501044_0001017 3300049823 Bacteria 33729
357 Ga0501044_0083717 3300049823 Bacteria 3225
358 Ga0501045_0024595 3300049824 Bacteria 4325
359 Ga0501045_0157690 3300049824 Bacteria 1689
360 Ga0501045_0248354 3300049824 Bacteria 1325
361 nmdc:mga00v17_116302_c1 3300050491 Bacteria 1700
362 nmdc:mga00v17_178318_c1 3300050491 Bacteria 1371
363 nmdc:mga00v17_258289_c1 3300050491 Bacteria 1130
364 nmdc:mga00v17_26156_c1 3300050491 Bacteria 3397
365 nmdc:mga00v17_399821_c1 3300050491 Bacteria 893
366 nmdc:mga0yw44_12518_c1 3300050492 Bacteria 4427
367 nmdc:mga0yw44_130621_c1 3300050492 Bacteria 1626
368 nmdc:mga0yw44_186095_c1 3300050492 Bacteria 1368
369 nmdc:mga0yw44_434235_c1 3300050492 Bacteria 890
370 nmdc:mga0yw44_606243_c1 3300050492 Bacteria 744
371 nmdc:mga0yw44_703926_c1 3300050492 Bacteria 686
372 nmdc:mga0yw44_77732_c1 3300050492 Bacteria 2074
373 nmdc:mga06z11_21150_c1 3300050494 Bacteria 3019
374 nmdc:mga06z11_363782_c1 3300050494 Bacteria 867
375 nmdc:mga06z11_4363_c1 3300050494 Bacteria 5563
376 nmdc:mga04h51_11558_c1 3300050495 Bacteria 2454
377 nmdc:mga04h51_64213_c1 3300050495 Bacteria 1266
378 nmdc:mga07m45_105881_c1 3300050496 Bacteria 1618
379 nmdc:mga08y16_639812_c1 3300050511 Bacteria 1069
380 nmdc:mga0sz30_83132_c1 3300050516 Bacteria 1387
381 Ga0495595_0096346 3300053084 Bacteria 1424
382 Ga0495595_0297710 3300053084 Bacteria 811
383 Ga0495619_0112530 3300053085 Bacteria 1861
384 Ga0500593_000537 3300053117 Bacteria 14908
385 Ga0500573_0077424 3300053140 Bacteria 1892
386 Ga0500573_0091122 3300053140 Bacteria 1722
387 Ga0501084_0000959 3300054114 Bacteria 22332
388 Ga0501084_0009264 3300054114 Bacteria 8145
389 Ga0501084_0237637 3300054114 Bacteria 1538
390 Ga0501084_0269275 3300054114 Bacteria 1438
391 Ga0501082_0022963 3300060353 Bacteria 5377
392 Ga0501082_0036278 3300060353 Bacteria 4247
393 Ga0466962_0336299 3300061719 Bacteria 750
394 2643826777 2643221561 Bacteria 4984412
395 2643890591 2643221576 Bacteria 5214352
396 2643959647 2643221590 Bacteria 5214697
397 2644092836 2643221615 Bacteria 5487866
398 2644100605 2643221617 Bacteria 5139111
399 2644117013 2643221620 Bacteria 5134593
400 2644322449 2643221657 Bacteria 5490246
401 2644534130 2643221696 Bacteria 5431823
402 2644538937 2643221697 Bacteria 3575694
403 2738869502 2738541305 Bacteria 4910150
404 2740165707 2739367898 Bacteria 4367674
405 2774395983 2773857762 Bacteria 5971770
406 2809197649 2808606439 Bacteria 5952208
407 2812330899 2811994874 Bacteria 5367947
408 2812347888 2811994878 Bacteria 5992952
409 2857486400 2857481737 Bacteria 4761446
410 2883825092 2883821847 Bacteria 5121194
411 2891968720 2891968417 Bacteria 5821697
412 2984595442 2984592036 Bacteria 3670284
413 8054612194 8054609563 Bacteria 5170090
414 Ga0075365_10093789
415 JGI24744J21845_10055498
416 Ga0070658_10019367
417 Ga0070683_100006487
418 Ga0070683_100016962
419 Ga0070690_100098850
420 Ga0068869_100027649
421 Ga0070682_100152796
422 Ga0070660_100024058
423 Ga0070691_10028043
424 Ga0070692_10003823
425 Ga0070692_10003896
426 Ga0070669_100236692
427 Ga0070675_100044656
428 Ga0070674_100008530
429 Ga0070673_100564782
430 Ga0070659_100095223
431 Ga0070701_10010009
432 Ga0070700_100026080
433 Ga0068867_100023893
434 Ga0070685_10049849
435 Ga0070679_100673715
436 Ga0070679_100787390
437 Ga0070684_100083196
438 Ga0070684_100097590
439 Ga0070684_100310624
440 Ga0070672_100032542
441 Ga0070672_100207886
442 Ga0070693_100131353
443 Ga0068855_100049091
444 Ga0068857_100007436
445 Ga0068854_100023437
446 Ga0068856_100221612
447 Ga0070702_100025861
448 Ga0070702_100065421
449 Ga0068852_100011385
450 Ga0068864_100161489
451 Ga0068866_10029300
452 Ga0068870_10003383
453 Ga0068858_100135700
454 Ga0068860_100034161
455 Ga0068860_100288562
456 Ga0081539_10039287
457 Ga0075365_10002096
458 Ga0075365_10046365
459 Ga0075365_10047627
460 Ga0075365_10056919
461 Ga0075365_10132252
462 Ga0075365_10484044
463 Ga0075365_10511632
464 Ga0075368_10015759
465 Ga0075368_10038913
466 Ga0075364_10015156
467 Ga0075364_10030937
468 Ga0075364_10153405
469 Ga0075364_10357397
470 Ga0075367_10014665
471 Ga0075367_10034951
472 Ga0075367_10082948
473 Ga0075367_10339520
474 Ga0075369_10196932
475 Ga0075370_10046555
476 Ga0075370_10145337
477 Ga0075370_10150285
478 Ga0068865_100005498
479 Ga0068865_100017658
480 Ga0105245_10014708
481 Ga0105245_10045396
482 Ga0105245_10339055
483 Ga0105243_10017861
484 Ga0105243_10228009
485 Ga0105242_10069272
486 Ga0105249_10037339
487 Ga0105239_10017700
488 Ga0105246_11087633
489 Ga0157369_10055363
490 Ga0163162_10006115
491 Ga0157372_10001336
492 Ga0157372_10023967
493 Ga0157375_10009759
494 Ga0157375_10649479
495 Ga0163163_10008528
496 Ga0163163_10392677
497 Ga0163163_10810353
498 Ga0157380_10089535
499 Ga0157377_10102563
500 Ga0157377_10137983
501 Ga0157377_10705206
502 Ga0157379_10028659
503 Ga0157379_10638871
504 Ga0157376_10162003
505 Ga0157376_10614573
506 Ga0163161_10083734
507 Ga0163161_10376028
508 Ga0213876_10076971
509 Ga0207697_10046876
510 Ga0207642_10178605
511 Ga0207688_10022224
512 Ga0207688_10052502
513 Ga0207647_10143386
514 Ga0207643_10034084
515 Ga0207705_10024921
516 Ga0207657_10010327
517 Ga0207652_10573623
518 Ga0207694_10070765
519 Ga0207687_10005433
520 Ga0207687_10027823
521 Ga0207687_10325274
522 Ga0207709_10087452
523 Ga0207670_10542384
524 Ga0207704_10029888
525 Ga0207704_10040596
526 Ga0207691_10035230
527 Ga0207689_10374714
528 Ga0207661_10007301
529 Ga0207661_10116046
530 Ga0207661_10594439
531 Ga0207679_10114999
532 Ga0207667_10030492
533 Ga0207651_10797067
534 Ga0207640_10070563
535 Ga0207677_10336734
536 Ga0207703_10040595
537 Ga0207639_10023013
538 Ga0207639_10139280
539 Ga0207708_10004071
540 Ga0207702_10442110
541 Ga0207648_10024276
542 Ga0207676_10396099
543 Ga0207674_10005580
544 Ga0207675_100244115
545 Ga0207683_10322890
546 Ga0207698_10004609
547 Ga0209813_10037990
548 Ga0209813_10051491
549 Ga0268265_10262373
550 Ga0268264_10001092
551 Ga0268264_10387682
552 Ga0265327_10000001
553 Ga0307405_10197421
554 Ga0307410_10137170
555 Ga0307410_10155102
556 Ga0307410_10486056
557 Ga0307410_10708929
558 Ga0307407_10150746
559 Ga0307412_10023903
560 Ga0307409_100114050
561 Ga0307409_100115402
562 Ga0307409_100123805
563 Ga0307409_100173368
564 Ga0307414_10593115
565 Ga0307411_10404761
566 Ga0307415_100073958
567 Ga0307415_100079889
568 Ga0307415_100143037
569 Ga0395900_0025478
570 Ga0395900_0223825
571 Ga0395905_0061400
572 Ga0436364_0995536
573 Ga0395901_0064174
574 Ga0395901_0185148
575 Ga0395901_0276765
576 Ga0395901_0830603
577 Ga0436365_1808658
578 Ga0439461_0017726
579 Ga0451791_1585186
580 Ga0451853_2806752
581 Ga0439434_0004931
582 Ga0439460_0104607
583 Ga0466972_0028753
584 Ga0466972_0067749
585 Ga0466972_0136982
586 Ga0466965_0024609
587 Ga0466965_0048360
588 Ga0466961_0050648
589 Ga0466961_0235045
590 Ga0466961_0274098
591 Ga0466963_0023888
592 Ga0466963_0030600
593 Ga0466963_0189360
594 Ga0466963_0198267
595 Ga0466963_0428738
596 Ga0466963_0611465
597 Ga0466964_0066696
598 Ga0466964_0088212
599 Ga0466968_0061359
600 Ga0466968_0268370
601 Ga0466970_0001545
602 Ga0466970_0004348
603 Ga0466970_0028110
604 Ga0466970_0032932
605 Ga0466970_0080094
606 Ga0466970_0155729
607 Ga0466970_0406603
608 Ga0466957_0009711
609 Ga0466957_0015775
610 Ga0466957_0622269
611 Ga0466960_0001774
612 Ga0466960_0008261
613 Ga0466960_0010477
614 Ga0466960_0112048
615 Ga0466960_0252639
616 Ga0466958_0353258
617 Ga0466967_0001916
618 Ga0466967_0094535
619 Ga0466967_0118566
620 Ga0466967_0135179
621 Ga0466967_0192615
622 Ga0466967_0245377
623 Ga0466967_0248362
624 Ga0466967_0357313
625 Ga0466967_0454088
626 Ga0466967_1530187
627 Ga0495603_0055341
628 Ga0495667_0415955
629 Ga0495657_0087869
630 Ga0495658_0035526
631 Ga0495658_0067104
632 Ga0495624_0226793
633 Ga0496100_0075684
634 Ga0496100_0716505
635 Ga0496101_0189453
636 Ga0496101_0269934
637 Ga0496102_0009379
638 Ga0496102_0122796
639 Ga0496102_0186290
640 Ga0496102_0816230
641 Ga0496103_0120869
642 Ga0496104_0006936
643 Ga0496104_0103104
644 Ga0496105_0509001
645 Ga0496106_0104086
646 Ga0496106_0688631
647 Ga0496107_0002679
648 Ga0496107_0087054
649 Ga0496108_0059300
650 Ga0496108_0189429
651 Ga0496109_0016874
652 Ga0496109_0020463
653 Ga0496109_0027077
654 Ga0496109_0030424
655 Ga0496109_0066395
656 Ga0496109_0251694
657 Ga0496109_0346525
658 Ga0496109_0367301
659 Ga0496109_0753825
660 Ga0496110_0084067
661 Ga0496111_0145661
662 Ga0496111_0314171
663 Ga0496112_0694266
664 Ga0496113_0077385
665 Ga0496113_0276029
666 Ga0496114_0034218
667 Ga0496114_0047079
668 Ga0496114_0057939
669 Ga0496114_0180811
670 Ga0496114_0264885
671 Ga0496114_0282407
672 Ga0496114_0430214
673 Ga0496114_0520872
674 Ga0496115_0015169
675 Ga0496115_0052119
676 Ga0496121_0063500
677 Ga0501031_0006465
678 Ga0501032_0000101
679 Ga0501032_0006799
680 Ga0501033_0000373
681 Ga0501033_0000498
682 Ga0501033_0229765
683 Ga0501034_0006023
684 Ga0501034_0010672
685 Ga0501034_0062985
686 Ga0501034_0090386
687 Ga0501036_0001450
688 Ga0501036_0027548
689 Ga0501036_0086111
690 Ga0501036_0164653
691 Ga0501036_0250953
692 Ga0501036_0773685
693 Ga0501037_0000287
694 Ga0501037_0006438
695 Ga0501037_0093681
696 Ga0501037_0117885
697 Ga0501038_0000125
698 Ga0501038_0001110
699 Ga0501038_0007033
700 Ga0501038_0273869
701 Ga0501039_0000086
702 Ga0501039_0023887
703 Ga0501040_0250940
704 Ga0501040_0264137
705 Ga0501042_0012607
706 Ga0501042_0171948
707 Ga0501043_0000098
708 Ga0501043_0043937
709 Ga0501043_0105517
710 Ga0501043_0297481
711 Ga0501046_0000160
712 Ga0501046_0002550
713 Ga0501046_0008574
714 Ga0501046_0454366
715 Ga0501047_0000496
716 Ga0501047_0007112
717 Ga0501047_0017434
718 Ga0501047_0109137
719 Ga0501048_0000364
720 Ga0501048_0000400
721 Ga0501048_0375308
722 Ga0501048_0578942
723 Ga0501067_0001901
724 Ga0501067_0010681
725 Ga0501067_0134394
726 Ga0501067_0237250
727 Ga0501068_0013701
728 Ga0501068_0036121
729 Ga0501068_0074271
730 Ga0501069_0000178
731 Ga0501070_0000306
732 Ga0501070_0012947
733 Ga0501070_0014385
734 Ga0501070_0032591
735 Ga0501070_0042836
736 Ga0501070_0071446
737 Ga0501072_0036096
738 Ga0501072_0068324
739 Ga0501072_0261442
740 Ga0501072_0369856
741 Ga0501072_0748726
742 Ga0501073_0004562
743 Ga0501073_0055351
744 Ga0501073_0069568
745 Ga0501073_0082203
746 Ga0501073_0139533
747 Ga0501074_0000058
748 Ga0501074_0003581
749 Ga0501074_0005477
750 Ga0501074_0005837
751 Ga0501074_0090048
752 Ga0501074_0737912
753 Ga0501076_0113298
754 Ga0501077_0021504
755 Ga0501079_0037492
756 Ga0501079_0129904
757 Ga0501079_0165624
758 Ga0501080_0006532
759 Ga0501080_0017680
760 Ga0501080_0043952
761 Ga0501080_0061455
762 Ga0501081_0246234
763 Ga0501083_0012541
764 Ga0501083_0027712
765 Ga0501035_0001535
766 Ga0501035_0014030
767 Ga0501035_0014924
768 Ga0501035_0422910
769 Ga0501044_0001017
770 Ga0501044_0083717
771 Ga0501045_0024595
772 Ga0501045_0157690
773 Ga0501045_0248354
774 nmdc:mga00v17_116302_c1
775 nmdc:mga00v17_178318_c1
776 nmdc:mga00v17_258289_c1
777 nmdc:mga00v17_26156_c1
778 nmdc:mga00v17_399821_c1
779 nmdc:mga0yw44_12518_c1
780 nmdc:mga0yw44_130621_c1
781 nmdc:mga0yw44_186095_c1
782 nmdc:mga0yw44_434235_c1
783 nmdc:mga0yw44_606243_c1
784 nmdc:mga0yw44_703926_c1
785 nmdc:mga0yw44_77732_c1
786 nmdc:mga06z11_21150_c1
787 nmdc:mga06z11_363782_c1
788 nmdc:mga06z11_4363_c1
789 nmdc:mga04h51_11558_c1
790 nmdc:mga04h51_64213_c1
791 nmdc:mga07m45_105881_c1
792 nmdc:mga08y16_639812_c1
793 nmdc:mga0sz30_83132_c1
794 Ga0495595_0096346
795 Ga0495595_0297710
796 Ga0495619_0112530
797 Ga0500593_000537
798 Ga0500573_0077424
799 Ga0500573_0091122
800 Ga0501084_0000959
801 Ga0501084_0009264
802 Ga0501084_0237637
803 Ga0501084_0269275
804 Ga0501082_0022963
805 Ga0501082_0036278
806 Ga0466962_0336299
807 2643826777
808 2643890591
809 2643959647
810 2644092836
811 2644100605
812 2644117013
813 2644322449
814 2644534130
815 2644538937
816 2738869502
817 2740165707
818 2774395983
819 2809197649
820 2812330899
821 2812347888
822 2857486400
823 2883825092
824 2891968720
825 2984595442
826 8054612194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09365

DUF2461

Conserved hypothetical protein (DUF2461)

9

207

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a8e-assembly1.cif.gz_A three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204. 0.5949 5 209
7sze-assembly1.cif.gz_B-3 structure of the rieske non-heme iron oxygenase gxta with saxitoxin bound 0.5944 69 105
3mqz-assembly1.cif.gz_A crystal structure of conserved protein duf1054 from pink subaerial biofilm microbial leptospirillum sp. group ii uba. 0.5651 25 206
3cxj-assembly1.cif.gz_A crystal structure of an uncharacterized protein from methanothermobacter thermautotrophicus 0.5595 43 210
4g6t-assembly1.cif.gz_A structure of the hopa1-scha chaperone-effector complex 0.5537 39 209
ID Description Score Start End Superfamily
af_O16742_53_191_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.6342 77 111 3.80.10.10
af_P34098_599_856_2.70.98.30 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5;Golgi alpha-mannosidase II; domain 4 0.6342 55 105 2.70.98.30
af_Q2G2G7_1_204_3.30.930.20 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.6309 2 203 3.30.930.20
af_Q2G2G7_1_204_3.30.930.20 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.6229 2 203 3.30.930.20
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.6019 5 209 3.30.930.20
ID Description Score Start End GO Terms
AF-A0A261CXJ0-F1-model_v4 TIGR02453 family protein 0.9939 2 208
AF-W5TW62-F1-model_v4 TIGR02453 family protein 0.9923 1 210
AF-A0A6B2TTU2-F1-model_v4 deleted 0.992 2 208
AF-A0A561BUB8-F1-model_v4 Uncharacterized protein (TIGR02453 family) 0.9916 2 208
AF-A0A522B3W2-F1-model_v4 DUF2461 family protein 0.9916 4 78

Map