F437990

General Info

Members Datasets Scaffolds Average Seq Length
413 205 413 241

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100170468|Ga0070659_1001704682
Length 272
Sequence VSRDERAPGDRGTVTGGEAERRPPAGRSDGTDAERIRDDAEALALLEGGTIEVLGLLPRASNFTFLARVRVDQDQMLAVYKPRSGEAPLWDFEEGTLAAREVAAYVVADALGWPWVPPTVLREGPQGTGSVQRFVAFDPDQHYLTMRSERADEFRRIALFDLVANNADRKSGHCLLARDGRIFVVDHGVCFHVEPKLRTVIWDFVGEPIPESLLEDLRGLRPNLASGTFHDRLETLLSPAEIDAIAQRVGDLLRSGRFPEPGPGRPYPWPVV

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
123 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
124 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
127 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
139 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
140 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
141 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
142 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.73
Rhizosphere 99.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000392 3300002459 Bacteria 14600
2 JGI24751J29686_10015213 3300002459 Unclassified 1587
3 Ga0070676_10000005 3300005328 Bacteria 76787
4 Ga0070683_100086775 3300005329 Bacteria 2934
5 Ga0070690_100024840 3300005330 Bacteria 3688
6 Ga0070690_100130705 3300005330 Bacteria 1695
7 Ga0068869_100001008 3300005334 Bacteria 16373
8 Ga0070666_10200734 3300005335 Bacteria 1403
9 Ga0070680_100000094 3300005336 Bacteria 50344
10 Ga0070680_100203629 3300005336 Bacteria 1669
11 Ga0070682_100001484 3300005337 Bacteria 13159
12 Ga0070660_100002067 3300005339 Bacteria 13860
13 Ga0070691_10257067 3300005341 Bacteria 939
14 Ga0070687_100068290 3300005343 Bacteria 1900
15 Ga0070661_100004932 3300005344 Bacteria 9186
16 Ga0070661_100107466 3300005344 Bacteria 2081
17 Ga0070692_10000073 3300005345 Bacteria 20414
18 Ga0070668_100205791 3300005347 Bacteria 1617
19 Ga0070669_100059363 3300005353 Bacteria 2809
20 Ga0070675_100015061 3300005354 Bacteria 6108
21 Ga0070675_100066254 3300005354 Bacteria 2987
22 Ga0070659_100001808 3300005366 Bacteria 15387
23 Ga0070659_100170468 3300005366 Unclassified 1783
24 Ga0070703_10007823 3300005406 Bacteria 3007
25 Ga0070703_10025132 3300005406 Bacteria 1765
26 Ga0070701_10003206 3300005438 Bacteria 6441
27 Ga0070701_10144650 3300005438 Bacteria 1363
28 Ga0070705_100000197 3300005440 Bacteria 35753
29 Ga0070700_100005613 3300005441 Bacteria 6651
30 Ga0070700_100239488 3300005441 Bacteria 1296
31 Ga0070694_100001583 3300005444 Bacteria 13379
32 Ga0070694_100022039 3300005444 Bacteria 4079
33 Ga0070694_100210669 3300005444 Bacteria 1453
34 Ga0070708_100002694 3300005445 Bacteria 13762
35 Ga0070708_100030280 3300005445 Bacteria 4677
36 Ga0070708_100118073 3300005445 Bacteria 2443
37 Ga0070708_100130023 3300005445 Bacteria 2330
38 Ga0070708_100305499 3300005445 Bacteria 1498
39 Ga0070663_100045692 3300005455 Bacteria 3095
40 Ga0070663_100068325 3300005455 Bacteria 2580
41 Ga0070662_100000700 3300005457 Bacteria 20531
42 Ga0070662_100262768 3300005457 Bacteria 1391
43 Ga0070681_10005820 3300005458 Bacteria 11930
44 Ga0070706_100126350 3300005467 Bacteria 2385
45 Ga0070706_100147599 3300005467 Bacteria 2196
46 Ga0070707_100164354 3300005468 Bacteria 2163
47 Ga0070707_100168770 3300005468 Bacteria 2132
48 Ga0070698_100039940 3300005471 Bacteria 4824
49 Ga0070698_100452239 3300005471 Bacteria 1220
50 Ga0070699_100096166 3300005518 Bacteria 2594
51 Ga0070699_100458498 3300005518 Bacteria 1156
52 Ga0070679_100001113 3300005530 Bacteria 23470
53 Ga0070684_100015215 3300005535 Bacteria 6257
54 Ga0070697_100247179 3300005536 Bacteria 1525
55 Ga0070697_100271661 3300005536 Unclassified 1453
56 Ga0068853_100000121 3300005539 Bacteria 52919
57 Ga0070672_100303121 3300005543 Bacteria 1355
58 Ga0070695_100015506 3300005545 Bacteria 4602
59 Ga0070696_100001591 3300005546 Bacteria 14883
60 Ga0070696_100004942 3300005546 Bacteria 8901
61 Ga0070693_100000104 3300005547 Bacteria 37548
62 Ga0070704_100001206 3300005549 Bacteria 13566
63 Ga0070704_100004668 3300005549 Bacteria 7928
64 Ga0070704_100041727 3300005549 Bacteria 3169
65 Ga0070704_100440272 3300005549 Bacteria 1120
66 Ga0068855_100010711 3300005563 Bacteria 11065
67 Ga0070664_100015706 3300005564 Bacteria 6197
68 Ga0070664_100162905 3300005564 Bacteria 1974
69 Ga0068857_100078365 3300005577 Bacteria 2949
70 Ga0068854_100001779 3300005578 Bacteria 13117
71 Ga0068856_100015480 3300005614 Bacteria 7370
72 Ga0070702_100013154 3300005615 Bacteria 4171
73 Ga0068859_100001562 3300005617 Bacteria 23360
74 Ga0068864_100101264 3300005618 Bacteria 2555
75 Ga0068861_100107935 3300005719 Bacteria 2226
76 Ga0068861_100249384 3300005719 Bacteria 1514
77 Ga0068870_10000293 3300005840 Bacteria 18549
78 Ga0068870_10001078 3300005840 Bacteria 10846
79 Ga0068863_100006522 3300005841 Bacteria 11451
80 Ga0068863_100028590 3300005841 Bacteria 5322
81 Ga0068863_100354514 3300005841 Bacteria 1429
82 Ga0068860_100062980 3300005843 Bacteria 3524
83 Ga0068860_100177287 3300005843 Bacteria 2060
84 Ga0068860_100267722 3300005843 Unclassified 1667
85 Ga0068862_100080269 3300005844 Bacteria 2829
86 Ga0081455_10004239 3300005937 Bacteria 16170
87 Ga0081455_10015515 3300005937 Bacteria 7396
88 Ga0081455_10043030 3300005937 Bacteria 3956
89 Ga0081455_10249239 3300005937 Bacteria 1300
90 Ga0075432_10010994 3300006058 Bacteria 3075
91 Ga0068871_100235852 3300006358 Bacteria 1589
92 Ga0075428_100003766 3300006844 Bacteria 16615
93 Ga0075428_100006180 3300006844 Bacteria 13323
94 Ga0075428_100006643 3300006844 Bacteria 12864
95 Ga0075428_100034671 3300006844 Bacteria 5565
96 Ga0075428_100211726 3300006844 Unclassified 2094
97 Ga0075428_100255346 3300006844 Bacteria 1888
98 Ga0075428_100386796 3300006844 Bacteria 1500
99 Ga0075430_100001411 3300006846 Bacteria 19543
100 Ga0075430_100022624 3300006846 Bacteria 5348
101 Ga0075430_100036926 3300006846 Bacteria 4141
102 Ga0075431_100001917 3300006847 Bacteria 19765
103 Ga0075431_100002615 3300006847 Bacteria 17415
104 Ga0075431_100002647 3300006847 Bacteria 17331
105 Ga0075431_100003114 3300006847 Bacteria 16059
106 Ga0075431_100168902 3300006847 Unclassified 2248
107 Ga0075433_10000272 3300006852 Bacteria 30447
108 Ga0075433_10026083 3300006852 Bacteria 4943
109 Ga0075434_100012835 3300006871 Bacteria 7954
110 Ga0075434_100020987 3300006871 Bacteria 6345
111 Ga0075434_100089866 3300006871 Unclassified 3072
112 Ga0075429_100000517 3300006880 Bacteria 29271
113 Ga0075429_100005166 3300006880 Bacteria 11229
114 Ga0075429_100030484 3300006880 Bacteria 4686
115 Ga0075429_100076179 3300006880 Bacteria 2922
116 Ga0075429_100103970 3300006880 Bacteria 2480
117 Ga0075429_100130679 3300006880 Bacteria 2196
118 Ga0075436_100003743 3300006914 Bacteria 10423
119 Ga0075436_100058242 3300006914 Bacteria 2668
120 Ga0075436_100083233 3300006914 Bacteria 2220
121 Ga0097620_100001562 3300006931 Bacteria 23360
122 Ga0075435_100007898 3300007076 Bacteria 7613
123 Ga0075435_100010415 3300007076 Bacteria 6801
124 Ga0105251_10013398 3300009011 Bacteria 4591
125 Ga0111539_10022861 3300009094 Bacteria 7678
126 Ga0111539_10124124 3300009094 Bacteria 3026
127 Ga0111539_10396312 3300009094 Unclassified 1608
128 Ga0111539_10406282 3300009094 Bacteria 1586
129 Ga0111539_10572183 3300009094 Bacteria 1316
130 Ga0111539_10579708 3300009094 Bacteria 1306
131 Ga0111539_10752801 3300009094 Bacteria 1134
132 Ga0114129_10000414 3300009147 Bacteria 50458
133 Ga0114129_10007740 3300009147 Bacteria 15288
134 Ga0114129_10032883 3300009147 Bacteria 7328
135 Ga0114129_10052568 3300009147 Bacteria 5718
136 Ga0114129_10067362 3300009147 Bacteria 4993
137 Ga0114129_10069657 3300009147 Bacteria 4903
138 Ga0114129_10555625 3300009147 Bacteria 1492
139 Ga0114129_11257520 3300009147 Unclassified 919
140 Ga0105243_10006576 3300009148 Bacteria 8980
141 Ga0105243_10304851 3300009148 Bacteria 1445
142 Ga0105241_10001075 3300009174 Bacteria 20834
143 Ga0105242_10232621 3300009176 Bacteria 1652
144 Ga0105248_10029189 3300009177 Bacteria 6151
145 Ga0105249_10007025 3300009553 Bacteria 9823
146 Ga0105249_11024607 3300009553 Bacteria 895
147 Ga0105249_11338565 3300009553 Bacteria 788
148 Ga0157373_10000101 3300013100 Bacteria 68799
149 Ga0157370_10188619 3300013104 Bacteria 1914
150 Ga0157378_10291650 3300013297 Bacteria 1576
151 Ga0157372_10000703 3300013307 Bacteria 36772
152 Ga0157375_10741730 3300013308 Unclassified 1134
153 Ga0163163_10094007 3300014325 Bacteria 3015
154 Ga0157380_10443546 3300014326 Bacteria 1244
155 Ga0182008_10089899 3300014497 Bacteria 1513
156 Ga0157377_10010763 3300014745 Bacteria 4539
157 Ga0157376_10240901 3300014969 Unclassified 1685
158 Ga0207653_10000903 3300025885 Bacteria 9860
159 Ga0207653_10018236 3300025885 Bacteria 2211
160 Ga0207688_10005878 3300025901 Bacteria 6679
161 Ga0207643_10000968 3300025908 Bacteria 17249
162 Ga0207643_10097350 3300025908 Bacteria 1722
163 Ga0207684_10189286 3300025910 Bacteria 1775
164 Ga0207654_10003371 3300025911 Bacteria 8090
165 Ga0207707_10000076 3300025912 Bacteria 100491
166 Ga0207662_10166106 3300025918 Bacteria 1413
167 Ga0207657_10000005 3300025919 Bacteria 213481
168 Ga0207649_10022050 3300025920 Bacteria 3676
169 Ga0207649_10029709 3300025920 Bacteria 3230
170 Ga0207652_10000060 3300025921 Bacteria 113511
171 Ga0207646_10044785 3300025922 Bacteria 3971
172 Ga0207646_10241194 3300025922 Bacteria 1633
173 Ga0207650_10001895 3300025925 Bacteria 14768
174 Ga0207659_10100772 3300025926 Bacteria 2177
175 Ga0207659_10199297 3300025926 Unclassified 1598
176 Ga0207690_10005357 3300025932 Bacteria 7560
177 Ga0207706_10000447 3300025933 Bacteria 43982
178 Ga0207686_10177477 3300025934 Bacteria 1508
179 Ga0207709_10014729 3300025935 Bacteria 4322
180 Ga0207670_10006643 3300025936 Bacteria 6432
181 Ga0207670_10361641 3300025936 Bacteria 1152
182 Ga0207704_10434853 3300025938 Bacteria 1044
183 Ga0207691_10044544 3300025940 Bacteria 4083
184 Ga0207689_10000050 3300025942 Bacteria 88556
185 Ga0207661_10610824 3300025944 Bacteria 1001
186 Ga0207679_10017908 3300025945 Bacteria 4734
187 Ga0207667_10000587 3300025949 Bacteria 47372
188 Ga0207712_10044065 3300025961 Bacteria 3081
189 Ga0207712_10074166 3300025961 Bacteria 2456
190 Ga0207640_10008804 3300025981 Bacteria 5617
191 Ga0207678_10001742 3300026067 Bacteria 19912
192 Ga0207708_10001806 3300026075 Bacteria 15773
193 Ga0207702_10010966 3300026078 Bacteria 7561
194 Ga0207641_10586861 3300026088 Bacteria 1090
195 Ga0207648_10002844 3300026089 Bacteria 18331
196 Ga0207676_10002288 3300026095 Bacteria 13737
197 Ga0207676_10204895 3300026095 Bacteria 1745
198 Ga0207674_10000075 3300026116 Bacteria 105297
199 Ga0207674_10003023 3300026116 Bacteria 20851
200 Ga0207675_100153458 3300026118 Bacteria 2193
201 Ga0207675_100311026 3300026118 Bacteria 1536
202 Ga0207675_100372108 3300026118 Bacteria 1404
203 Ga0207683_10111455 3300026121 Bacteria 2450
204 Ga0209974_10017244 3300027876 Bacteria 2395
205 Ga0207428_10013846 3300027907 Bacteria 7027
206 Ga0207428_10114042 3300027907 Bacteria 2077
207 Ga0207428_10173578 3300027907 Unclassified 1631
208 Ga0268265_10033826 3300028380 Bacteria 3720
209 Ga0268265_10242081 3300028380 Bacteria 1593
210 Ga0268264_10226941 3300028381 Bacteria 1722
211 Ga0316575_10026437 3300031665 Bacteria 2255
212 Ga0316579_10017078 3300031691 Bacteria 3179
213 Ga0316579_10042828 3300031691 Unclassified 2104
214 Ga0316577_10007973 3300031733 Bacteria 5657
215 Ga0316577_10014831 3300031733 Bacteria 4284
216 Ga0307416_100411660 3300032002 Bacteria 1393
217 Ga0373948_0002953 3300034817 Bacteria 2570
218 Ga0373940_0010242 3300035088 Bacteria 2200
219 Ga0373939_0021428 3300035114 Bacteria 1769
220 Ga0373961_0004731 3300035241 Bacteria 3277
221 Ga0316574_0005318 3300035398 Bacteria 6857
222 Ga0316584_0010597 3300036712 Bacteria 6451
223 Ga0316584_0287516 3300036712 Bacteria 1193
224 Ga0395899_0028463 3300037312 Bacteria 4207
225 Ga0395899_0129364 3300037312 Bacteria 1804
226 Ga0395899_0152642 3300037312 Unclassified 1636
227 Ga0395900_0002369 3300037418 Bacteria 20830
228 Ga0395900_0028273 3300037418 Bacteria 5744
229 Ga0395900_0107073 3300037418 Unclassified 2872
230 Ga0395898_0010849 3300037466 Bacteria 9516
231 Ga0395905_0170271 3300037471 Unclassified 2046
232 Ga0316581_0002584 3300037588 Bacteria 4364
233 Ga0395901_0001376 3300038443 Bacteria 25437
234 Ga0395901_0051158 3300038443 Bacteria 4294
235 Ga0395901_0070430 3300038443 Bacteria 3643
236 Ga0439443_007972 3300042003 Unclassified 1484
237 Ga0439450_038190 3300042008 Bacteria 1106
238 Ga0439455_0093592 3300042012 Bacteria 826
239 Ga0439463_004147 3300042016 Bacteria 3639
240 Ga0439459_0002143 3300042438 Bacteria 3024
241 Ga0439464_0087675 3300042439 Bacteria 935
242 Ga0439460_0036161 3300042461 Unclassified 1431
243 Ga0451577_0004974 3300042876 Bacteria 13794
244 Ga0451576_0019550 3300045051 Bacteria 7391
245 Ga0495617_058937 3300046452 Bacteria 1272
246 Ga0495603_0010317 3300046455 Bacteria 5654
247 Ga0495641_0028845 3300046461 Bacteria 2681
248 Ga0495641_0127830 3300046461 Bacteria 1134
249 Ga0495580_0009035 3300046472 Bacteria 7864
250 Ga0495588_0024543 3300046674 Bacteria 2996
251 Ga0495589_0098400 3300046794 Bacteria 1417
252 Ga0495581_0112105 3300047315 Bacteria 1586
253 Ga0495636_0017662 3300047318 Bacteria 2857
254 Ga0495676_0219618 3300047321 Bacteria 1311
255 Ga0495683_0100547 3300047323 Bacteria 1391
256 Ga0495677_0023344 3300047445 Bacteria 2246
257 Ga0496103_0141533 3300048906 Bacteria 1538
258 Ga0496106_0251173 3300048909 Bacteria 1414
259 Ga0496109_0634603 3300048912 Bacteria 1005
260 Ga0501031_0056650 3300049568 Bacteria 2554
261 Ga0501031_0066876 3300049568 Bacteria 2341
262 Ga0501032_0001812 3300049569 Bacteria 16872
263 Ga0501033_0010503 3300049570 Bacteria 7101
264 Ga0501033_0049928 3300049570 Bacteria 3105
265 Ga0501033_0053296 3300049570 Bacteria 2996
266 Ga0501033_0276884 3300049570 Bacteria 1185
267 Ga0501034_0011674 3300049571 Bacteria 9089
268 Ga0501036_0038982 3300049572 Bacteria 4023
269 Ga0501036_0150631 3300049572 Bacteria 1962
270 Ga0501037_0002915 3300049573 Bacteria 12408
271 Ga0501037_0400969 3300049573 Bacteria 941
272 Ga0501038_0020236 3300049574 Bacteria 5986
273 Ga0501038_0097027 3300049574 Bacteria 2459
274 Ga0501038_0259389 3300049574 Bacteria 1374
275 Ga0501038_0259774 3300049574 Bacteria 1373
276 Ga0501039_0032637 3300049575 Bacteria 4015
277 Ga0501039_0102686 3300049575 Bacteria 2231
278 Ga0501039_0120819 3300049575 Bacteria 2053
279 Ga0501039_0279845 3300049575 Bacteria 1311
280 Ga0501040_0000791 3300049576 Bacteria 19704
281 Ga0501040_0017372 3300049576 Bacteria 4774
282 Ga0501040_0022860 3300049576 Bacteria 4188
283 Ga0501040_0083894 3300049576 Bacteria 2210
284 Ga0501040_0123669 3300049576 Bacteria 1816
285 Ga0501041_0009369 3300049577 Bacteria 5770
286 Ga0501041_0010765 3300049577 Bacteria 5396
287 Ga0501041_0052205 3300049577 Bacteria 2492
288 Ga0501042_0001076 3300049578 Bacteria 15654
289 Ga0501042_0022940 3300049578 Bacteria 4361
290 Ga0501042_0058357 3300049578 Bacteria 2754
291 Ga0501042_0058756 3300049578 Bacteria 2745
292 Ga0501043_0002456 3300049579 Bacteria 15673
293 Ga0501043_0063919 3300049579 Bacteria 2890
294 Ga0501046_0015948 3300049580 Bacteria 6301
295 Ga0501046_0018886 3300049580 Bacteria 5725
296 Ga0501046_0022762 3300049580 Bacteria 5159
297 Ga0501046_0226891 3300049580 Bacteria 1381
298 Ga0501047_0039706 3300049581 Bacteria 4552
299 Ga0501048_0035741 3300049582 Bacteria 3574
300 Ga0501048_0076923 3300049582 Bacteria 2355
301 Ga0501067_0084588 3300049583 Bacteria 1760
302 Ga0501067_0164816 3300049583 Bacteria 1234
303 Ga0501068_0003671 3300049584 Bacteria 8307
304 Ga0501068_0012653 3300049584 Bacteria 4789
305 Ga0501068_0519656 3300049584 Bacteria 773
306 Ga0501069_0003575 3300049585 Bacteria 8009
307 Ga0501070_0008161 3300049586 Bacteria 8856
308 Ga0501071_0027161 3300049587 Bacteria 4024
309 Ga0501071_0037817 3300049587 Bacteria 3448
310 Ga0501071_0042153 3300049587 Bacteria 3269
311 Ga0501071_0180672 3300049587 Bacteria 1581
312 Ga0501071_0278780 3300049587 Bacteria 1265
313 Ga0501071_0439281 3300049587 Bacteria 998
314 Ga0501072_0003764 3300049588 Bacteria 11454
315 Ga0501072_0063358 3300049588 Bacteria 2916
316 Ga0501072_0114476 3300049588 Bacteria 2147
317 Ga0501072_0245693 3300049588 Bacteria 1426
318 Ga0501072_0303465 3300049588 Bacteria 1269
319 Ga0501073_0001540 3300049589 Bacteria 17085
320 Ga0501073_0158956 3300049589 Bacteria 1566
321 Ga0501074_0003186 3300049590 Bacteria 11570
322 Ga0501074_0042494 3300049590 Bacteria 3289
323 Ga0501074_0066631 3300049590 Bacteria 2590
324 Ga0501075_0013147 3300049591 Bacteria 5901
325 Ga0501075_0013721 3300049591 Bacteria 5789
326 Ga0501075_0024385 3300049591 Bacteria 4435
327 Ga0501075_0040487 3300049591 Bacteria 3489
328 Ga0501075_0095478 3300049591 Bacteria 2256
329 Ga0501075_0204387 3300049591 Bacteria 1506
330 Ga0501076_0000533 3300049592 Bacteria 24272
331 Ga0501076_0005005 3300049592 Bacteria 9484
332 Ga0501076_0024067 3300049592 Bacteria 4703
333 Ga0501076_0044821 3300049592 Bacteria 3489
334 Ga0501076_0052892 3300049592 Unclassified 3218
335 Ga0501076_0130895 3300049592 Bacteria 2034
336 Ga0501077_0012013 3300049593 Bacteria 5419
337 Ga0501077_0014366 3300049593 Bacteria 4975
338 Ga0501077_0019710 3300049593 Bacteria 4267
339 Ga0501079_0014666 3300049741 Bacteria 5975
340 Ga0501079_0045161 3300049741 Bacteria 3400
341 Ga0501079_0051116 3300049741 Bacteria 3190
342 Ga0501079_0083742 3300049741 Bacteria 2467
343 Ga0501080_0006534 3300049742 Bacteria 10476
344 Ga0501080_0130130 3300049742 Bacteria 2330
345 Ga0501080_0281953 3300049742 Bacteria 1510
346 Ga0501080_0309297 3300049742 Bacteria 1432
347 Ga0501081_0001629 3300049743 Bacteria 13882
348 Ga0501081_0011786 3300049743 Bacteria 5725
349 Ga0501081_0036874 3300049743 Bacteria 3335
350 Ga0501081_0392414 3300049743 Unclassified 1027
351 Ga0501081_0581262 3300049743 Bacteria 838
352 Ga0501083_0001320 3300049744 Bacteria 16807
353 Ga0501083_0003406 3300049744 Bacteria 11127
354 Ga0501035_0000996 3300049822 Bacteria 29956
355 Ga0501035_0430145 3300049822 Bacteria 1095
356 Ga0501044_0004525 3300049823 Bacteria 15546
357 Ga0501045_0002568 3300049824 Bacteria 12384
358 Ga0501045_0021536 3300049824 Bacteria 4612
359 Ga0501045_0033381 3300049824 Bacteria 3731
360 Ga0501045_0055805 3300049824 Bacteria 2889
361 Ga0501045_0208527 3300049824 Bacteria 1455
362 Ga0501045_0415094 3300049824 Bacteria 1001
363 nmdc:mga05p37_1302382_c1 3300050507 Bacteria 741
364 nmdc:mga05p37_155795_c1 3300050507 Bacteria 2792
365 nmdc:mga05p37_2650_c1 3300050507 Bacteria 20838
366 nmdc:mga05p37_468602_c2 3300050507 Unclassified 932
367 nmdc:mga05p37_62160_c1 3300050507 Bacteria 4596
368 nmdc:mga05p37_72969_c1 3300050507 Bacteria 4224
369 nmdc:mga05p37_742977_c1 3300050507 Bacteria 1083
370 nmdc:mga05p37_7476_c1 3300050507 Bacteria 12881
371 nmdc:mga09592_150661_c1 3300050508 Bacteria 2006
372 nmdc:mga09592_214036_c1 3300050508 Bacteria 1670
373 nmdc:mga09592_2156_c1 3300050508 Bacteria 15877
374 nmdc:mga0qj67_1092_c1 3300050509 Bacteria 18796
375 nmdc:mga0qj67_113236_c1 3300050509 Bacteria 2191
376 nmdc:mga0qj67_211156_c1 3300050509 Unclassified 1577
377 nmdc:mga0qj67_79259_c1 3300050509 Bacteria 2630
378 nmdc:mga06r32_106259_c1 3300050510 Bacteria 2758
379 nmdc:mga06r32_12849_c1 3300050510 Bacteria 7570
380 nmdc:mga06r32_203417_c1 3300050510 Bacteria 1968
381 nmdc:mga06r32_21771_c1 3300050510 Bacteria 5918
382 nmdc:mga06r32_507337_c1 3300050510 Bacteria 1183
383 nmdc:mga06r32_5702_c1 3300050510 Bacteria 11213
384 nmdc:mga06r32_61051_c1 3300050510 Bacteria 3628
385 nmdc:mga06r32_845032_c1 3300050510 Bacteria 874
386 nmdc:mga06r32_8457_c1 3300050510 Bacteria 9274
387 nmdc:mga08y16_242364_c1 3300050511 Bacteria 1864
388 nmdc:mga08y16_490069_c1 3300050511 Bacteria 1250
389 nmdc:mga0n895_107232_c1 3300050512 Bacteria 2807
390 nmdc:mga0n895_1106_c1 3300050512 Bacteria 19703
391 nmdc:mga0rr50_527_c1 3300050513 Bacteria 20429
392 nmdc:mga08x19_4359_c1 3300050514 Bacteria 8389
393 nmdc:mga0a205_106191_c2 3300050515 Bacteria 1938
394 nmdc:mga0a205_10845_c1 3300050515 Bacteria 8384
395 nmdc:mga0a205_168964_c1 3300050515 Unclassified 2083
396 nmdc:mga0a205_64302_c1 3300050515 Bacteria 3543
397 nmdc:mga0a205_89947_c1 3300050515 Bacteria 2967
398 Ga0501084_0002275 3300054114 Bacteria 15423
399 Ga0501084_0047225 3300054114 Bacteria 3606
400 Ga0501084_0057936 3300054114 Bacteria 3241
401 Ga0501084_0084688 3300054114 Bacteria 2661
402 Ga0501084_0100268 3300054114 Bacteria 2431
403 Ga0501082_0004883 3300060353 Bacteria 11697
404 Ga0501082_0011577 3300060353 Bacteria 7590
405 Ga0501082_0057952 3300060353 Bacteria 3336
406 Ga0501082_0137821 3300060353 Bacteria 2117
407 Ga0530510_0000864 3300061734 Bacteria 19984
408 Ga0530510_0001540 3300061734 Bacteria 15553
409 Ga0530510_0042791 3300061734 Unclassified 3272
410 Ga0530510_0075914 3300061734 Bacteria 2441
411 Ga0530510_0088844 3300061734 Bacteria 2253
412 Ga0530510_0266585 3300061734 Bacteria 1278
413 Ga0530510_0503274 3300061734 Bacteria 918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100255346 Ga0075428_1002553462 198
2 3300006846 Ga0075430_100022624 Ga0075430_1000226245 198
3 3300006847 Ga0075431_100001917 Ga0075431_10000191715 198
4 3300005467 Ga0070706_100147599 Ga0070706_1001475992 201
5 3300005518 Ga0070699_100458498 Ga0070699_1004584982 201
6 3300050507 nmdc:mga05p37_155795_c1 nmdc:mga05p37_155795_c1_1263_1874 201
7 3300050509 nmdc:mga0qj67_79259_c1 nmdc:mga0qj67_79259_c1_898_1509 201
8 3300050510 nmdc:mga06r32_21771_c1 nmdc:mga06r32_21771_c1_5055_5666 201
9 3300006914 Ga0075436_100083233 Ga0075436_1000832333 210
10 3300005445 Ga0070708_100030280 Ga0070708_1000302803 211
11 3300005467 Ga0070706_100126350 Ga0070706_1001263503 211
12 3300005468 Ga0070707_100168770 Ga0070707_1001687703 211
13 3300025922 Ga0207646_10044785 Ga0207646_100447854 211
14 3300061734 Ga0530510_0266585 Ga0530510_0266585_249_890 211
15 3300009553 Ga0105249_11338565 Ga0105249_113385651 216
16 3300028380 Ga0268265_10242081 Ga0268265_102420813 216
17 3300049822 Ga0501035_0430145 Ga0501035_0430145_24_680 216
18 3300005536 Ga0070697_100247179 Ga0070697_1002471793 217
19 3300005937 Ga0081455_10043030 Ga0081455_100430302 217
20 3300006844 Ga0075428_100006643 Ga0075428_1000066435 217
21 3300006847 Ga0075431_100002615 Ga0075431_10000261516 217
22 3300006880 Ga0075429_100005166 Ga0075429_1000051665 217
23 3300009147 Ga0114129_10007740 Ga0114129_1000774016 217
24 3300047318 Ga0495636_0017662 Ga0495636_0017662_462_1121 217
25 3300050507 nmdc:mga05p37_7476_c1 nmdc:mga05p37_7476_c1_10279_10938 217
26 3300050510 nmdc:mga06r32_5702_c1 nmdc:mga06r32_5702_c1_3936_4595 217
27 3300013308 Ga0157375_10741730 Ga0157375_107417302 219
28 3300014969 Ga0157376_10240901 Ga0157376_102409012 219
29 3300005444 Ga0070694_100210669 Ga0070694_1002106692 226
30 3300009147 Ga0114129_10052568 Ga0114129_100525684 226
31 3300050507 nmdc:mga05p37_2650_c1 nmdc:mga05p37_2650_c1_5316_6002 226
32 3300050512 nmdc:mga0n895_1106_c1 nmdc:mga0n895_1106_c1_14295_14981 226
33 3300050513 nmdc:mga0rr50_527_c1 nmdc:mga0rr50_527_c1_3059_3745 226
34 3300050514 nmdc:mga08x19_4359_c1 nmdc:mga08x19_4359_c1_5706_6392 226
35 3300050515 nmdc:mga0a205_10845_c1 nmdc:mga0a205_10845_c1_4199_4885 226
36 3300042461 Ga0439460_0036161 Ga0439460_0036161_737_1420 227
37 3300049588 Ga0501072_0303465 Ga0501072_0303465_345_1052 227
38 3300049592 Ga0501076_0052892 Ga0501076_0052892_1222_1929 227
39 3300006844 Ga0075428_100006180 Ga0075428_10000618011 230
40 3300006846 Ga0075430_100001411 Ga0075430_10000141114 230
41 3300006847 Ga0075431_100002647 Ga0075431_1000026477 230
42 3300006880 Ga0075429_100000517 Ga0075429_10000051714 230
43 3300009094 Ga0111539_10572183 Ga0111539_105721832 230
44 3300009147 Ga0114129_10032883 Ga0114129_100328836 230
45 3300049580 Ga0501046_0022762 Ga0501046_0022762_4205_4900 230
46 3300049744 Ga0501083_0001320 Ga0501083_0001320_15861_16556 230
47 3300050507 nmdc:mga05p37_62160_c1 nmdc:mga05p37_62160_c1_141_842 230
48 3300050508 nmdc:mga09592_2156_c1 nmdc:mga09592_2156_c1_12683_13384 230
49 3300050509 nmdc:mga0qj67_1092_c1 nmdc:mga0qj67_1092_c1_12367_13068 230
50 3300050510 nmdc:mga06r32_8457_c1 nmdc:mga06r32_8457_c1_876_1577 230
51 3300006880 Ga0075429_100130679 Ga0075429_1001306793 231
52 3300009147 Ga0114129_10067362 Ga0114129_100673625 231
53 3300037418 Ga0395900_0002369 Ga0395900_0002369_609_1313 231
54 3300037466 Ga0395898_0010849 Ga0395898_0010849_4880_5584 231
55 3300038443 Ga0395901_0001376 Ga0395901_0001376_4529_5233 231
56 3300050508 nmdc:mga09592_150661_c1 nmdc:mga09592_150661_c1_616_1320 231
57 3300050515 nmdc:mga0a205_64302_c1 nmdc:mga0a205_64302_c1_2205_2909 231
58 3300049743 Ga0501081_0581262 Ga0501081_0581262_108_812 232
59 3300005336 Ga0070680_100203629 Ga0070680_1002036292 233
60 3300006844 Ga0075428_100003766 Ga0075428_10000376617 233
61 3300006847 Ga0075431_100003114 Ga0075431_1000031147 233
62 3300006847 Ga0075431_100168902 Ga0075431_1001689024 233
63 3300006880 Ga0075429_100030484 Ga0075429_1000304844 233
64 3300009094 Ga0111539_10752801 Ga0111539_107528011 233
65 3300009147 Ga0114129_10000414 Ga0114129_1000041434 233
66 3300009147 Ga0114129_11257520 Ga0114129_112575201 233
67 3300037312 Ga0395899_0152642 Ga0395899_0152642_772_1479 233
68 3300037418 Ga0395900_0107073 Ga0395900_0107073_147_854 233
69 3300037471 Ga0395905_0170271 Ga0395905_0170271_725_1432 233
70 3300038443 Ga0395901_0051158 Ga0395901_0051158_2823_3530 233
71 3300042008 Ga0439450_038190 Ga0439450_038190_293_1003 233
72 3300042016 Ga0439463_004147 Ga0439463_004147_1343_2053 233
73 3300049570 Ga0501033_0049928 Ga0501033_0049928_1386_2093 233
74 3300049570 Ga0501033_0053296 Ga0501033_0053296_2210_2920 233
75 3300049573 Ga0501037_0400969 Ga0501037_0400969_182_889 233
76 3300049574 Ga0501038_0097027 Ga0501038_0097027_1540_2250 233
77 3300049574 Ga0501038_0259389 Ga0501038_0259389_140_847 233
78 3300049575 Ga0501039_0032637 Ga0501039_0032637_2270_2980 233
79 3300049576 Ga0501040_0000791 Ga0501040_0000791_12747_13457 233
80 3300049576 Ga0501040_0083894 Ga0501040_0083894_819_1526 233
81 3300049577 Ga0501041_0009369 Ga0501041_0009369_3561_4271 233
82 3300049577 Ga0501041_0052205 Ga0501041_0052205_1144_1851 233
83 3300049578 Ga0501042_0001076 Ga0501042_0001076_11710_12420 233
84 3300049579 Ga0501043_0063919 Ga0501043_0063919_1204_1914 233
85 3300049580 Ga0501046_0015948 Ga0501046_0015948_790_1500 233
86 3300049580 Ga0501046_0018886 Ga0501046_0018886_441_1148 233
87 3300049581 Ga0501047_0039706 Ga0501047_0039706_1072_1782 233
88 3300049584 Ga0501068_0012653 Ga0501068_0012653_462_1169 233
89 3300049584 Ga0501068_0519656 Ga0501068_0519656_32_739 233
90 3300049587 Ga0501071_0180672 Ga0501071_0180672_274_981 233
91 3300049587 Ga0501071_0278780 Ga0501071_0278780_307_1014 233
92 3300049588 Ga0501072_0063358 Ga0501072_0063358_697_1407 233
93 3300049588 Ga0501072_0245693 Ga0501072_0245693_567_1274 233
94 3300049590 Ga0501074_0042494 Ga0501074_0042494_444_1154 233
95 3300049591 Ga0501075_0013147 Ga0501075_0013147_1468_2175 233
96 3300049591 Ga0501075_0024385 Ga0501075_0024385_2118_2828 233
97 3300049591 Ga0501075_0204387 Ga0501075_0204387_453_1160 233
98 3300049592 Ga0501076_0000533 Ga0501076_0000533_20055_20762 233
99 3300049592 Ga0501076_0005005 Ga0501076_0005005_3342_4052 233
100 3300049593 Ga0501077_0014366 Ga0501077_0014366_1589_2296 233
101 3300049593 Ga0501077_0019710 Ga0501077_0019710_1716_2426 233
102 3300049741 Ga0501079_0014666 Ga0501079_0014666_4004_4711 233
103 3300049741 Ga0501079_0045161 Ga0501079_0045161_2438_3148 233
104 3300049741 Ga0501079_0083742 Ga0501079_0083742_1245_1952 233
105 3300049742 Ga0501080_0309297 Ga0501080_0309297_507_1217 233
106 3300049743 Ga0501081_0011786 Ga0501081_0011786_109_816 233
107 3300049744 Ga0501083_0003406 Ga0501083_0003406_8517_9227 233
108 3300049824 Ga0501045_0002568 Ga0501045_0002568_789_1499 233
109 3300049824 Ga0501045_0021536 Ga0501045_0021536_734_1441 233
110 3300049824 Ga0501045_0415094 Ga0501045_0415094_107_814 233
111 3300050507 nmdc:mga05p37_1302382_c1 nmdc:mga05p37_1302382_c1_12_719 233
112 3300050507 nmdc:mga05p37_468602_c2 nmdc:mga05p37_468602_c2_193_900 233
113 3300050508 nmdc:mga09592_214036_c1 nmdc:mga09592_214036_c1_221_928 233
114 3300050510 nmdc:mga06r32_106259_c1 nmdc:mga06r32_106259_c1_737_1444 233
115 3300050510 nmdc:mga06r32_12849_c1 nmdc:mga06r32_12849_c1_2091_2798 233
116 3300054114 Ga0501084_0002275 Ga0501084_0002275_1396_2106 233
117 3300054114 Ga0501084_0047225 Ga0501084_0047225_1966_2673 233
118 3300060353 Ga0501082_0011577 Ga0501082_0011577_790_1500 233
119 3300060353 Ga0501082_0137821 Ga0501082_0137821_918_1625 233
120 3300061734 Ga0530510_0000864 Ga0530510_0000864_5640_6347 233
121 3300061734 Ga0530510_0001540 Ga0530510_0001540_11147_11854 233
122 3300061734 Ga0530510_0042791 Ga0530510_0042791_1818_2525 233
123 3300061734 Ga0530510_0075914 Ga0530510_0075914_925_1635 233
124 3300005328 Ga0070676_10000005 Ga0070676_1000000522 234
125 3300005330 Ga0070690_100024840 Ga0070690_1000248403 234
126 3300005334 Ga0068869_100001008 Ga0068869_10000100810 234
127 3300005335 Ga0070666_10200734 Ga0070666_102007342 234
128 3300005336 Ga0070680_100000094 Ga0070680_10000009430 234
129 3300005337 Ga0070682_100001484 Ga0070682_1000014844 234
130 3300005339 Ga0070660_100002067 Ga0070660_1000020676 234
131 3300005343 Ga0070687_100068290 Ga0070687_1000682903 234
132 3300005344 Ga0070661_100004932 Ga0070661_1000049324 234
133 3300005345 Ga0070692_10000073 Ga0070692_1000007318 234
134 3300005347 Ga0070668_100205791 Ga0070668_1002057912 234
135 3300005353 Ga0070669_100059363 Ga0070669_1000593632 234
136 3300005366 Ga0070659_100001808 Ga0070659_10000180812 234
137 3300005406 Ga0070703_10007823 Ga0070703_100078233 234
138 3300005438 Ga0070701_10003206 Ga0070701_100032065 234
139 3300005440 Ga0070705_100000197 Ga0070705_10000019711 234
140 3300005444 Ga0070694_100001583 Ga0070694_10000158311 234
141 3300005445 Ga0070708_100305499 Ga0070708_1003054992 234
142 3300005455 Ga0070663_100045692 Ga0070663_1000456924 234
143 3300005457 Ga0070662_100000700 Ga0070662_10000070018 234
144 3300005458 Ga0070681_10005820 Ga0070681_100058204 234
145 3300005530 Ga0070679_100001113 Ga0070679_1000011134 234
146 3300005539 Ga0068853_100000121 Ga0068853_1000001219 234
147 3300005543 Ga0070672_100303121 Ga0070672_1003031212 234
148 3300005545 Ga0070695_100015506 Ga0070695_1000155067 234
149 3300005546 Ga0070696_100001591 Ga0070696_1000015917 234
150 3300005547 Ga0070693_100000104 Ga0070693_10000010435 234
151 3300005549 Ga0070704_100001206 Ga0070704_10000120612 234
152 3300005549 Ga0070704_100440272 Ga0070704_1004402721 234
153 3300005563 Ga0068855_100010711 Ga0068855_1000107116 234
154 3300005564 Ga0070664_100162905 Ga0070664_1001629052 234
155 3300005578 Ga0068854_100001779 Ga0068854_10000177910 234
156 3300005614 Ga0068856_100015480 Ga0068856_1000154805 234
157 3300005615 Ga0070702_100013154 Ga0070702_1000131543 234
158 3300005617 Ga0068859_100001562 Ga0068859_10000156218 234
159 3300005719 Ga0068861_100107935 Ga0068861_1001079352 234
160 3300005719 Ga0068861_100249384 Ga0068861_1002493842 234
161 3300005840 Ga0068870_10001078 Ga0068870_100010782 234
162 3300005841 Ga0068863_100028590 Ga0068863_1000285905 234
163 3300005843 Ga0068860_100062980 Ga0068860_1000629804 234
164 3300006358 Ga0068871_100235852 Ga0068871_1002358523 234
165 3300006844 Ga0075428_100386796 Ga0075428_1003867962 234
166 3300006852 Ga0075433_10026083 Ga0075433_100260835 234
167 3300006914 Ga0075436_100058242 Ga0075436_1000582424 234
168 3300006931 Ga0097620_100001562 Ga0097620_10000156218 234
169 3300007076 Ga0075435_100010415 Ga0075435_1000104155 234
170 3300009147 Ga0114129_10555625 Ga0114129_105556254 234
171 3300009174 Ga0105241_10001075 Ga0105241_100010754 234
172 3300009177 Ga0105248_10029189 Ga0105248_100291894 234
173 3300013100 Ga0157373_10000101 Ga0157373_1000010138 234
174 3300013104 Ga0157370_10188619 Ga0157370_101886192 234
175 3300013307 Ga0157372_10000703 Ga0157372_1000070331 234
176 3300014326 Ga0157380_10443546 Ga0157380_104435462 234
177 3300014497 Ga0182008_10089899 Ga0182008_100898992 234
178 3300025885 Ga0207653_10000903 Ga0207653_100009033 234
179 3300025901 Ga0207688_10005878 Ga0207688_100058786 234
180 3300025911 Ga0207654_10003371 Ga0207654_100033716 234
181 3300025912 Ga0207707_10000076 Ga0207707_100000764 234
182 3300025918 Ga0207662_10166106 Ga0207662_101661062 234
183 3300025919 Ga0207657_10000005 Ga0207657_10000005133 234
184 3300025920 Ga0207649_10022050 Ga0207649_100220504 234
185 3300025921 Ga0207652_10000060 Ga0207652_10000060109 234
186 3300025926 Ga0207659_10100772 Ga0207659_101007724 234
187 3300025932 Ga0207690_10005357 Ga0207690_100053574 234
188 3300025933 Ga0207706_10000447 Ga0207706_1000044711 234
189 3300025936 Ga0207670_10006643 Ga0207670_100066435 234
190 3300025938 Ga0207704_10434853 Ga0207704_104348532 234
191 3300025940 Ga0207691_10044544 Ga0207691_100445442 234
192 3300025942 Ga0207689_10000050 Ga0207689_1000005046 234
193 3300025949 Ga0207667_10000587 Ga0207667_1000058746 234
194 3300025961 Ga0207712_10044065 Ga0207712_100440652 234
195 3300025981 Ga0207640_10008804 Ga0207640_100088044 234
196 3300026067 Ga0207678_10001742 Ga0207678_1000174220 234
197 3300026078 Ga0207702_10010966 Ga0207702_100109661 234
198 3300026089 Ga0207648_10002844 Ga0207648_100028444 234
199 3300026095 Ga0207676_10204895 Ga0207676_102048953 234
200 3300026116 Ga0207674_10000075 Ga0207674_1000007540 234
201 3300026118 Ga0207675_100311026 Ga0207675_1003110262 234
202 3300027876 Ga0209974_10017244 Ga0209974_100172443 234
203 3300028381 Ga0268264_10226941 Ga0268264_102269413 234
204 3300034817 Ga0373948_0002953 Ga0373948_0002953_1272_1985 234
205 3300035241 Ga0373961_0004731 Ga0373961_0004731_2537_3250 234
206 3300042012 Ga0439455_0093592 Ga0439455_0093592_55_768 234
207 3300042438 Ga0439459_0002143 Ga0439459_0002143_208_921 234
208 3300042439 Ga0439464_0087675 Ga0439464_0087675_57_770 234
209 3300042876 Ga0451577_0004974 Ga0451577_0004974_1154_1867 234
210 3300045051 Ga0451576_0019550 Ga0451576_0019550_2470_3183 234
211 3300046455 Ga0495603_0010317 Ga0495603_0010317_3642_4385 234
212 3300046461 Ga0495641_0028845 Ga0495641_0028845_53_796 234
213 3300046674 Ga0495588_0024543 Ga0495588_0024543_249_992 234
214 3300047321 Ga0495676_0219618 Ga0495676_0219618_53_796 234
215 3300048906 Ga0496103_0141533 Ga0496103_0141533_360_1073 234
216 3300048909 Ga0496106_0251173 Ga0496106_0251173_148_861 234
217 3300048912 Ga0496109_0634603 Ga0496109_0634603_207_917 234
218 3300049583 Ga0501067_0164816 Ga0501067_0164816_337_1050 234
219 3300049587 Ga0501071_0037817 Ga0501071_0037817_158_868 234
220 3300049589 Ga0501073_0158956 Ga0501073_0158956_556_1266 234
221 3300050507 nmdc:mga05p37_742977_c1 nmdc:mga05p37_742977_c1_91_804 234
222 3300050515 nmdc:mga0a205_106191_c2 nmdc:mga0a205_106191_c2_1021_1731 234
223 3300006058 Ga0075432_10010994 Ga0075432_100109941 235
224 3300006852 Ga0075433_10000272 Ga0075433_1000027213 235
225 3300006871 Ga0075434_100089866 Ga0075434_1000898663 235
226 3300006914 Ga0075436_100003743 Ga0075436_1000037436 235
227 3300007076 Ga0075435_100007898 Ga0075435_1000078986 235
228 3300026088 Ga0207641_10586861 Ga0207641_105868612 235
229 3300027907 Ga0207428_10173578 Ga0207428_101735783 235
230 3300032002 Ga0307416_100411660 Ga0307416_1004116602 235
231 3300049575 Ga0501039_0120819 Ga0501039_0120819_128_841 235
232 3300049576 Ga0501040_0123669 Ga0501040_0123669_776_1489 235
233 3300049578 Ga0501042_0058756 Ga0501042_0058756_776_1489 235
234 3300049580 Ga0501046_0226891 Ga0501046_0226891_561_1274 235
235 3300049587 Ga0501071_0042153 Ga0501071_0042153_1526_2239 235
236 3300049591 Ga0501075_0013721 Ga0501075_0013721_3213_3926 235
237 3300049592 Ga0501076_0024067 Ga0501076_0024067_594_1307 235
238 3300049742 Ga0501080_0130130 Ga0501080_0130130_348_1061 235
239 3300049824 Ga0501045_0208527 Ga0501045_0208527_334_1047 235
240 3300050510 nmdc:mga06r32_845032_c1 nmdc:mga06r32_845032_c1_103_828 235
241 3300054114 Ga0501084_0084688 Ga0501084_0084688_1712_2425 235
242 3300060353 Ga0501082_0004883 Ga0501082_0004883_6279_6992 235
243 3300005445 Ga0070708_100130023 Ga0070708_1001300232 236
244 3300049575 Ga0501039_0279845 Ga0501039_0279845_587_1300 237
245 3300037312 Ga0395899_0129364 Ga0395899_0129364_403_1119 238
246 3300037418 Ga0395900_0028273 Ga0395900_0028273_4752_5468 238
247 3300061734 Ga0530510_0088844 Ga0530510_0088844_633_1355 238
248 3300005445 Ga0070708_100002694 Ga0070708_10000269411 239
249 3300005468 Ga0070707_100164354 Ga0070707_1001643544 239
250 3300005471 Ga0070698_100452239 Ga0070698_1004522392 239
251 3300005518 Ga0070699_100096166 Ga0070699_1000961662 239
252 3300025922 Ga0207646_10241194 Ga0207646_102411942 239
253 3300031665 Ga0316575_10026437 Ga0316575_100264372 239
254 3300035398 Ga0316574_0005318 Ga0316574_0005318_4649_5380 239
255 3300031691 Ga0316579_10017078 Ga0316579_100170783 241
256 3300031733 Ga0316577_10014831 Ga0316577_100148313 241
257 3300036712 Ga0316584_0010597 Ga0316584_0010597_5694_6425 241
258 3300037588 Ga0316581_0002584 Ga0316581_0002584_2383_3114 241
259 3300006844 Ga0075428_100034671 Ga0075428_1000346716 242
260 3300006846 Ga0075430_100036926 Ga0075430_1000369265 242
261 3300006880 Ga0075429_100103970 Ga0075429_1001039703 242
262 3300050509 nmdc:mga0qj67_113236_c1 nmdc:mga0qj67_113236_c1_1042_1770 242
263 3300050510 nmdc:mga06r32_203417_c1 nmdc:mga06r32_203417_c1_1017_1745 242
264 3300005536 Ga0070697_100271661 Ga0070697_1002716611 243
265 3300009553 Ga0105249_11024607 Ga0105249_110246071 243
266 3300005457 Ga0070662_100262768 Ga0070662_1002627681 244
267 3300005445 Ga0070708_100118073 Ga0070708_1001180732 245
268 3300031691 Ga0316579_10042828 Ga0316579_100428283 245
269 3300049568 Ga0501031_0066876 Ga0501031_0066876_854_1597 245
270 3300049569 Ga0501032_0001812 Ga0501032_0001812_12100_12843 245
271 3300049570 Ga0501033_0010503 Ga0501033_0010503_616_1359 245
272 3300049571 Ga0501034_0011674 Ga0501034_0011674_1271_2014 245
273 3300049572 Ga0501036_0038982 Ga0501036_0038982_984_1727 245
274 3300049573 Ga0501037_0002915 Ga0501037_0002915_4030_4773 245
275 3300049574 Ga0501038_0020236 Ga0501038_0020236_4500_5243 245
276 3300049575 Ga0501039_0102686 Ga0501039_0102686_873_1616 245
277 3300049576 Ga0501040_0022860 Ga0501040_0022860_2573_3316 245
278 3300049577 Ga0501041_0010765 Ga0501041_0010765_1978_2721 245
279 3300049578 Ga0501042_0058357 Ga0501042_0058357_1267_2010 245
280 3300049579 Ga0501043_0002456 Ga0501043_0002456_12418_13161 245
281 3300049582 Ga0501048_0035741 Ga0501048_0035741_854_1597 245
282 3300049583 Ga0501067_0084588 Ga0501067_0084588_64_807 245
283 3300049584 Ga0501068_0003671 Ga0501068_0003671_3903_4646 245
284 3300049585 Ga0501069_0003575 Ga0501069_0003575_3490_4233 245
285 3300049586 Ga0501070_0008161 Ga0501070_0008161_350_1093 245
286 3300049587 Ga0501071_0027161 Ga0501071_0027161_478_1221 245
287 3300049588 Ga0501072_0003764 Ga0501072_0003764_10040_10783 245
288 3300049589 Ga0501073_0001540 Ga0501073_0001540_3773_4516 245
289 3300049590 Ga0501074_0003186 Ga0501074_0003186_1120_1863 245
290 3300049591 Ga0501075_0040487 Ga0501075_0040487_2131_2874 245
291 3300049592 Ga0501076_0044821 Ga0501076_0044821_616_1359 245
292 3300049593 Ga0501077_0012013 Ga0501077_0012013_4061_4804 245
293 3300049742 Ga0501080_0006534 Ga0501080_0006534_983_1726 245
294 3300049743 Ga0501081_0001629 Ga0501081_0001629_7544_8287 245
295 3300049822 Ga0501035_0000996 Ga0501035_0000996_17156_17899 245
296 3300049823 Ga0501044_0004525 Ga0501044_0004525_12637_13380 245
297 3300049824 Ga0501045_0033381 Ga0501045_0033381_854_1597 245
298 3300054114 Ga0501084_0100268 Ga0501084_0100268_745_1488 245
299 3300060353 Ga0501082_0057952 Ga0501082_0057952_463_1206 245
300 3300005330 Ga0070690_100130705 Ga0070690_1001307053 246
301 3300005341 Ga0070691_10257067 Ga0070691_102570672 246
302 3300005438 Ga0070701_10144650 Ga0070701_101446501 246
303 3300005441 Ga0070700_100239488 Ga0070700_1002394882 246
304 3300005618 Ga0068864_100101264 Ga0068864_1001012642 246
305 3300005841 Ga0068863_100354514 Ga0068863_1003545143 246
306 3300005843 Ga0068860_100177287 Ga0068860_1001772874 246
307 3300009148 Ga0105243_10304851 Ga0105243_103048512 246
308 3300009176 Ga0105242_10232621 Ga0105242_102326212 246
309 3300013297 Ga0157378_10291650 Ga0157378_102916503 246
310 3300025908 Ga0207643_10097350 Ga0207643_100973502 246
311 3300025936 Ga0207670_10361641 Ga0207670_103616411 246
312 3300026118 Ga0207675_100372108 Ga0207675_1003721083 246
313 3300026121 Ga0207683_10111455 Ga0207683_101114553 246
314 3300036712 Ga0316584_0287516 Ga0316584_0287516_13_762 246
315 3300005937 Ga0081455_10004239 Ga0081455_100042394 247
316 3300005549 Ga0070704_100041727 Ga0070704_1000417272 248
317 3300046461 Ga0495641_0127830 Ga0495641_0127830_305_1063 248
318 3300046472 Ga0495580_0009035 Ga0495580_0009035_1314_2072 248
319 3300047315 Ga0495581_0112105 Ga0495581_0112105_478_1236 248
320 3300046452 Ga0495617_058937 Ga0495617_058937_286_1065 250
321 3300049568 Ga0501031_0056650 Ga0501031_0056650_591_1343 250
322 3300049570 Ga0501033_0276884 Ga0501033_0276884_204_956 250
323 3300049572 Ga0501036_0150631 Ga0501036_0150631_794_1546 250
324 3300049574 Ga0501038_0259774 Ga0501038_0259774_29_781 250
325 3300049576 Ga0501040_0017372 Ga0501040_0017372_2389_3141 250
326 3300049578 Ga0501042_0022940 Ga0501042_0022940_1208_1960 250
327 3300049582 Ga0501048_0076923 Ga0501048_0076923_1441_2193 250
328 3300049587 Ga0501071_0439281 Ga0501071_0439281_203_955 250
329 3300049588 Ga0501072_0114476 Ga0501072_0114476_290_1042 250
330 3300049590 Ga0501074_0066631 Ga0501074_0066631_661_1413 250
331 3300049591 Ga0501075_0095478 Ga0501075_0095478_1450_2202 250
332 3300049592 Ga0501076_0130895 Ga0501076_0130895_351_1103 250
333 3300049741 Ga0501079_0051116 Ga0501079_0051116_1223_1975 250
334 3300049742 Ga0501080_0281953 Ga0501080_0281953_666_1418 250
335 3300049743 Ga0501081_0036874 Ga0501081_0036874_1077_1829 250
336 3300049824 Ga0501045_0055805 Ga0501045_0055805_2018_2770 250
337 3300054114 Ga0501084_0057936 Ga0501084_0057936_1446_2198 250
338 3300061734 Ga0530510_0503274 Ga0530510_0503274_125_877 250
339 3300049743 Ga0501081_0392414 Ga0501081_0392414_254_1015 251
340 3300031733 Ga0316577_10007973 Ga0316577_100079733 252
341 3300005546 Ga0070696_100004942 Ga0070696_1000049428 253
342 3300009094 Ga0111539_10406282 Ga0111539_104062822 253
343 3300025934 Ga0207686_10177477 Ga0207686_101774772 253
344 3300050511 nmdc:mga08y16_490069_c1 nmdc:mga08y16_490069_c1_314_1087 253
345 3300005937 Ga0081455_10015515 Ga0081455_100155155 254
346 3300006871 Ga0075434_100020987 Ga0075434_1000209876 254
347 3300006880 Ga0075429_100076179 Ga0075429_1000761793 254
348 3300009094 Ga0111539_10022861 Ga0111539_100228614 254
349 3300009147 Ga0114129_10069657 Ga0114129_100696576 254
350 3300027907 Ga0207428_10114042 Ga0207428_101140421 254
351 3300037312 Ga0395899_0028463 Ga0395899_0028463_3112_3888 254
352 3300038443 Ga0395901_0070430 Ga0395901_0070430_2443_3219 254
353 3300050507 nmdc:mga05p37_72969_c1 nmdc:mga05p37_72969_c1_611_1387 254
354 3300050512 nmdc:mga0n895_107232_c1 nmdc:mga0n895_107232_c1_759_1535 254
355 3300050515 nmdc:mga0a205_89947_c1 nmdc:mga0a205_89947_c1_1909_2685 254
356 3300006844 Ga0075428_100211726 Ga0075428_1002117263 258
357 3300050510 nmdc:mga06r32_507337_c1 nmdc:mga06r32_507337_c1_113_889 258
358 3300002459 JGI24751J29686_10000392 JGI24751J29686_1000039214 259
359 3300002459 JGI24751J29686_10015213 JGI24751J29686_100152132 259
360 3300005329 Ga0070683_100086775 Ga0070683_1000867754 259
361 3300005344 Ga0070661_100107466 Ga0070661_1001074661 259
362 3300005354 Ga0070675_100015061 Ga0070675_1000150616 259
363 3300005354 Ga0070675_100066254 Ga0070675_1000662542 259
364 3300005366 Ga0070659_100170468 Ga0070659_1001704682 259
365 3300005406 Ga0070703_10025132 Ga0070703_100251322 259
366 3300005441 Ga0070700_100005613 Ga0070700_1000056133 259
367 3300005444 Ga0070694_100022039 Ga0070694_1000220393 259
368 3300005455 Ga0070663_100068325 Ga0070663_1000683253 259
369 3300005471 Ga0070698_100039940 Ga0070698_1000399406 259
370 3300005535 Ga0070684_100015215 Ga0070684_1000152154 259
371 3300005549 Ga0070704_100004668 Ga0070704_1000046688 259
372 3300005564 Ga0070664_100015706 Ga0070664_1000157063 259
373 3300005577 Ga0068857_100078365 Ga0068857_1000783654 259
374 3300005840 Ga0068870_10000293 Ga0068870_1000029313 259
375 3300005841 Ga0068863_100006522 Ga0068863_1000065224 259
376 3300005843 Ga0068860_100267722 Ga0068860_1002677221 259
377 3300005844 Ga0068862_100080269 Ga0068862_1000802692 259
378 3300005937 Ga0081455_10249239 Ga0081455_102492392 259
379 3300006871 Ga0075434_100012835 Ga0075434_1000128354 259
380 3300009011 Ga0105251_10013398 Ga0105251_100133983 259
381 3300009094 Ga0111539_10124124 Ga0111539_101241244 259
382 3300009094 Ga0111539_10396312 Ga0111539_103963122 259
383 3300009094 Ga0111539_10579708 Ga0111539_105797082 259
384 3300009148 Ga0105243_10006576 Ga0105243_1000657610 259
385 3300009553 Ga0105249_10007025 Ga0105249_100070255 259
386 3300014325 Ga0163163_10094007 Ga0163163_100940073 259
387 3300014745 Ga0157377_10010763 Ga0157377_100107632 259
388 3300025885 Ga0207653_10018236 Ga0207653_100182362 259
389 3300025908 Ga0207643_10000968 Ga0207643_1000096811 259
390 3300025910 Ga0207684_10189286 Ga0207684_101892863 259
391 3300025920 Ga0207649_10029709 Ga0207649_100297093 259
392 3300025925 Ga0207650_10001895 Ga0207650_1000189511 259
393 3300025926 Ga0207659_10199297 Ga0207659_101992971 259
394 3300025935 Ga0207709_10014729 Ga0207709_100147294 259
395 3300025944 Ga0207661_10610824 Ga0207661_106108241 259
396 3300025945 Ga0207679_10017908 Ga0207679_100179084 259
397 3300025961 Ga0207712_10074166 Ga0207712_100741664 259
398 3300026075 Ga0207708_10001806 Ga0207708_100018069 259
399 3300026095 Ga0207676_10002288 Ga0207676_1000228813 259
400 3300026116 Ga0207674_10003023 Ga0207674_1000302312 259
401 3300026118 Ga0207675_100153458 Ga0207675_1001534582 259
402 3300027907 Ga0207428_10013846 Ga0207428_100138468 259
403 3300028380 Ga0268265_10033826 Ga0268265_100338264 259
404 3300035088 Ga0373940_0010242 Ga0373940_0010242_210_989 259
405 3300035114 Ga0373939_0021428 Ga0373939_0021428_268_1047 259
406 3300042003 Ga0439443_007972 Ga0439443_007972_306_1085 259
407 3300046794 Ga0495589_0098400 Ga0495589_0098400_540_1319 259
408 3300047323 Ga0495683_0100547 Ga0495683_0100547_580_1359 259
409 3300047445 Ga0495677_0023344 Ga0495677_0023344_216_995 259
410 3300050509 nmdc:mga0qj67_211156_c1 nmdc:mga0qj67_211156_c1_265_1044 259
411 3300050510 nmdc:mga06r32_61051_c1 nmdc:mga06r32_61051_c1_402_1181 259
412 3300050511 nmdc:mga08y16_242364_c1 nmdc:mga08y16_242364_c1_36_815 259
413 3300050515 nmdc:mga0a205_168964_c1 nmdc:mga0a205_168964_c1_1097_1876 259

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p0c-assembly3.cif.gz_B-2 nischarin px-domain 0.7144 37 71
4wtv-assembly2.cif.gz_B crystal structure of the phosphatidylinositol 4-kinase iibeta 0.6907 75 246
8a5x-assembly1.cif.gz_A crystal structure of phosphatidyl inositol 4-kinase ii beta in complex with mm1373 0.6885 82 246
4yc4-assembly1.cif.gz_A crystal structure of phosphatidyl inositol 4-kinase ii alpha in complex with nucleotide analog 0.6796 73 246
4pla-assembly1.cif.gz_A crystal structure of phosphatidyl inositol 4-kinase ii alpha in complex with atp 0.6569 71 246
ID Description Score Start End Superfamily
af_O06242_7_252_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9089 39 249 3.10.450.50
af_O77353_210_442_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7926 82 245 3.10.20.90
af_O06242_7_252_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7807 39 249 3.10.450.50
af_Q54ES0_99_349_1.10.1070.11 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5;Phosphatidylinositol 3-/4-kinase, catalytic domain 0.7535 57 245 1.10.1070.11
af_Q9SGW8_243_498_1.10.1070.11 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5;Phosphatidylinositol 3-/4-kinase, catalytic domain 0.7349 47 243 1.10.1070.11
ID Description Score Start End GO Terms
AF-A0A2W6CB68-F1-model_v4 Phosphatidylinositol kinase 0.9742 27 119 GO:0016301
AF-A0A7W1BDN1-F1-model_v4 SCO1664 family protein 0.9734 23 214
AF-A0A2W4L9T9-F1-model_v4 SCO1664 family protein 0.9734 26 199
AF-A0A2Z5YGM6-F1-model_v4 deleted 0.9688 35 126
AF-A0A534ZHI4-F1-model_v4 SCO1664 family protein 0.9669 39 226

Feature Viewer

pLDDT pTM Quality
88.47 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map