F437894

General Info

Members Datasets Scaffolds Average Seq Length
412 233 412 171

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0248037|Ga0495645_0248037_617_1174
Length 185
Sequence VTSSNKSERGRLEITRAPLVGLYPGTFDPATLGHLDIIKRAVKLVDHLVIGVATNASKSPLFTLDERMEIMHHEAEKMAEGRATIEVLPVSEVLMVDFAKSIGATVVIRGLRAVSDFEYEFQMAAMNQRLNMEIETVVLMADPRMQAIASKLVKEIAILGGDVKPFTSPYVAERLSKRAKEQANR

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
217 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
218 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
221 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
222 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
223 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
224 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
225 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.17
Nodule 0
Rhizoplane 0.73
Rhizosphere 84.95
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000013 3300003214 Bacteria 402100
2 JGI25153J46596_10003018 3300003215 Bacteria 9527
3 Ga0070658_10042656 3300005327 Bacteria 3664
4 Ga0070658_10051759 3300005327 Bacteria 3328
5 Ga0070658_10240932 3300005327 Bacteria 1533
6 Ga0070683_100113131 3300005329 Bacteria 2561
7 Ga0070690_100254800 3300005330 Bacteria 1243
8 Ga0070666_10125769 3300005335 Bacteria 1780
9 Ga0070666_10148892 3300005335 Bacteria 1633
10 Ga0070680_100723335 3300005336 Bacteria 857
11 Ga0070682_100768151 3300005337 Bacteria 780
12 Ga0068868_100020987 3300005338 Bacteria 4918
13 Ga0068868_101001213 3300005338 Bacteria 764
14 Ga0070660_100308699 3300005339 Bacteria 1298
15 Ga0070661_100003375 3300005344 Bacteria 11008
16 Ga0070661_100242047 3300005344 Bacteria 1390
17 Ga0070668_100226279 3300005347 Bacteria 1545
18 Ga0070675_100721391 3300005354 Bacteria 909
19 Ga0070671_100182508 3300005355 Bacteria 1777
20 Ga0070674_100196003 3300005356 Bacteria 1556
21 Ga0070674_100691522 3300005356 Bacteria 871
22 Ga0070659_100199772 3300005366 Bacteria 1645
23 Ga0070667_100030043 3300005367 Bacteria 4532
24 Ga0070667_101118043 3300005367 Bacteria 737
25 Ga0070667_101431068 3300005367 Bacteria 648
26 Ga0070714_100241269 3300005435 Bacteria 1668
27 Ga0070714_101350416 3300005435 Bacteria 696
28 Ga0070710_10636233 3300005437 Bacteria 746
29 Ga0070711_100132904 3300005439 Bacteria 1856
30 Ga0070681_10893696 3300005458 Bacteria 807
31 Ga0070681_11465611 3300005458 Bacteria 607
32 Ga0070679_100108925 3300005530 Bacteria 2756
33 Ga0070684_100025863 3300005535 Bacteria 4938
34 Ga0068853_100151736 3300005539 Bacteria 2086
35 Ga0068853_100194499 3300005539 Bacteria 1844
36 Ga0070665_100014524 3300005548 Bacteria 7900
37 Ga0070665_100180637 3300005548 Bacteria 2111
38 Ga0070665_100317342 3300005548 Bacteria 1562
39 Ga0070665_100745398 3300005548 Bacteria 992
40 Ga0068855_100062730 3300005563 Bacteria 4338
41 Ga0068855_100100880 3300005563 Bacteria 3323
42 Ga0068855_100308437 3300005563 Bacteria 1751
43 Ga0068857_100026423 3300005577 Bacteria 5117
44 Ga0068857_100324696 3300005577 Bacteria 1422
45 Ga0068856_100415548 3300005614 Bacteria 1365
46 Ga0068856_100785812 3300005614 Bacteria 972
47 Ga0068856_100879184 3300005614 Bacteria 915
48 Ga0068859_101283338 3300005617 Bacteria 807
49 Ga0068864_100097024 3300005618 Bacteria 2609
50 Ga0068864_102034940 3300005618 Bacteria 580
51 Ga0068861_100043871 3300005719 Bacteria 3360
52 Ga0068863_100037524 3300005841 Bacteria 4613
53 Ga0068858_100092535 3300005842 Bacteria 2815
54 Ga0068858_100126240 3300005842 Bacteria 2396
55 Ga0068860_100007909 3300005843 Bacteria 10615
56 Ga0068862_100052027 3300005844 Bacteria 3503
57 Ga0068862_101242549 3300005844 Bacteria 745
58 Ga0075365_10013719 3300006038 Bacteria 4859
59 Ga0075365_10075103 3300006038 Bacteria 2280
60 Ga0075368_10000440 3300006042 Bacteria 12241
61 Ga0075363_100000965 3300006048 Bacteria 10222
62 Ga0075364_10001672 3300006051 Bacteria 12176
63 Ga0070716_100840698 3300006173 Bacteria 714
64 Ga0075362_10000905 3300006177 Bacteria 8980
65 Ga0075367_10005181 3300006178 Bacteria 6443
66 Ga0075369_10003725 3300006186 Bacteria 5577
67 Ga0075366_10000526 3300006195 Bacteria 17747
68 Ga0097621_100000004 3300006237 Bacteria 144414
69 Ga0097621_100050804 3300006237 Bacteria 3373
70 Ga0097621_100054697 3300006237 Bacteria 3256
71 Ga0097621_100106936 3300006237 Bacteria 2360
72 Ga0097621_100768744 3300006237 Bacteria 891
73 Ga0075370_10009230 3300006353 Bacteria 5111
74 Ga0068871_100000028 3300006358 Bacteria 78414
75 Ga0068871_100039943 3300006358 Bacteria 3757
76 Ga0068871_100051672 3300006358 Bacteria 3328
77 Ga0068871_100058907 3300006358 Bacteria 3128
78 Ga0068871_100209463 3300006358 Bacteria 1686
79 Ga0068871_100994823 3300006358 Bacteria 781
80 Ga0068871_101381821 3300006358 Bacteria 663
81 Ga0068865_100004725 3300006881 Bacteria 8224
82 Ga0097620_101283560 3300006931 Bacteria 807
83 Ga0105240_10012030 3300009093 Bacteria 11996
84 Ga0105240_10688043 3300009093 Bacteria 1117
85 Ga0105240_11295699 3300009093 Bacteria 769
86 Ga0105240_11770644 3300009093 Bacteria 644
87 Ga0111539_10191349 3300009094 Bacteria 2387
88 Ga0105245_11176369 3300009098 Bacteria 814
89 Ga0105245_11202249 3300009098 Bacteria 806
90 Ga0105243_10561668 3300009148 Bacteria 1092
91 Ga0105241_10044486 3300009174 Bacteria 3365
92 Ga0105241_10130822 3300009174 Bacteria 2032
93 Ga0105241_10353971 3300009174 Bacteria 1276
94 Ga0105242_10010671 3300009176 Bacteria 7050
95 Ga0105242_10058055 3300009176 Bacteria 3171
96 Ga0105242_11052766 3300009176 Bacteria 825
97 Ga0105248_10024136 3300009177 Bacteria 6758
98 Ga0105248_10598479 3300009177 Bacteria 1244
99 Ga0105248_11347772 3300009177 Bacteria 807
100 Ga0105248_12244001 3300009177 Bacteria 621
101 Ga0105237_10068601 3300009545 Bacteria 3539
102 Ga0105237_10212456 3300009545 Bacteria 1934
103 Ga0105237_10533353 3300009545 Bacteria 1180
104 Ga0105237_11241600 3300009545 Bacteria 752
105 Ga0105238_10088964 3300009551 Bacteria 3075
106 Ga0105238_10247120 3300009551 Bacteria 1762
107 Ga0105238_10776911 3300009551 Bacteria 973
108 Ga0105238_10812232 3300009551 Bacteria 951
109 Ga0105238_11422515 3300009551 Bacteria 721
110 Ga0105249_10400158 3300009553 Bacteria 1403
111 Ga0099796_10018756 3300010159 Bacteria 2084
112 Ga0105239_10266624 3300010375 Bacteria 1925
113 Ga0105239_10503914 3300010375 Bacteria 1376
114 Ga0105239_11114824 3300010375 Bacteria 908
115 Ga0105239_11901294 3300010375 Bacteria 690
116 Ga0105239_12135166 3300010375 Bacteria 651
117 Ga0105246_10593327 3300011119 Bacteria 956
118 Ga0157373_10708270 3300013100 Bacteria 738
119 Ga0157371_10506743 3300013102 Bacteria 892
120 Ga0157369_10307772 3300013105 Bacteria 1648
121 Ga0157374_11105176 3300013296 Bacteria 813
122 Ga0157378_10009866 3300013297 Bacteria 8321
123 Ga0157378_10664226 3300013297 Bacteria 1059
124 Ga0157378_10696576 3300013297 Bacteria 1035
125 Ga0157378_11761577 3300013297 Bacteria 667
126 Ga0163162_10928447 3300013306 Bacteria 982
127 Ga0163162_10989454 3300013306 Bacteria 951
128 Ga0163162_11037858 3300013306 Bacteria 928
129 Ga0157372_10003598 3300013307 Bacteria 16678
130 Ga0157372_10032901 3300013307 Bacteria 5690
131 Ga0157372_10046890 3300013307 Bacteria 4799
132 Ga0157372_10132231 3300013307 Bacteria 2872
133 Ga0157372_10357509 3300013307 Bacteria 1702
134 Ga0157372_12330939 3300013307 Unclassified 615
135 Ga0157375_10038943 3300013308 Bacteria 4569
136 Ga0157375_11236401 3300013308 Bacteria 877
137 Ga0163163_10000111 3300014325 Bacteria 86620
138 Ga0163163_10198702 3300014325 Bacteria 2053
139 Ga0163163_10698658 3300014325 Bacteria 1078
140 Ga0163163_11711168 3300014325 Bacteria 689
141 Ga0157380_10347511 3300014326 Bacteria 1386
142 Ga0157379_10000904 3300014968 Bacteria 24009
143 Ga0157376_10025599 3300014969 Bacteria 4650
144 Ga0157376_10413328 3300014969 Bacteria 1307
145 Ga0157376_10420045 3300014969 Bacteria 1297
146 Ga0157376_10511709 3300014969 Bacteria 1182
147 Ga0157376_11257713 3300014969 Bacteria 769
148 Ga0163161_10184912 3300017792 Bacteria 1599
149 Ga0213874_10007393 3300021377 Bacteria 2635
150 Ga0213876_10000225 3300021384 Bacteria 56051
151 Ga0213876_10001860 3300021384 Bacteria 12707
152 Ga0209233_1000013 3300025261 Bacteria 1013785
153 Ga0209233_1000964 3300025261 Bacteria 12429
154 Ga0209758_1000036 3300025297 Bacteria 441671
155 Ga0209758_1035611 3300025297 Bacteria 1959
156 Ga0207682_10281163 3300025893 Bacteria 778
157 Ga0207642_10129097 3300025899 Bacteria 1316
158 Ga0207680_10186325 3300025903 Bacteria 1406
159 Ga0207705_10028609 3300025909 Bacteria 3973
160 Ga0207705_10132281 3300025909 Bacteria 1857
161 Ga0207654_10002467 3300025911 Bacteria 9403
162 Ga0207707_11006322 3300025912 Bacteria 684
163 Ga0207695_10052612 3300025913 Bacteria 4264
164 Ga0207695_10053055 3300025913 Bacteria 4243
165 Ga0207695_10164623 3300025913 Bacteria 2147
166 Ga0207695_10282504 3300025913 Bacteria 1553
167 Ga0207671_10058895 3300025914 Bacteria 2848
168 Ga0207671_10363350 3300025914 Bacteria 1149
169 Ga0207657_10045311 3300025919 Bacteria 3861
170 Ga0207657_10110733 3300025919 Bacteria 2268
171 Ga0207649_10000073 3300025920 Bacteria 86636
172 Ga0207652_10104136 3300025921 Bacteria 2510
173 Ga0207652_10249463 3300025921 Bacteria 1601
174 Ga0207694_10149311 3300025924 Bacteria 1882
175 Ga0207694_10568488 3300025924 Bacteria 952
176 Ga0207694_10652967 3300025924 Bacteria 886
177 Ga0207694_10873713 3300025924 Bacteria 760
178 Ga0207650_10929218 3300025925 Bacteria 739
179 Ga0207659_10532636 3300025926 Bacteria 997
180 Ga0207687_10417885 3300025927 Bacteria 1106
181 Ga0207664_10204331 3300025929 Bacteria 1707
182 Ga0207664_10739535 3300025929 Bacteria 885
183 Ga0207644_10396162 3300025931 Bacteria 1128
184 Ga0207690_10076015 3300025932 Bacteria 2331
185 Ga0207706_10974168 3300025933 Bacteria 714
186 Ga0207686_10014940 3300025934 Bacteria 4333
187 Ga0207686_10015854 3300025934 Bacteria 4223
188 Ga0207686_10413273 3300025934 Bacteria 1030
189 Ga0207709_11190700 3300025935 Bacteria 628
190 Ga0207669_10294117 3300025937 Bacteria 1231
191 Ga0207704_10072895 3300025938 Bacteria 2185
192 Ga0207704_10139205 3300025938 Bacteria 1695
193 Ga0207691_10241027 3300025940 Bacteria 1563
194 Ga0207711_10046724 3300025941 Bacteria 3699
195 Ga0207711_10721432 3300025941 Bacteria 930
196 Ga0207689_10233103 3300025942 Bacteria 1521
197 Ga0207661_10443714 3300025944 Bacteria 1181
198 Ga0207679_10133854 3300025945 Bacteria 1993
199 Ga0207667_10138834 3300025949 Bacteria 2502
200 Ga0207667_10148405 3300025949 Bacteria 2414
201 Ga0207667_10370059 3300025949 Bacteria 1460
202 Ga0207651_10526933 3300025960 Bacteria 1025
203 Ga0207712_10816830 3300025961 Bacteria 820
204 Ga0207668_10102022 3300025972 Bacteria 2134
205 Ga0207668_11107731 3300025972 Bacteria 710
206 Ga0207658_10450449 3300025986 Bacteria 1139
207 Ga0207677_10394635 3300026023 Bacteria 1172
208 Ga0207703_10012145 3300026035 Bacteria 6712
209 Ga0207703_10188910 3300026035 Bacteria 1823
210 Ga0207639_10039705 3300026041 Bacteria 3508
211 Ga0207639_10456432 3300026041 Bacteria 1161
212 Ga0207639_10546747 3300026041 Bacteria 1063
213 Ga0207678_10248217 3300026067 Bacteria 1524
214 Ga0207702_10445162 3300026078 Bacteria 1256
215 Ga0207702_10770394 3300026078 Bacteria 950
216 Ga0207702_10809718 3300026078 Bacteria 926
217 Ga0207641_10010540 3300026088 Bacteria 7585
218 Ga0207641_11840447 3300026088 Bacteria 607
219 Ga0207676_10053359 3300026095 Bacteria 3164
220 Ga0207676_11145877 3300026095 Bacteria 770
221 Ga0207674_10040418 3300026116 Bacteria 4831
222 Ga0207674_10211073 3300026116 Bacteria 1890
223 Ga0207674_10276056 3300026116 Bacteria 1628
224 Ga0207683_10047741 3300026121 Bacteria 3749
225 Ga0209813_10000625 3300027866 Bacteria 8213
226 Ga0268266_10108213 3300028379 Bacteria 2459
227 Ga0268266_10156276 3300028379 Bacteria 2060
228 Ga0268265_10305547 3300028380 Bacteria 1434
229 Ga0268265_10335381 3300028380 Bacteria 1375
230 Ga0268265_10688174 3300028380 Bacteria 987
231 Ga0268264_10153274 3300028381 Bacteria 2068
232 Ga0265318_10043625 3300028577 Bacteria 1699
233 Ga0265338_10043723 3300028800 Bacteria 4149
234 Ga0265338_10095701 3300028800 Bacteria 2438
235 Ga0265330_10032648 3300031235 Bacteria 2332
236 Ga0265332_10025264 3300031238 Bacteria 2610
237 Ga0265332_10108831 3300031238 Bacteria 1168
238 Ga0265332_10141750 3300031238 Bacteria 1007
239 Ga0265328_10097955 3300031239 Bacteria 1085
240 Ga0265325_10004925 3300031241 Bacteria 8327
241 Ga0265325_10015770 3300031241 Bacteria 4240
242 Ga0265329_10023000 3300031242 Bacteria 2080
243 Ga0265340_10000021 3300031247 Bacteria 87640
244 Ga0265340_10003362 3300031247 Bacteria 9050
245 Ga0265340_10068658 3300031247 Bacteria 1683
246 Ga0265339_10009825 3300031249 Bacteria 5977
247 Ga0265339_10055770 3300031249 Bacteria 2142
248 Ga0265339_10089270 3300031249 Bacteria 1618
249 Ga0265339_10162401 3300031249 Bacteria 1123
250 Ga0265331_10000006 3300031250 Bacteria 418907
251 Ga0265331_10000823 3300031250 Bacteria 25431
252 Ga0265331_10189889 3300031250 Bacteria 927
253 Ga0265327_10000074 3300031251 Bacteria 214435
254 Ga0265327_10031062 3300031251 Bacteria 3008
255 Ga0265316_10002070 3300031344 Bacteria 21121
256 Ga0265316_10049639 3300031344 Bacteria 3304
257 Ga0265316_10050999 3300031344 Bacteria 3252
258 Ga0265316_10308281 3300031344 Bacteria 1152
259 Ga0265316_10380236 3300031344 Bacteria 1019
260 Ga0265313_10008006 3300031595 Bacteria 7093
261 Ga0265313_10063720 3300031595 Bacteria 1717
262 Ga0265313_10118864 3300031595 Bacteria 1154
263 Ga0265314_10000370 3300031711 Bacteria 61431
264 Ga0265314_10065200 3300031711 Bacteria 2461
265 Ga0265314_10076858 3300031711 Bacteria 2216
266 Ga0265314_10205980 3300031711 Bacteria 1159
267 Ga0265314_10209975 3300031711 Bacteria 1144
268 Ga0265342_10052161 3300031712 Bacteria 2438
269 Ga0265342_10228314 3300031712 Bacteria 1001
270 Ga0265342_10293623 3300031712 Bacteria 858
271 Ga0307516_10075012 3300031730 Bacteria 3237
272 Ga0307516_10086492 3300031730 Bacteria 2971
273 Ga0307507_10035940 3300033179 Bacteria 5076
274 Ga0373943_0014593 3300035170 Bacteria 3560
275 Ga0373946_0139774 3300035171 Bacteria 1121
276 Ga0373935_0009238 3300035692 Bacteria 5901
277 Ga0373947_0009411 3300035725 Bacteria 5613
278 Ga0373925_0002583 3300037068 Bacteria 14402
279 Ga0373925_0200239 3300037068 Bacteria 1588
280 Ga0395900_0820690 3300037418 Bacteria 857
281 Ga0395898_0178819 3300037466 Bacteria 2027
282 Ga0395901_1304928 3300038443 Bacteria 687
283 Ga0436365_0014930 3300039437 Bacteria 48249
284 Ga0436365_0992819 3300039437 Bacteria 772
285 Ga0436365_1698101 3300039437 Bacteria 2635
286 Ga0436365_1793593 3300039437 Bacteria 726
287 Ga0436361_1129526 3300039447 Bacteria 1029
288 Ga0436363_0026865 3300039450 Bacteria 582
289 Ga0436363_1287658 3300039450 Bacteria 1996
290 Ga0436362_1114918 3300039453 Bacteria 811
291 Ga0451793_0905697 3300041452 Bacteria 969
292 Ga0451802_2127313 3300041460 Bacteria 985
293 Ga0466967_0623967 3300045976 Bacteria 1065
294 Ga0495617_133260 3300046452 Bacteria 796
295 Ga0495592_0188789 3300046454 Bacteria 1398
296 Ga0495650_0055472 3300046471 Bacteria 1612
297 Ga0495580_0003681 3300046472 Bacteria 13002
298 Ga0495639_0194789 3300046475 Bacteria 990
299 Ga0495585_0155984 3300046492 Bacteria 1188
300 Ga0495618_0784459 3300046514 Bacteria 556
301 Ga0495648_0295686 3300046524 Bacteria 761
302 Ga0495665_0153390 3300046531 Bacteria 1202
303 Ga0495609_0007772 3300046538 Bacteria 5314
304 Ga0495621_0013772 3300046539 Bacteria 2547
305 Ga0495645_0248037 3300046543 Bacteria 1185
306 Ga0495622_0011212 3300046557 Bacteria 4138
307 Ga0495656_0066625 3300046615 Bacteria 1587
308 Ga0495657_0143026 3300046675 Bacteria 1490
309 Ga0495658_0006807 3300046683 Bacteria 5627
310 Ga0495658_0130522 3300046683 Bacteria 1529
311 Ga0495649_0042200 3300046694 Bacteria 2493
312 Ga0495589_0132521 3300046794 Bacteria 1196
313 Ga0495600_0242670 3300046809 Bacteria 1148
314 Ga0495636_0018305 3300047318 Bacteria 2810
315 Ga0495674_0557773 3300047319 Bacteria 911
316 Ga0495683_0168356 3300047323 Bacteria 1009
317 Ga0495602_0275398 3300048088 Bacteria 1242
318 Ga0496100_0570477 3300048903 Bacteria 877
319 Ga0496121_0002103 3300048924 Bacteria 31338
320 Ga0501031_0020259 3300049568 Bacteria 4336
321 Ga0501031_0790913 3300049568 Bacteria 608
322 Ga0501032_0010031 3300049569 Bacteria 6838
323 Ga0501032_0114470 3300049569 Bacteria 1784
324 Ga0501033_0005872 3300049570 Bacteria 9648
325 Ga0501033_0025987 3300049570 Bacteria 4406
326 Ga0501033_0086134 3300049570 Bacteria 2300
327 Ga0501033_0359283 3300049570 Bacteria 1019
328 Ga0501034_0091345 3300049571 Bacteria 3042
329 Ga0501034_0856060 3300049571 Bacteria 799
330 Ga0501034_1212180 3300049571 Bacteria 633
331 Ga0501036_0019828 3300049572 Bacteria 5646
332 Ga0501036_0193741 3300049572 Bacteria 1710
333 Ga0501036_0661431 3300049572 Bacteria 864
334 Ga0501037_0019421 3300049573 Bacteria 5012
335 Ga0501037_0027488 3300049573 Bacteria 4203
336 Ga0501037_0420433 3300049573 Bacteria 915
337 Ga0501037_0562427 3300049573 Bacteria 769
338 Ga0501038_0018768 3300049574 Bacteria 6243
339 Ga0501038_0037225 3300049574 Bacteria 4267
340 Ga0501038_0226698 3300049574 Bacteria 1489
341 Ga0501038_0348650 3300049574 Bacteria 1153
342 Ga0501038_0862456 3300049574 Bacteria 670
343 Ga0501039_0034845 3300049575 Bacteria 3884
344 Ga0501043_0005813 3300049579 Bacteria 9923
345 Ga0501043_0027261 3300049579 Bacteria 4486
346 Ga0501043_0151476 3300049579 Bacteria 1815
347 Ga0501046_0002196 3300049580 Bacteria 18436
348 Ga0501046_0066667 3300049580 Bacteria 2805
349 Ga0501046_0068504 3300049580 Bacteria 2762
350 Ga0501046_0272575 3300049580 Bacteria 1241
351 Ga0501046_0372038 3300049580 Bacteria 1035
352 Ga0501047_0054734 3300049581 Bacteria 3859
353 Ga0501047_0135343 3300049581 Bacteria 2344
354 Ga0501047_0180256 3300049581 Bacteria 1979
355 Ga0501048_0001595 3300049582 Bacteria 17213
356 Ga0501067_0002120 3300049583 Bacteria 10922
357 Ga0501068_0033835 3300049584 Bacteria 3046
358 Ga0501069_0005271 3300049585 Bacteria 6717
359 Ga0501070_0007693 3300049586 Bacteria 9139
360 Ga0501072_0023730 3300049588 Bacteria 4765
361 Ga0501073_0041007 3300049589 Bacteria 3272
362 Ga0501073_0185959 3300049589 Bacteria 1438
363 Ga0501073_0486902 3300049589 Bacteria 853
364 Ga0501074_0006923 3300049590 Bacteria 8185
365 Ga0501076_0140467 3300049592 Bacteria 1962
366 Ga0501079_0017694 3300049741 Bacteria 5444
367 Ga0501080_0063730 3300049742 Bacteria 3429
368 Ga0501080_0220922 3300049742 Bacteria 1734
369 Ga0501080_0289771 3300049742 Bacteria 1486
370 Ga0501080_0638584 3300049742 Bacteria 943
371 Ga0501083_0012369 3300049744 Bacteria 5972
372 Ga0501083_0037466 3300049744 Bacteria 3303
373 Ga0501035_0102792 3300049822 Bacteria 2507
374 Ga0501035_0164015 3300049822 Bacteria 1922
375 Ga0501035_0204603 3300049822 Bacteria 1691
376 Ga0501035_0433783 3300049822 Bacteria 1089
377 Ga0501044_0047692 3300049823 Bacteria 4430
378 Ga0501044_0058863 3300049823 Bacteria 3938
379 Ga0501044_0078571 3300049823 Bacteria 3343
380 Ga0501044_0406472 3300049823 Bacteria 1273
381 nmdc:mga03683_1393_c1 3300050489 Bacteria 7192
382 nmdc:mga03n38_1069_c1 3300050490 Bacteria 7557
383 nmdc:mga00v17_67378_c1 3300050491 Bacteria 2212
384 nmdc:mga0yw44_8703_c1 3300050492 Bacteria 5076
385 nmdc:mga0k408_18844_c1 3300050493 Bacteria 3853
386 nmdc:mga06z11_1924_c1 3300050494 Bacteria 7832
387 nmdc:mga06z11_392765_c1 3300050494 Bacteria 834
388 nmdc:mga04h51_383_c1 3300050495 Bacteria 10752
389 nmdc:mga07m45_426681_c1 3300050496 Bacteria 769
390 Ga0500643_000014 3300053087 Bacteria 318249
391 Ga0500644_0304027 3300053088 Bacteria 683
392 Ga0500566_0372756 3300053094 Bacteria 647
393 Ga0500641_0209479 3300053096 Bacteria 830
394 Ga0500650_0395297 3300053098 Bacteria 599
395 Ga0500555_036129 3300053103 Bacteria 1386
396 Ga0500593_205750 3300053117 Bacteria 706
397 Ga0500594_0021048 3300053118 Bacteria 1632
398 Ga0500594_0056065 3300053118 Bacteria 1123
399 Ga0500595_000390 3300053119 Bacteria 28255
400 Ga0500595_021288 3300053119 Bacteria 2317
401 Ga0500595_054709 3300053119 Bacteria 1224
402 Ga0500595_087748 3300053119 Bacteria 904
403 Ga0500597_062620 3300053120 Bacteria 1600
404 Ga0500642_0077175 3300053130 Bacteria 1525
405 Ga0500568_0137526 3300053139 Bacteria 906
406 Ga0500616_0114683 3300053153 Bacteria 1296
407 Ga0500639_146681 3300053163 Bacteria 1094
408 Ga0500636_0318539 3300053177 Bacteria 757
409 Ga0500596_023331 3300053735 Bacteria 938
410 Ga0501084_0021827 3300054114 Bacteria 5340
411 Ga0501082_0007310 3300060353 Bacteria 9530
412 Ga0501082_0039274 3300060353 Bacteria 4083

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1698101 Ga0436365_1698101_1597_2055 152
2 3300025972 Ga0207668_11107731 Ga0207668_111077312 156
3 3300041460 Ga0451802_2127313 Ga0451802_2127313_408_890 158
4 3300006038 Ga0075365_10013719 Ga0075365_100137195 161
5 3300006038 Ga0075365_10075103 Ga0075365_100751032 161
6 3300006042 Ga0075368_10000440 Ga0075368_100004407 161
7 3300006048 Ga0075363_100000965 Ga0075363_1000009653 161
8 3300006051 Ga0075364_10001672 Ga0075364_100016727 161
9 3300006177 Ga0075362_10000905 Ga0075362_100009053 161
10 3300006178 Ga0075367_10005181 Ga0075367_100051816 161
11 3300006186 Ga0075369_10003725 Ga0075369_100037252 161
12 3300006195 Ga0075366_10000526 Ga0075366_1000052612 161
13 3300006353 Ga0075370_10009230 Ga0075370_100092304 161
14 3300013102 Ga0157371_10506743 Ga0157371_105067432 161
15 3300027866 Ga0209813_10000625 Ga0209813_100006253 161
16 3300033179 Ga0307507_10035940 Ga0307507_100359403 161
17 3300050489 nmdc:mga03683_1393_c1 nmdc:mga03683_1393_c1_5544_6035 161
18 3300050490 nmdc:mga03n38_1069_c1 nmdc:mga03n38_1069_c1_77_568 161
19 3300050491 nmdc:mga00v17_67378_c1 nmdc:mga00v17_67378_c1_1381_1872 161
20 3300050492 nmdc:mga0yw44_8703_c1 nmdc:mga0yw44_8703_c1_113_604 161
21 3300050493 nmdc:mga0k408_18844_c1 nmdc:mga0k408_18844_c1_2205_2696 161
22 3300050494 nmdc:mga06z11_1924_c1 nmdc:mga06z11_1924_c1_341_832 161
23 3300050494 nmdc:mga06z11_392765_c1 nmdc:mga06z11_392765_c1_86_577 161
24 3300050495 nmdc:mga04h51_383_c1 nmdc:mga04h51_383_c1_6238_6729 161
25 3300050496 nmdc:mga07m45_426681_c1 nmdc:mga07m45_426681_c1_191_682 161
26 3300053096 Ga0500641_0209479 Ga0500641_0209479_11_502 161
27 3300053117 Ga0500593_205750 Ga0500593_205750_140_631 161
28 3300053118 Ga0500594_0021048 Ga0500594_0021048_1076_1567 161
29 3300031251 Ga0265327_10031062 Ga0265327_100310623 163
30 3300005327 Ga0070658_10042656 Ga0070658_100426564 164
31 3300006358 Ga0068871_100994823 Ga0068871_1009948232 166
32 3300010159 Ga0099796_10018756 Ga0099796_100187562 166
33 3300037068 Ga0373925_0200239 Ga0373925_0200239_572_1075 166
34 3300039437 Ga0436365_0992819 Ga0436365_0992819_141_641 166
35 3300046531 Ga0495665_0153390 Ga0495665_0153390_373_876 166
36 3300049574 Ga0501038_0862456 Ga0501038_0862456_140_652 166
37 3300005435 Ga0070714_101350416 Ga0070714_1013504161 167
38 3300005439 Ga0070711_100132904 Ga0070711_1001329042 167
39 3300005614 Ga0068856_100415548 Ga0068856_1004155482 167
40 3300005614 Ga0068856_100879184 Ga0068856_1008791842 167
41 3300006173 Ga0070716_100840698 Ga0070716_1008406982 167
42 3300006358 Ga0068871_100051672 Ga0068871_1000516722 167
43 3300009176 Ga0105242_10010671 Ga0105242_100106715 167
44 3300013307 Ga0157372_10003598 Ga0157372_1000359813 167
45 3300013307 Ga0157372_10032901 Ga0157372_100329015 167
46 3300013307 Ga0157372_10046890 Ga0157372_100468902 167
47 3300013307 Ga0157372_10357509 Ga0157372_103575092 167
48 3300014969 Ga0157376_11257713 Ga0157376_112577132 167
49 3300021377 Ga0213874_10007393 Ga0213874_100073933 167
50 3300021384 Ga0213876_10000225 Ga0213876_1000022548 167
51 3300025929 Ga0207664_10739535 Ga0207664_107395352 167
52 3300025934 Ga0207686_10014940 Ga0207686_100149405 167
53 3300026078 Ga0207702_10770394 Ga0207702_107703942 167
54 3300026078 Ga0207702_10809718 Ga0207702_108097182 167
55 3300035170 Ga0373943_0014593 Ga0373943_0014593_2872_3381 167
56 3300035171 Ga0373946_0139774 Ga0373946_0139774_36_545 167
57 3300035692 Ga0373935_0009238 Ga0373935_0009238_2980_3489 167
58 3300035725 Ga0373947_0009411 Ga0373947_0009411_1006_1515 167
59 3300037068 Ga0373925_0002583 Ga0373925_0002583_3289_3798 167
60 3300039437 Ga0436365_0014930 Ga0436365_0014930_45657_46169 167
61 3300039450 Ga0436363_0026865 Ga0436363_0026865_14_520 167
62 3300039450 Ga0436363_1287658 Ga0436363_1287658_81_593 167
63 3300046472 Ga0495580_0003681 Ga0495580_0003681_539_1051 167
64 3300046475 Ga0495639_0194789 Ga0495639_0194789_378_890 167
65 3300046683 Ga0495658_0006807 Ga0495658_0006807_727_1239 167
66 3300047319 Ga0495674_0557773 Ga0495674_0557773_136_645 167
67 3300053153 Ga0500616_0114683 Ga0500616_0114683_539_1048 167
68 3300005435 Ga0070714_100241269 Ga0070714_1002412692 168
69 3300005437 Ga0070710_10636233 Ga0070710_106362331 168
70 3300005548 Ga0070665_100180637 Ga0070665_1001806372 168
71 3300009094 Ga0111539_10191349 Ga0111539_101913492 168
72 3300025929 Ga0207664_10204331 Ga0207664_102043312 168
73 3300025933 Ga0207706_10974168 Ga0207706_109741682 168
74 3300028577 Ga0265318_10043625 Ga0265318_100436253 168
75 3300031235 Ga0265330_10032648 Ga0265330_100326484 168
76 3300031238 Ga0265332_10108831 Ga0265332_101088312 168
77 3300031239 Ga0265328_10097955 Ga0265328_100979552 168
78 3300031241 Ga0265325_10015770 Ga0265325_100157702 168
79 3300031247 Ga0265340_10000021 Ga0265340_1000002113 168
80 3300031247 Ga0265340_10003362 Ga0265340_100033625 168
81 3300031247 Ga0265340_10068658 Ga0265340_100686583 168
82 3300031249 Ga0265339_10055770 Ga0265339_100557702 168
83 3300031249 Ga0265339_10089270 Ga0265339_100892702 168
84 3300031250 Ga0265331_10189889 Ga0265331_101898892 168
85 3300031344 Ga0265316_10002070 Ga0265316_1000207021 168
86 3300031344 Ga0265316_10049639 Ga0265316_100496393 168
87 3300031344 Ga0265316_10380236 Ga0265316_103802362 168
88 3300031595 Ga0265313_10063720 Ga0265313_100637202 168
89 3300031595 Ga0265313_10118864 Ga0265313_101188642 168
90 3300031711 Ga0265314_10000370 Ga0265314_100003706 168
91 3300031712 Ga0265342_10052161 Ga0265342_100521613 168
92 3300003215 JGI25153J46596_10003018 JGI25153J46596_100030182 169
93 3300005327 Ga0070658_10051759 Ga0070658_100517592 169
94 3300005327 Ga0070658_10240932 Ga0070658_102409321 169
95 3300005329 Ga0070683_100113131 Ga0070683_1001131313 169
96 3300005330 Ga0070690_100254800 Ga0070690_1002548002 169
97 3300005335 Ga0070666_10125769 Ga0070666_101257692 169
98 3300005336 Ga0070680_100723335 Ga0070680_1007233352 169
99 3300005338 Ga0068868_100020987 Ga0068868_1000209874 169
100 3300005338 Ga0068868_101001213 Ga0068868_1010012131 169
101 3300005339 Ga0070660_100308699 Ga0070660_1003086992 169
102 3300005344 Ga0070661_100242047 Ga0070661_1002420473 169
103 3300005347 Ga0070668_100226279 Ga0070668_1002262791 169
104 3300005355 Ga0070671_100182508 Ga0070671_1001825082 169
105 3300005356 Ga0070674_100196003 Ga0070674_1001960032 169
106 3300005356 Ga0070674_100691522 Ga0070674_1006915221 169
107 3300005366 Ga0070659_100199772 Ga0070659_1001997722 169
108 3300005367 Ga0070667_100030043 Ga0070667_1000300432 169
109 3300005367 Ga0070667_101118043 Ga0070667_1011180432 169
110 3300005367 Ga0070667_101431068 Ga0070667_1014310681 169
111 3300005458 Ga0070681_11465611 Ga0070681_114656111 169
112 3300005535 Ga0070684_100025863 Ga0070684_1000258631 169
113 3300005539 Ga0068853_100151736 Ga0068853_1001517362 169
114 3300005548 Ga0070665_100317342 Ga0070665_1003173423 169
115 3300005548 Ga0070665_100745398 Ga0070665_1007453982 169
116 3300005563 Ga0068855_100062730 Ga0068855_1000627304 169
117 3300005563 Ga0068855_100100880 Ga0068855_1001008804 169
118 3300005563 Ga0068855_100308437 Ga0068855_1003084373 169
119 3300005577 Ga0068857_100324696 Ga0068857_1003246962 169
120 3300005614 Ga0068856_100785812 Ga0068856_1007858122 169
121 3300005617 Ga0068859_101283338 Ga0068859_1012833381 169
122 3300005719 Ga0068861_100043871 Ga0068861_1000438713 169
123 3300005841 Ga0068863_100037524 Ga0068863_1000375242 169
124 3300005842 Ga0068858_100092535 Ga0068858_1000925352 169
125 3300005842 Ga0068858_100126240 Ga0068858_1001262402 169
126 3300005844 Ga0068862_101242549 Ga0068862_1012425492 169
127 3300006237 Ga0097621_100054697 Ga0097621_1000546974 169
128 3300006237 Ga0097621_100106936 Ga0097621_1001069363 169
129 3300006237 Ga0097621_100768744 Ga0097621_1007687442 169
130 3300006358 Ga0068871_100058907 Ga0068871_1000589072 169
131 3300006358 Ga0068871_100209463 Ga0068871_1002094632 169
132 3300006881 Ga0068865_100004725 Ga0068865_1000047259 169
133 3300006931 Ga0097620_101283560 Ga0097620_1012835601 169
134 3300009093 Ga0105240_10012030 Ga0105240_100120308 169
135 3300009093 Ga0105240_10688043 Ga0105240_106880432 169
136 3300009093 Ga0105240_11295699 Ga0105240_112956992 169
137 3300009093 Ga0105240_11770644 Ga0105240_117706442 169
138 3300009098 Ga0105245_11176369 Ga0105245_111763691 169
139 3300009098 Ga0105245_11202249 Ga0105245_112022492 169
140 3300009148 Ga0105243_10561668 Ga0105243_105616682 169
141 3300009174 Ga0105241_10130822 Ga0105241_101308222 169
142 3300009174 Ga0105241_10353971 Ga0105241_103539712 169
143 3300009176 Ga0105242_11052766 Ga0105242_110527662 169
144 3300009177 Ga0105248_10024136 Ga0105248_100241364 169
145 3300009177 Ga0105248_10598479 Ga0105248_105984792 169
146 3300009177 Ga0105248_11347772 Ga0105248_113477722 169
147 3300009177 Ga0105248_12244001 Ga0105248_122440011 169
148 3300009545 Ga0105237_10068601 Ga0105237_100686014 169
149 3300009545 Ga0105237_10212456 Ga0105237_102124561 169
150 3300009545 Ga0105237_11241600 Ga0105237_112416002 169
151 3300009551 Ga0105238_10247120 Ga0105238_102471203 169
152 3300009551 Ga0105238_10776911 Ga0105238_107769112 169
153 3300009551 Ga0105238_10812232 Ga0105238_108122322 169
154 3300009551 Ga0105238_11422515 Ga0105238_114225151 169
155 3300009553 Ga0105249_10400158 Ga0105249_104001582 169
156 3300010375 Ga0105239_10266624 Ga0105239_102666242 169
157 3300010375 Ga0105239_10503914 Ga0105239_105039142 169
158 3300010375 Ga0105239_11114824 Ga0105239_111148242 169
159 3300010375 Ga0105239_11901294 Ga0105239_119012942 169
160 3300010375 Ga0105239_12135166 Ga0105239_121351662 169
161 3300013100 Ga0157373_10708270 Ga0157373_107082701 169
162 3300013105 Ga0157369_10307772 Ga0157369_103077722 169
163 3300013296 Ga0157374_11105176 Ga0157374_111051762 169
164 3300013297 Ga0157378_10009866 Ga0157378_100098669 169
165 3300013297 Ga0157378_10664226 Ga0157378_106642262 169
166 3300013297 Ga0157378_10696576 Ga0157378_106965762 169
167 3300013306 Ga0163162_10928447 Ga0163162_109284472 169
168 3300013306 Ga0163162_10989454 Ga0163162_109894542 169
169 3300013306 Ga0163162_11037858 Ga0163162_110378582 169
170 3300013307 Ga0157372_10132231 Ga0157372_101322312 169
171 3300013308 Ga0157375_10038943 Ga0157375_100389435 169
172 3300014325 Ga0163163_10198702 Ga0163163_101987023 169
173 3300014325 Ga0163163_10698658 Ga0163163_106986582 169
174 3300014325 Ga0163163_11711168 Ga0163163_117111681 169
175 3300014326 Ga0157380_10347511 Ga0157380_103475112 169
176 3300014969 Ga0157376_10025599 Ga0157376_100255994 169
177 3300014969 Ga0157376_10413328 Ga0157376_104133282 169
178 3300014969 Ga0157376_10511709 Ga0157376_105117091 169
179 3300017792 Ga0163161_10184912 Ga0163161_101849123 169
180 3300025261 Ga0209233_1000964 Ga0209233_10009643 169
181 3300025297 Ga0209758_1000036 Ga0209758_1000036232 169
182 3300025297 Ga0209758_1035611 Ga0209758_10356112 169
183 3300025899 Ga0207642_10129097 Ga0207642_101290972 169
184 3300025909 Ga0207705_10028609 Ga0207705_100286092 169
185 3300025912 Ga0207707_11006322 Ga0207707_110063222 169
186 3300025913 Ga0207695_10052612 Ga0207695_100526124 169
187 3300025913 Ga0207695_10053055 Ga0207695_100530552 169
188 3300025913 Ga0207695_10164623 Ga0207695_101646232 169
189 3300025914 Ga0207671_10058895 Ga0207671_100588952 169
190 3300025919 Ga0207657_10110733 Ga0207657_101107333 169
191 3300025921 Ga0207652_10249463 Ga0207652_102494632 169
192 3300025924 Ga0207694_10652967 Ga0207694_106529672 169
193 3300025924 Ga0207694_10873713 Ga0207694_108737131 169
194 3300025925 Ga0207650_10929218 Ga0207650_109292181 169
195 3300025927 Ga0207687_10417885 Ga0207687_104178852 169
196 3300025931 Ga0207644_10396162 Ga0207644_103961622 169
197 3300025932 Ga0207690_10076015 Ga0207690_100760152 169
198 3300025934 Ga0207686_10413273 Ga0207686_104132732 169
199 3300025935 Ga0207709_11190700 Ga0207709_111907001 169
200 3300025937 Ga0207669_10294117 Ga0207669_102941172 169
201 3300025938 Ga0207704_10072895 Ga0207704_100728953 169
202 3300025938 Ga0207704_10139205 Ga0207704_101392053 169
203 3300025940 Ga0207691_10241027 Ga0207691_102410272 169
204 3300025941 Ga0207711_10046724 Ga0207711_100467242 169
205 3300025941 Ga0207711_10721432 Ga0207711_107214322 169
206 3300025944 Ga0207661_10443714 Ga0207661_104437142 169
207 3300025945 Ga0207679_10133854 Ga0207679_101338542 169
208 3300025949 Ga0207667_10138834 Ga0207667_101388342 169
209 3300025949 Ga0207667_10148405 Ga0207667_101484052 169
210 3300025949 Ga0207667_10370059 Ga0207667_103700593 169
211 3300025960 Ga0207651_10526933 Ga0207651_105269332 169
212 3300025961 Ga0207712_10816830 Ga0207712_108168302 169
213 3300025986 Ga0207658_10450449 Ga0207658_104504492 169
214 3300026023 Ga0207677_10394635 Ga0207677_103946352 169
215 3300026035 Ga0207703_10012145 Ga0207703_100121456 169
216 3300026035 Ga0207703_10188910 Ga0207703_101889102 169
217 3300026041 Ga0207639_10456432 Ga0207639_104564322 169
218 3300026041 Ga0207639_10546747 Ga0207639_105467472 169
219 3300026078 Ga0207702_10445162 Ga0207702_104451622 169
220 3300026088 Ga0207641_10010540 Ga0207641_100105406 169
221 3300026088 Ga0207641_11840447 Ga0207641_118404471 169
222 3300026095 Ga0207676_11145877 Ga0207676_111458772 169
223 3300026116 Ga0207674_10211073 Ga0207674_102110732 169
224 3300026116 Ga0207674_10276056 Ga0207674_102760563 169
225 3300026121 Ga0207683_10047741 Ga0207683_100477414 169
226 3300028379 Ga0268266_10108213 Ga0268266_101082132 169
227 3300028379 Ga0268266_10156276 Ga0268266_101562762 169
228 3300028380 Ga0268265_10335381 Ga0268265_103353813 169
229 3300028380 Ga0268265_10688174 Ga0268265_106881742 169
230 3300028800 Ga0265338_10095701 Ga0265338_100957012 169
231 3300031250 Ga0265331_10000006 Ga0265331_1000000687 169
232 3300037418 Ga0395900_0820690 Ga0395900_0820690_78_587 169
233 3300037466 Ga0395898_0178819 Ga0395898_0178819_204_713 169
234 3300038443 Ga0395901_1304928 Ga0395901_1304928_11_520 169
235 3300039437 Ga0436365_1793593 Ga0436365_1793593_135_644 169
236 3300039447 Ga0436361_1129526 Ga0436361_1129526_222_734 169
237 3300039453 Ga0436362_1114918 Ga0436362_1114918_258_773 169
238 3300041452 Ga0451793_0905697 Ga0451793_0905697_13_522 169
239 3300045976 Ga0466967_0623967 Ga0466967_0623967_257_775 169
240 3300046452 Ga0495617_133260 Ga0495617_133260_159_668 169
241 3300046471 Ga0495650_0055472 Ga0495650_0055472_595_1104 169
242 3300046492 Ga0495585_0155984 Ga0495585_0155984_54_563 169
243 3300046514 Ga0495618_0784459 Ga0495618_0784459_25_534 169
244 3300046524 Ga0495648_0295686 Ga0495648_0295686_130_639 169
245 3300046538 Ga0495609_0007772 Ga0495609_0007772_613_1122 169
246 3300046539 Ga0495621_0013772 Ga0495621_0013772_395_904 169
247 3300046615 Ga0495656_0066625 Ga0495656_0066625_490_999 169
248 3300046683 Ga0495658_0130522 Ga0495658_0130522_519_1028 169
249 3300046794 Ga0495589_0132521 Ga0495589_0132521_363_872 169
250 3300047318 Ga0495636_0018305 Ga0495636_0018305_1951_2460 169
251 3300048903 Ga0496100_0570477 Ga0496100_0570477_331_840 169
252 3300049568 Ga0501031_0020259 Ga0501031_0020259_3222_3731 169
253 3300049568 Ga0501031_0790913 Ga0501031_0790913_31_543 169
254 3300049569 Ga0501032_0010031 Ga0501032_0010031_5353_5862 169
255 3300049570 Ga0501033_0025987 Ga0501033_0025987_3353_3862 169
256 3300049570 Ga0501033_0086134 Ga0501033_0086134_143_655 169
257 3300049570 Ga0501033_0359283 Ga0501033_0359283_449_958 169
258 3300049571 Ga0501034_0091345 Ga0501034_0091345_1349_1858 169
259 3300049572 Ga0501036_0019828 Ga0501036_0019828_4299_4808 169
260 3300049572 Ga0501036_0193741 Ga0501036_0193741_632_1144 169
261 3300049573 Ga0501037_0019421 Ga0501037_0019421_2741_3250 169
262 3300049573 Ga0501037_0027488 Ga0501037_0027488_2885_3397 169
263 3300049573 Ga0501037_0562427 Ga0501037_0562427_61_570 169
264 3300049574 Ga0501038_0018768 Ga0501038_0018768_1349_1858 169
265 3300049574 Ga0501038_0226698 Ga0501038_0226698_749_1258 169
266 3300049574 Ga0501038_0348650 Ga0501038_0348650_35_544 169
267 3300049575 Ga0501039_0034845 Ga0501039_0034845_596_1105 169
268 3300049579 Ga0501043_0005813 Ga0501043_0005813_3855_4364 169
269 3300049579 Ga0501043_0027261 Ga0501043_0027261_224_736 169
270 3300049579 Ga0501043_0151476 Ga0501043_0151476_486_995 169
271 3300049580 Ga0501046_0002196 Ga0501046_0002196_15423_15932 169
272 3300049580 Ga0501046_0066667 Ga0501046_0066667_529_1041 169
273 3300049580 Ga0501046_0068504 Ga0501046_0068504_1663_2175 169
274 3300049581 Ga0501047_0135343 Ga0501047_0135343_997_1506 169
275 3300049581 Ga0501047_0180256 Ga0501047_0180256_301_813 169
276 3300049582 Ga0501048_0001595 Ga0501048_0001595_4977_5486 169
277 3300049583 Ga0501067_0002120 Ga0501067_0002120_7792_8301 169
278 3300049585 Ga0501069_0005271 Ga0501069_0005271_4088_4597 169
279 3300049586 Ga0501070_0007693 Ga0501070_0007693_6987_7496 169
280 3300049588 Ga0501072_0023730 Ga0501072_0023730_3402_3911 169
281 3300049589 Ga0501073_0041007 Ga0501073_0041007_1735_2244 169
282 3300049589 Ga0501073_0185959 Ga0501073_0185959_26_535 169
283 3300049590 Ga0501074_0006923 Ga0501074_0006923_3985_4494 169
284 3300049592 Ga0501076_0140467 Ga0501076_0140467_604_1113 169
285 3300049741 Ga0501079_0017694 Ga0501079_0017694_1585_2094 169
286 3300049742 Ga0501080_0063730 Ga0501080_0063730_417_926 169
287 3300049742 Ga0501080_0220922 Ga0501080_0220922_708_1217 169
288 3300049742 Ga0501080_0638584 Ga0501080_0638584_390_902 169
289 3300049744 Ga0501083_0012369 Ga0501083_0012369_104_613 169
290 3300049822 Ga0501035_0102792 Ga0501035_0102792_945_1457 169
291 3300049822 Ga0501035_0164015 Ga0501035_0164015_997_1506 169
292 3300049822 Ga0501035_0433783 Ga0501035_0433783_274_783 169
293 3300049823 Ga0501044_0047692 Ga0501044_0047692_2765_3274 169
294 3300049823 Ga0501044_0078571 Ga0501044_0078571_1838_2350 169
295 3300049823 Ga0501044_0406472 Ga0501044_0406472_63_572 169
296 3300053088 Ga0500644_0304027 Ga0500644_0304027_158_673 169
297 3300053094 Ga0500566_0372756 Ga0500566_0372756_40_549 169
298 3300053098 Ga0500650_0395297 Ga0500650_0395297_39_548 169
299 3300053118 Ga0500594_0056065 Ga0500594_0056065_18_527 169
300 3300053119 Ga0500595_054709 Ga0500595_054709_214_723 169
301 3300053120 Ga0500597_062620 Ga0500597_062620_78_587 169
302 3300053130 Ga0500642_0077175 Ga0500642_0077175_741_1250 169
303 3300053139 Ga0500568_0137526 Ga0500568_0137526_263_772 169
304 3300053163 Ga0500639_146681 Ga0500639_146681_318_827 169
305 3300053177 Ga0500636_0318539 Ga0500636_0318539_150_659 169
306 3300054114 Ga0501084_0021827 Ga0501084_0021827_1627_2136 169
307 3300060353 Ga0501082_0039274 Ga0501082_0039274_874_1383 169
308 3300031238 Ga0265332_10141750 Ga0265332_101417502 170
309 3300031242 Ga0265329_10023000 Ga0265329_100230002 170
310 3300031344 Ga0265316_10308281 Ga0265316_103082812 170
311 3300031730 Ga0307516_10086492 Ga0307516_100864922 171
312 3300005577 Ga0068857_100026423 Ga0068857_1000264232 172
313 3300005844 Ga0068862_100052027 Ga0068862_1000520273 172
314 3300013307 Ga0157372_12330939 Ga0157372_123309392 172
315 3300025924 Ga0207694_10149311 Ga0207694_101493112 172
316 3300025972 Ga0207668_10102022 Ga0207668_101020223 172
317 3300026116 Ga0207674_10040418 Ga0207674_100404182 172
318 3300028380 Ga0268265_10305547 Ga0268265_103055472 172
319 3300031249 Ga0265339_10162401 Ga0265339_101624012 172
320 3300031711 Ga0265314_10205980 Ga0265314_102059802 172
321 3300048088 Ga0495602_0275398 Ga0495602_0275398_385_903 172
322 3300053087 Ga0500643_000014 Ga0500643_000014_212110_212628 172
323 3300053103 Ga0500555_036129 Ga0500555_036129_520_1038 172
324 3300053119 Ga0500595_087748 Ga0500595_087748_351_869 172
325 3300013297 Ga0157378_11761577 Ga0157378_117615772 173
326 3300013308 Ga0157375_11236401 Ga0157375_112364012 173
327 3300021384 Ga0213876_10001860 Ga0213876_1000186011 173
328 3300003214 JGI25165J46597_1000013 JGI25165J46597_10000139 174
329 3300005335 Ga0070666_10148892 Ga0070666_101488923 174
330 3300005337 Ga0070682_100768151 Ga0070682_1007681511 174
331 3300005344 Ga0070661_100003375 Ga0070661_1000033757 174
332 3300005354 Ga0070675_100721391 Ga0070675_1007213912 174
333 3300005458 Ga0070681_10893696 Ga0070681_108936962 174
334 3300005530 Ga0070679_100108925 Ga0070679_1001089252 174
335 3300005539 Ga0068853_100194499 Ga0068853_1001944992 174
336 3300005548 Ga0070665_100014524 Ga0070665_1000145245 174
337 3300005618 Ga0068864_100097024 Ga0068864_1000970241 174
338 3300005618 Ga0068864_102034940 Ga0068864_1020349401 174
339 3300005843 Ga0068860_100007909 Ga0068860_1000079092 174
340 3300006237 Ga0097621_100000004 Ga0097621_10000000442 174
341 3300006237 Ga0097621_100050804 Ga0097621_1000508045 174
342 3300006358 Ga0068871_100000028 Ga0068871_1000000283 174
343 3300006358 Ga0068871_100039943 Ga0068871_1000399432 174
344 3300006358 Ga0068871_101381821 Ga0068871_1013818211 174
345 3300009174 Ga0105241_10044486 Ga0105241_100444863 174
346 3300009176 Ga0105242_10058055 Ga0105242_100580553 174
347 3300009545 Ga0105237_10533353 Ga0105237_105333532 174
348 3300009551 Ga0105238_10088964 Ga0105238_100889642 174
349 3300011119 Ga0105246_10593327 Ga0105246_105933271 174
350 3300014325 Ga0163163_10000111 Ga0163163_1000011133 174
351 3300014968 Ga0157379_10000904 Ga0157379_100009042 174
352 3300014969 Ga0157376_10420045 Ga0157376_104200452 174
353 3300025261 Ga0209233_1000013 Ga0209233_1000013264 174
354 3300025893 Ga0207682_10281163 Ga0207682_102811632 174
355 3300025903 Ga0207680_10186325 Ga0207680_101863252 174
356 3300025909 Ga0207705_10132281 Ga0207705_101322813 174
357 3300025911 Ga0207654_10002467 Ga0207654_100024679 174
358 3300025913 Ga0207695_10282504 Ga0207695_102825042 174
359 3300025914 Ga0207671_10363350 Ga0207671_103633502 174
360 3300025919 Ga0207657_10045311 Ga0207657_100453114 174
361 3300025920 Ga0207649_10000073 Ga0207649_1000007312 174
362 3300025921 Ga0207652_10104136 Ga0207652_101041363 174
363 3300025924 Ga0207694_10568488 Ga0207694_105684882 174
364 3300025926 Ga0207659_10532636 Ga0207659_105326362 174
365 3300025934 Ga0207686_10015854 Ga0207686_100158543 174
366 3300025942 Ga0207689_10233103 Ga0207689_102331032 174
367 3300026041 Ga0207639_10039705 Ga0207639_100397054 174
368 3300026067 Ga0207678_10248217 Ga0207678_102482173 174
369 3300026095 Ga0207676_10053359 Ga0207676_100533592 174
370 3300028381 Ga0268264_10153274 Ga0268264_101532742 174
371 3300028800 Ga0265338_10043723 Ga0265338_100437234 174
372 3300031238 Ga0265332_10025264 Ga0265332_100252642 174
373 3300031241 Ga0265325_10004925 Ga0265325_100049256 174
374 3300031249 Ga0265339_10009825 Ga0265339_100098255 174
375 3300031250 Ga0265331_10000823 Ga0265331_1000082312 174
376 3300031251 Ga0265327_10000074 Ga0265327_10000074133 174
377 3300031344 Ga0265316_10050999 Ga0265316_100509995 174
378 3300031595 Ga0265313_10008006 Ga0265313_100080065 174
379 3300031711 Ga0265314_10065200 Ga0265314_100652002 174
380 3300031711 Ga0265314_10076858 Ga0265314_100768582 174
381 3300031711 Ga0265314_10209975 Ga0265314_102099752 174
382 3300031712 Ga0265342_10228314 Ga0265342_102283142 174
383 3300031712 Ga0265342_10293623 Ga0265342_102936231 174
384 3300031730 Ga0307516_10075012 Ga0307516_100750124 174
385 3300046454 Ga0495592_0188789 Ga0495592_0188789_322_846 174
386 3300046543 Ga0495645_0248037 Ga0495645_0248037_617_1174 174
387 3300046557 Ga0495622_0011212 Ga0495622_0011212_2402_2926 174
388 3300046675 Ga0495657_0143026 Ga0495657_0143026_37_561 174
389 3300046694 Ga0495649_0042200 Ga0495649_0042200_1937_2461 174
390 3300046809 Ga0495600_0242670 Ga0495600_0242670_185_742 174
391 3300047323 Ga0495683_0168356 Ga0495683_0168356_426_950 174
392 3300048924 Ga0496121_0002103 Ga0496121_0002103_30255_30779 174
393 3300049569 Ga0501032_0114470 Ga0501032_0114470_943_1485 174
394 3300049570 Ga0501033_0005872 Ga0501033_0005872_6736_7278 174
395 3300049571 Ga0501034_0856060 Ga0501034_0856060_101_628 174
396 3300049571 Ga0501034_1212180 Ga0501034_1212180_43_585 174
397 3300049572 Ga0501036_0661431 Ga0501036_0661431_158_700 174
398 3300049573 Ga0501037_0420433 Ga0501037_0420433_179_721 174
399 3300049574 Ga0501038_0037225 Ga0501038_0037225_2217_2759 174
400 3300049580 Ga0501046_0272575 Ga0501046_0272575_559_1101 174
401 3300049580 Ga0501046_0372038 Ga0501046_0372038_461_1003 174
402 3300049581 Ga0501047_0054734 Ga0501047_0054734_1073_1615 174
403 3300049584 Ga0501068_0033835 Ga0501068_0033835_1089_1631 174
404 3300049589 Ga0501073_0486902 Ga0501073_0486902_133_675 174
405 3300049742 Ga0501080_0289771 Ga0501080_0289771_118_660 174
406 3300049744 Ga0501083_0037466 Ga0501083_0037466_2362_2889 174
407 3300049822 Ga0501035_0204603 Ga0501035_0204603_130_672 174
408 3300049823 Ga0501044_0058863 Ga0501044_0058863_2370_2912 174
409 3300053119 Ga0500595_000390 Ga0500595_000390_19766_20290 174
410 3300053119 Ga0500595_021288 Ga0500595_021288_95_619 174
411 3300053735 Ga0500596_023331 Ga0500596_023331_234_758 174
412 3300060353 Ga0501082_0007310 Ga0501082_0007310_2052_2579 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

22

156

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b7d-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine 0.9696 10 171
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9676 10 171
3l93-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from yersinia pestis. 0.9664 11 169
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9662 11 170
6g6v-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. 0.964 11 169
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.956 11 170 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9495 11 169 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9491 11 170 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9446 8 170 3.40.50.620
3nd7D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9377 10 168 3.40.50.620
ID Description Score Start End GO Terms
AF-A5V280-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9842 11 174 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A5FXQ8-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9803 10 171 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A7G9SKH7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9795 11 171 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A3A0EP61-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9794 9 173 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-B8GVE7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.979 11 172 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
88.15 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map