F437894
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 412 | 233 | 412 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300046543|Ga0495645_0248037|Ga0495645_0248037_617_1174 |
| Length | 185 |
| Sequence | VTSSNKSERGRLEITRAPLVGLYPGTFDPATLGHLDIIKRAVKLVDHLVIGVATNASKSPLFTLDERMEIMHHEAEKMAEGRATIEVLPVSEVLMVDFAKSIGATVVIRGLRAVSDFEYEFQMAAMNQRLNMEIETVVLMADPRMQAIASKLVKEIAILGGDVKPFTSPYVAERLSKRAKEQANR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 37 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 38 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 39 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 40 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 131 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 132 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 134 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 138 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 142 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 143 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 145 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 147 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 152 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 153 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 154 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 155 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 157 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 158 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 183 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 209 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 210 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 211 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 212 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 213 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 214 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 215 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 216 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 217 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 218 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 219 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 220 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 221 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 222 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 223 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 224 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 225 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 226 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 227 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 228 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 229 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 230 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 231 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 232 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.17 |
| Nodule | 0 |
| Rhizoplane | 0.73 |
| Rhizosphere | 84.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000013 | 3300003214 | Bacteria | 402100 |
| 2 | JGI25153J46596_10003018 | 3300003215 | Bacteria | 9527 |
| 3 | Ga0070658_10042656 | 3300005327 | Bacteria | 3664 |
| 4 | Ga0070658_10051759 | 3300005327 | Bacteria | 3328 |
| 5 | Ga0070658_10240932 | 3300005327 | Bacteria | 1533 |
| 6 | Ga0070683_100113131 | 3300005329 | Bacteria | 2561 |
| 7 | Ga0070690_100254800 | 3300005330 | Bacteria | 1243 |
| 8 | Ga0070666_10125769 | 3300005335 | Bacteria | 1780 |
| 9 | Ga0070666_10148892 | 3300005335 | Bacteria | 1633 |
| 10 | Ga0070680_100723335 | 3300005336 | Bacteria | 857 |
| 11 | Ga0070682_100768151 | 3300005337 | Bacteria | 780 |
| 12 | Ga0068868_100020987 | 3300005338 | Bacteria | 4918 |
| 13 | Ga0068868_101001213 | 3300005338 | Bacteria | 764 |
| 14 | Ga0070660_100308699 | 3300005339 | Bacteria | 1298 |
| 15 | Ga0070661_100003375 | 3300005344 | Bacteria | 11008 |
| 16 | Ga0070661_100242047 | 3300005344 | Bacteria | 1390 |
| 17 | Ga0070668_100226279 | 3300005347 | Bacteria | 1545 |
| 18 | Ga0070675_100721391 | 3300005354 | Bacteria | 909 |
| 19 | Ga0070671_100182508 | 3300005355 | Bacteria | 1777 |
| 20 | Ga0070674_100196003 | 3300005356 | Bacteria | 1556 |
| 21 | Ga0070674_100691522 | 3300005356 | Bacteria | 871 |
| 22 | Ga0070659_100199772 | 3300005366 | Bacteria | 1645 |
| 23 | Ga0070667_100030043 | 3300005367 | Bacteria | 4532 |
| 24 | Ga0070667_101118043 | 3300005367 | Bacteria | 737 |
| 25 | Ga0070667_101431068 | 3300005367 | Bacteria | 648 |
| 26 | Ga0070714_100241269 | 3300005435 | Bacteria | 1668 |
| 27 | Ga0070714_101350416 | 3300005435 | Bacteria | 696 |
| 28 | Ga0070710_10636233 | 3300005437 | Bacteria | 746 |
| 29 | Ga0070711_100132904 | 3300005439 | Bacteria | 1856 |
| 30 | Ga0070681_10893696 | 3300005458 | Bacteria | 807 |
| 31 | Ga0070681_11465611 | 3300005458 | Bacteria | 607 |
| 32 | Ga0070679_100108925 | 3300005530 | Bacteria | 2756 |
| 33 | Ga0070684_100025863 | 3300005535 | Bacteria | 4938 |
| 34 | Ga0068853_100151736 | 3300005539 | Bacteria | 2086 |
| 35 | Ga0068853_100194499 | 3300005539 | Bacteria | 1844 |
| 36 | Ga0070665_100014524 | 3300005548 | Bacteria | 7900 |
| 37 | Ga0070665_100180637 | 3300005548 | Bacteria | 2111 |
| 38 | Ga0070665_100317342 | 3300005548 | Bacteria | 1562 |
| 39 | Ga0070665_100745398 | 3300005548 | Bacteria | 992 |
| 40 | Ga0068855_100062730 | 3300005563 | Bacteria | 4338 |
| 41 | Ga0068855_100100880 | 3300005563 | Bacteria | 3323 |
| 42 | Ga0068855_100308437 | 3300005563 | Bacteria | 1751 |
| 43 | Ga0068857_100026423 | 3300005577 | Bacteria | 5117 |
| 44 | Ga0068857_100324696 | 3300005577 | Bacteria | 1422 |
| 45 | Ga0068856_100415548 | 3300005614 | Bacteria | 1365 |
| 46 | Ga0068856_100785812 | 3300005614 | Bacteria | 972 |
| 47 | Ga0068856_100879184 | 3300005614 | Bacteria | 915 |
| 48 | Ga0068859_101283338 | 3300005617 | Bacteria | 807 |
| 49 | Ga0068864_100097024 | 3300005618 | Bacteria | 2609 |
| 50 | Ga0068864_102034940 | 3300005618 | Bacteria | 580 |
| 51 | Ga0068861_100043871 | 3300005719 | Bacteria | 3360 |
| 52 | Ga0068863_100037524 | 3300005841 | Bacteria | 4613 |
| 53 | Ga0068858_100092535 | 3300005842 | Bacteria | 2815 |
| 54 | Ga0068858_100126240 | 3300005842 | Bacteria | 2396 |
| 55 | Ga0068860_100007909 | 3300005843 | Bacteria | 10615 |
| 56 | Ga0068862_100052027 | 3300005844 | Bacteria | 3503 |
| 57 | Ga0068862_101242549 | 3300005844 | Bacteria | 745 |
| 58 | Ga0075365_10013719 | 3300006038 | Bacteria | 4859 |
| 59 | Ga0075365_10075103 | 3300006038 | Bacteria | 2280 |
| 60 | Ga0075368_10000440 | 3300006042 | Bacteria | 12241 |
| 61 | Ga0075363_100000965 | 3300006048 | Bacteria | 10222 |
| 62 | Ga0075364_10001672 | 3300006051 | Bacteria | 12176 |
| 63 | Ga0070716_100840698 | 3300006173 | Bacteria | 714 |
| 64 | Ga0075362_10000905 | 3300006177 | Bacteria | 8980 |
| 65 | Ga0075367_10005181 | 3300006178 | Bacteria | 6443 |
| 66 | Ga0075369_10003725 | 3300006186 | Bacteria | 5577 |
| 67 | Ga0075366_10000526 | 3300006195 | Bacteria | 17747 |
| 68 | Ga0097621_100000004 | 3300006237 | Bacteria | 144414 |
| 69 | Ga0097621_100050804 | 3300006237 | Bacteria | 3373 |
| 70 | Ga0097621_100054697 | 3300006237 | Bacteria | 3256 |
| 71 | Ga0097621_100106936 | 3300006237 | Bacteria | 2360 |
| 72 | Ga0097621_100768744 | 3300006237 | Bacteria | 891 |
| 73 | Ga0075370_10009230 | 3300006353 | Bacteria | 5111 |
| 74 | Ga0068871_100000028 | 3300006358 | Bacteria | 78414 |
| 75 | Ga0068871_100039943 | 3300006358 | Bacteria | 3757 |
| 76 | Ga0068871_100051672 | 3300006358 | Bacteria | 3328 |
| 77 | Ga0068871_100058907 | 3300006358 | Bacteria | 3128 |
| 78 | Ga0068871_100209463 | 3300006358 | Bacteria | 1686 |
| 79 | Ga0068871_100994823 | 3300006358 | Bacteria | 781 |
| 80 | Ga0068871_101381821 | 3300006358 | Bacteria | 663 |
| 81 | Ga0068865_100004725 | 3300006881 | Bacteria | 8224 |
| 82 | Ga0097620_101283560 | 3300006931 | Bacteria | 807 |
| 83 | Ga0105240_10012030 | 3300009093 | Bacteria | 11996 |
| 84 | Ga0105240_10688043 | 3300009093 | Bacteria | 1117 |
| 85 | Ga0105240_11295699 | 3300009093 | Bacteria | 769 |
| 86 | Ga0105240_11770644 | 3300009093 | Bacteria | 644 |
| 87 | Ga0111539_10191349 | 3300009094 | Bacteria | 2387 |
| 88 | Ga0105245_11176369 | 3300009098 | Bacteria | 814 |
| 89 | Ga0105245_11202249 | 3300009098 | Bacteria | 806 |
| 90 | Ga0105243_10561668 | 3300009148 | Bacteria | 1092 |
| 91 | Ga0105241_10044486 | 3300009174 | Bacteria | 3365 |
| 92 | Ga0105241_10130822 | 3300009174 | Bacteria | 2032 |
| 93 | Ga0105241_10353971 | 3300009174 | Bacteria | 1276 |
| 94 | Ga0105242_10010671 | 3300009176 | Bacteria | 7050 |
| 95 | Ga0105242_10058055 | 3300009176 | Bacteria | 3171 |
| 96 | Ga0105242_11052766 | 3300009176 | Bacteria | 825 |
| 97 | Ga0105248_10024136 | 3300009177 | Bacteria | 6758 |
| 98 | Ga0105248_10598479 | 3300009177 | Bacteria | 1244 |
| 99 | Ga0105248_11347772 | 3300009177 | Bacteria | 807 |
| 100 | Ga0105248_12244001 | 3300009177 | Bacteria | 621 |
| 101 | Ga0105237_10068601 | 3300009545 | Bacteria | 3539 |
| 102 | Ga0105237_10212456 | 3300009545 | Bacteria | 1934 |
| 103 | Ga0105237_10533353 | 3300009545 | Bacteria | 1180 |
| 104 | Ga0105237_11241600 | 3300009545 | Bacteria | 752 |
| 105 | Ga0105238_10088964 | 3300009551 | Bacteria | 3075 |
| 106 | Ga0105238_10247120 | 3300009551 | Bacteria | 1762 |
| 107 | Ga0105238_10776911 | 3300009551 | Bacteria | 973 |
| 108 | Ga0105238_10812232 | 3300009551 | Bacteria | 951 |
| 109 | Ga0105238_11422515 | 3300009551 | Bacteria | 721 |
| 110 | Ga0105249_10400158 | 3300009553 | Bacteria | 1403 |
| 111 | Ga0099796_10018756 | 3300010159 | Bacteria | 2084 |
| 112 | Ga0105239_10266624 | 3300010375 | Bacteria | 1925 |
| 113 | Ga0105239_10503914 | 3300010375 | Bacteria | 1376 |
| 114 | Ga0105239_11114824 | 3300010375 | Bacteria | 908 |
| 115 | Ga0105239_11901294 | 3300010375 | Bacteria | 690 |
| 116 | Ga0105239_12135166 | 3300010375 | Bacteria | 651 |
| 117 | Ga0105246_10593327 | 3300011119 | Bacteria | 956 |
| 118 | Ga0157373_10708270 | 3300013100 | Bacteria | 738 |
| 119 | Ga0157371_10506743 | 3300013102 | Bacteria | 892 |
| 120 | Ga0157369_10307772 | 3300013105 | Bacteria | 1648 |
| 121 | Ga0157374_11105176 | 3300013296 | Bacteria | 813 |
| 122 | Ga0157378_10009866 | 3300013297 | Bacteria | 8321 |
| 123 | Ga0157378_10664226 | 3300013297 | Bacteria | 1059 |
| 124 | Ga0157378_10696576 | 3300013297 | Bacteria | 1035 |
| 125 | Ga0157378_11761577 | 3300013297 | Bacteria | 667 |
| 126 | Ga0163162_10928447 | 3300013306 | Bacteria | 982 |
| 127 | Ga0163162_10989454 | 3300013306 | Bacteria | 951 |
| 128 | Ga0163162_11037858 | 3300013306 | Bacteria | 928 |
| 129 | Ga0157372_10003598 | 3300013307 | Bacteria | 16678 |
| 130 | Ga0157372_10032901 | 3300013307 | Bacteria | 5690 |
| 131 | Ga0157372_10046890 | 3300013307 | Bacteria | 4799 |
| 132 | Ga0157372_10132231 | 3300013307 | Bacteria | 2872 |
| 133 | Ga0157372_10357509 | 3300013307 | Bacteria | 1702 |
| 134 | Ga0157372_12330939 | 3300013307 | Unclassified | 615 |
| 135 | Ga0157375_10038943 | 3300013308 | Bacteria | 4569 |
| 136 | Ga0157375_11236401 | 3300013308 | Bacteria | 877 |
| 137 | Ga0163163_10000111 | 3300014325 | Bacteria | 86620 |
| 138 | Ga0163163_10198702 | 3300014325 | Bacteria | 2053 |
| 139 | Ga0163163_10698658 | 3300014325 | Bacteria | 1078 |
| 140 | Ga0163163_11711168 | 3300014325 | Bacteria | 689 |
| 141 | Ga0157380_10347511 | 3300014326 | Bacteria | 1386 |
| 142 | Ga0157379_10000904 | 3300014968 | Bacteria | 24009 |
| 143 | Ga0157376_10025599 | 3300014969 | Bacteria | 4650 |
| 144 | Ga0157376_10413328 | 3300014969 | Bacteria | 1307 |
| 145 | Ga0157376_10420045 | 3300014969 | Bacteria | 1297 |
| 146 | Ga0157376_10511709 | 3300014969 | Bacteria | 1182 |
| 147 | Ga0157376_11257713 | 3300014969 | Bacteria | 769 |
| 148 | Ga0163161_10184912 | 3300017792 | Bacteria | 1599 |
| 149 | Ga0213874_10007393 | 3300021377 | Bacteria | 2635 |
| 150 | Ga0213876_10000225 | 3300021384 | Bacteria | 56051 |
| 151 | Ga0213876_10001860 | 3300021384 | Bacteria | 12707 |
| 152 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 153 | Ga0209233_1000964 | 3300025261 | Bacteria | 12429 |
| 154 | Ga0209758_1000036 | 3300025297 | Bacteria | 441671 |
| 155 | Ga0209758_1035611 | 3300025297 | Bacteria | 1959 |
| 156 | Ga0207682_10281163 | 3300025893 | Bacteria | 778 |
| 157 | Ga0207642_10129097 | 3300025899 | Bacteria | 1316 |
| 158 | Ga0207680_10186325 | 3300025903 | Bacteria | 1406 |
| 159 | Ga0207705_10028609 | 3300025909 | Bacteria | 3973 |
| 160 | Ga0207705_10132281 | 3300025909 | Bacteria | 1857 |
| 161 | Ga0207654_10002467 | 3300025911 | Bacteria | 9403 |
| 162 | Ga0207707_11006322 | 3300025912 | Bacteria | 684 |
| 163 | Ga0207695_10052612 | 3300025913 | Bacteria | 4264 |
| 164 | Ga0207695_10053055 | 3300025913 | Bacteria | 4243 |
| 165 | Ga0207695_10164623 | 3300025913 | Bacteria | 2147 |
| 166 | Ga0207695_10282504 | 3300025913 | Bacteria | 1553 |
| 167 | Ga0207671_10058895 | 3300025914 | Bacteria | 2848 |
| 168 | Ga0207671_10363350 | 3300025914 | Bacteria | 1149 |
| 169 | Ga0207657_10045311 | 3300025919 | Bacteria | 3861 |
| 170 | Ga0207657_10110733 | 3300025919 | Bacteria | 2268 |
| 171 | Ga0207649_10000073 | 3300025920 | Bacteria | 86636 |
| 172 | Ga0207652_10104136 | 3300025921 | Bacteria | 2510 |
| 173 | Ga0207652_10249463 | 3300025921 | Bacteria | 1601 |
| 174 | Ga0207694_10149311 | 3300025924 | Bacteria | 1882 |
| 175 | Ga0207694_10568488 | 3300025924 | Bacteria | 952 |
| 176 | Ga0207694_10652967 | 3300025924 | Bacteria | 886 |
| 177 | Ga0207694_10873713 | 3300025924 | Bacteria | 760 |
| 178 | Ga0207650_10929218 | 3300025925 | Bacteria | 739 |
| 179 | Ga0207659_10532636 | 3300025926 | Bacteria | 997 |
| 180 | Ga0207687_10417885 | 3300025927 | Bacteria | 1106 |
| 181 | Ga0207664_10204331 | 3300025929 | Bacteria | 1707 |
| 182 | Ga0207664_10739535 | 3300025929 | Bacteria | 885 |
| 183 | Ga0207644_10396162 | 3300025931 | Bacteria | 1128 |
| 184 | Ga0207690_10076015 | 3300025932 | Bacteria | 2331 |
| 185 | Ga0207706_10974168 | 3300025933 | Bacteria | 714 |
| 186 | Ga0207686_10014940 | 3300025934 | Bacteria | 4333 |
| 187 | Ga0207686_10015854 | 3300025934 | Bacteria | 4223 |
| 188 | Ga0207686_10413273 | 3300025934 | Bacteria | 1030 |
| 189 | Ga0207709_11190700 | 3300025935 | Bacteria | 628 |
| 190 | Ga0207669_10294117 | 3300025937 | Bacteria | 1231 |
| 191 | Ga0207704_10072895 | 3300025938 | Bacteria | 2185 |
| 192 | Ga0207704_10139205 | 3300025938 | Bacteria | 1695 |
| 193 | Ga0207691_10241027 | 3300025940 | Bacteria | 1563 |
| 194 | Ga0207711_10046724 | 3300025941 | Bacteria | 3699 |
| 195 | Ga0207711_10721432 | 3300025941 | Bacteria | 930 |
| 196 | Ga0207689_10233103 | 3300025942 | Bacteria | 1521 |
| 197 | Ga0207661_10443714 | 3300025944 | Bacteria | 1181 |
| 198 | Ga0207679_10133854 | 3300025945 | Bacteria | 1993 |
| 199 | Ga0207667_10138834 | 3300025949 | Bacteria | 2502 |
| 200 | Ga0207667_10148405 | 3300025949 | Bacteria | 2414 |
| 201 | Ga0207667_10370059 | 3300025949 | Bacteria | 1460 |
| 202 | Ga0207651_10526933 | 3300025960 | Bacteria | 1025 |
| 203 | Ga0207712_10816830 | 3300025961 | Bacteria | 820 |
| 204 | Ga0207668_10102022 | 3300025972 | Bacteria | 2134 |
| 205 | Ga0207668_11107731 | 3300025972 | Bacteria | 710 |
| 206 | Ga0207658_10450449 | 3300025986 | Bacteria | 1139 |
| 207 | Ga0207677_10394635 | 3300026023 | Bacteria | 1172 |
| 208 | Ga0207703_10012145 | 3300026035 | Bacteria | 6712 |
| 209 | Ga0207703_10188910 | 3300026035 | Bacteria | 1823 |
| 210 | Ga0207639_10039705 | 3300026041 | Bacteria | 3508 |
| 211 | Ga0207639_10456432 | 3300026041 | Bacteria | 1161 |
| 212 | Ga0207639_10546747 | 3300026041 | Bacteria | 1063 |
| 213 | Ga0207678_10248217 | 3300026067 | Bacteria | 1524 |
| 214 | Ga0207702_10445162 | 3300026078 | Bacteria | 1256 |
| 215 | Ga0207702_10770394 | 3300026078 | Bacteria | 950 |
| 216 | Ga0207702_10809718 | 3300026078 | Bacteria | 926 |
| 217 | Ga0207641_10010540 | 3300026088 | Bacteria | 7585 |
| 218 | Ga0207641_11840447 | 3300026088 | Bacteria | 607 |
| 219 | Ga0207676_10053359 | 3300026095 | Bacteria | 3164 |
| 220 | Ga0207676_11145877 | 3300026095 | Bacteria | 770 |
| 221 | Ga0207674_10040418 | 3300026116 | Bacteria | 4831 |
| 222 | Ga0207674_10211073 | 3300026116 | Bacteria | 1890 |
| 223 | Ga0207674_10276056 | 3300026116 | Bacteria | 1628 |
| 224 | Ga0207683_10047741 | 3300026121 | Bacteria | 3749 |
| 225 | Ga0209813_10000625 | 3300027866 | Bacteria | 8213 |
| 226 | Ga0268266_10108213 | 3300028379 | Bacteria | 2459 |
| 227 | Ga0268266_10156276 | 3300028379 | Bacteria | 2060 |
| 228 | Ga0268265_10305547 | 3300028380 | Bacteria | 1434 |
| 229 | Ga0268265_10335381 | 3300028380 | Bacteria | 1375 |
| 230 | Ga0268265_10688174 | 3300028380 | Bacteria | 987 |
| 231 | Ga0268264_10153274 | 3300028381 | Bacteria | 2068 |
| 232 | Ga0265318_10043625 | 3300028577 | Bacteria | 1699 |
| 233 | Ga0265338_10043723 | 3300028800 | Bacteria | 4149 |
| 234 | Ga0265338_10095701 | 3300028800 | Bacteria | 2438 |
| 235 | Ga0265330_10032648 | 3300031235 | Bacteria | 2332 |
| 236 | Ga0265332_10025264 | 3300031238 | Bacteria | 2610 |
| 237 | Ga0265332_10108831 | 3300031238 | Bacteria | 1168 |
| 238 | Ga0265332_10141750 | 3300031238 | Bacteria | 1007 |
| 239 | Ga0265328_10097955 | 3300031239 | Bacteria | 1085 |
| 240 | Ga0265325_10004925 | 3300031241 | Bacteria | 8327 |
| 241 | Ga0265325_10015770 | 3300031241 | Bacteria | 4240 |
| 242 | Ga0265329_10023000 | 3300031242 | Bacteria | 2080 |
| 243 | Ga0265340_10000021 | 3300031247 | Bacteria | 87640 |
| 244 | Ga0265340_10003362 | 3300031247 | Bacteria | 9050 |
| 245 | Ga0265340_10068658 | 3300031247 | Bacteria | 1683 |
| 246 | Ga0265339_10009825 | 3300031249 | Bacteria | 5977 |
| 247 | Ga0265339_10055770 | 3300031249 | Bacteria | 2142 |
| 248 | Ga0265339_10089270 | 3300031249 | Bacteria | 1618 |
| 249 | Ga0265339_10162401 | 3300031249 | Bacteria | 1123 |
| 250 | Ga0265331_10000006 | 3300031250 | Bacteria | 418907 |
| 251 | Ga0265331_10000823 | 3300031250 | Bacteria | 25431 |
| 252 | Ga0265331_10189889 | 3300031250 | Bacteria | 927 |
| 253 | Ga0265327_10000074 | 3300031251 | Bacteria | 214435 |
| 254 | Ga0265327_10031062 | 3300031251 | Bacteria | 3008 |
| 255 | Ga0265316_10002070 | 3300031344 | Bacteria | 21121 |
| 256 | Ga0265316_10049639 | 3300031344 | Bacteria | 3304 |
| 257 | Ga0265316_10050999 | 3300031344 | Bacteria | 3252 |
| 258 | Ga0265316_10308281 | 3300031344 | Bacteria | 1152 |
| 259 | Ga0265316_10380236 | 3300031344 | Bacteria | 1019 |
| 260 | Ga0265313_10008006 | 3300031595 | Bacteria | 7093 |
| 261 | Ga0265313_10063720 | 3300031595 | Bacteria | 1717 |
| 262 | Ga0265313_10118864 | 3300031595 | Bacteria | 1154 |
| 263 | Ga0265314_10000370 | 3300031711 | Bacteria | 61431 |
| 264 | Ga0265314_10065200 | 3300031711 | Bacteria | 2461 |
| 265 | Ga0265314_10076858 | 3300031711 | Bacteria | 2216 |
| 266 | Ga0265314_10205980 | 3300031711 | Bacteria | 1159 |
| 267 | Ga0265314_10209975 | 3300031711 | Bacteria | 1144 |
| 268 | Ga0265342_10052161 | 3300031712 | Bacteria | 2438 |
| 269 | Ga0265342_10228314 | 3300031712 | Bacteria | 1001 |
| 270 | Ga0265342_10293623 | 3300031712 | Bacteria | 858 |
| 271 | Ga0307516_10075012 | 3300031730 | Bacteria | 3237 |
| 272 | Ga0307516_10086492 | 3300031730 | Bacteria | 2971 |
| 273 | Ga0307507_10035940 | 3300033179 | Bacteria | 5076 |
| 274 | Ga0373943_0014593 | 3300035170 | Bacteria | 3560 |
| 275 | Ga0373946_0139774 | 3300035171 | Bacteria | 1121 |
| 276 | Ga0373935_0009238 | 3300035692 | Bacteria | 5901 |
| 277 | Ga0373947_0009411 | 3300035725 | Bacteria | 5613 |
| 278 | Ga0373925_0002583 | 3300037068 | Bacteria | 14402 |
| 279 | Ga0373925_0200239 | 3300037068 | Bacteria | 1588 |
| 280 | Ga0395900_0820690 | 3300037418 | Bacteria | 857 |
| 281 | Ga0395898_0178819 | 3300037466 | Bacteria | 2027 |
| 282 | Ga0395901_1304928 | 3300038443 | Bacteria | 687 |
| 283 | Ga0436365_0014930 | 3300039437 | Bacteria | 48249 |
| 284 | Ga0436365_0992819 | 3300039437 | Bacteria | 772 |
| 285 | Ga0436365_1698101 | 3300039437 | Bacteria | 2635 |
| 286 | Ga0436365_1793593 | 3300039437 | Bacteria | 726 |
| 287 | Ga0436361_1129526 | 3300039447 | Bacteria | 1029 |
| 288 | Ga0436363_0026865 | 3300039450 | Bacteria | 582 |
| 289 | Ga0436363_1287658 | 3300039450 | Bacteria | 1996 |
| 290 | Ga0436362_1114918 | 3300039453 | Bacteria | 811 |
| 291 | Ga0451793_0905697 | 3300041452 | Bacteria | 969 |
| 292 | Ga0451802_2127313 | 3300041460 | Bacteria | 985 |
| 293 | Ga0466967_0623967 | 3300045976 | Bacteria | 1065 |
| 294 | Ga0495617_133260 | 3300046452 | Bacteria | 796 |
| 295 | Ga0495592_0188789 | 3300046454 | Bacteria | 1398 |
| 296 | Ga0495650_0055472 | 3300046471 | Bacteria | 1612 |
| 297 | Ga0495580_0003681 | 3300046472 | Bacteria | 13002 |
| 298 | Ga0495639_0194789 | 3300046475 | Bacteria | 990 |
| 299 | Ga0495585_0155984 | 3300046492 | Bacteria | 1188 |
| 300 | Ga0495618_0784459 | 3300046514 | Bacteria | 556 |
| 301 | Ga0495648_0295686 | 3300046524 | Bacteria | 761 |
| 302 | Ga0495665_0153390 | 3300046531 | Bacteria | 1202 |
| 303 | Ga0495609_0007772 | 3300046538 | Bacteria | 5314 |
| 304 | Ga0495621_0013772 | 3300046539 | Bacteria | 2547 |
| 305 | Ga0495645_0248037 | 3300046543 | Bacteria | 1185 |
| 306 | Ga0495622_0011212 | 3300046557 | Bacteria | 4138 |
| 307 | Ga0495656_0066625 | 3300046615 | Bacteria | 1587 |
| 308 | Ga0495657_0143026 | 3300046675 | Bacteria | 1490 |
| 309 | Ga0495658_0006807 | 3300046683 | Bacteria | 5627 |
| 310 | Ga0495658_0130522 | 3300046683 | Bacteria | 1529 |
| 311 | Ga0495649_0042200 | 3300046694 | Bacteria | 2493 |
| 312 | Ga0495589_0132521 | 3300046794 | Bacteria | 1196 |
| 313 | Ga0495600_0242670 | 3300046809 | Bacteria | 1148 |
| 314 | Ga0495636_0018305 | 3300047318 | Bacteria | 2810 |
| 315 | Ga0495674_0557773 | 3300047319 | Bacteria | 911 |
| 316 | Ga0495683_0168356 | 3300047323 | Bacteria | 1009 |
| 317 | Ga0495602_0275398 | 3300048088 | Bacteria | 1242 |
| 318 | Ga0496100_0570477 | 3300048903 | Bacteria | 877 |
| 319 | Ga0496121_0002103 | 3300048924 | Bacteria | 31338 |
| 320 | Ga0501031_0020259 | 3300049568 | Bacteria | 4336 |
| 321 | Ga0501031_0790913 | 3300049568 | Bacteria | 608 |
| 322 | Ga0501032_0010031 | 3300049569 | Bacteria | 6838 |
| 323 | Ga0501032_0114470 | 3300049569 | Bacteria | 1784 |
| 324 | Ga0501033_0005872 | 3300049570 | Bacteria | 9648 |
| 325 | Ga0501033_0025987 | 3300049570 | Bacteria | 4406 |
| 326 | Ga0501033_0086134 | 3300049570 | Bacteria | 2300 |
| 327 | Ga0501033_0359283 | 3300049570 | Bacteria | 1019 |
| 328 | Ga0501034_0091345 | 3300049571 | Bacteria | 3042 |
| 329 | Ga0501034_0856060 | 3300049571 | Bacteria | 799 |
| 330 | Ga0501034_1212180 | 3300049571 | Bacteria | 633 |
| 331 | Ga0501036_0019828 | 3300049572 | Bacteria | 5646 |
| 332 | Ga0501036_0193741 | 3300049572 | Bacteria | 1710 |
| 333 | Ga0501036_0661431 | 3300049572 | Bacteria | 864 |
| 334 | Ga0501037_0019421 | 3300049573 | Bacteria | 5012 |
| 335 | Ga0501037_0027488 | 3300049573 | Bacteria | 4203 |
| 336 | Ga0501037_0420433 | 3300049573 | Bacteria | 915 |
| 337 | Ga0501037_0562427 | 3300049573 | Bacteria | 769 |
| 338 | Ga0501038_0018768 | 3300049574 | Bacteria | 6243 |
| 339 | Ga0501038_0037225 | 3300049574 | Bacteria | 4267 |
| 340 | Ga0501038_0226698 | 3300049574 | Bacteria | 1489 |
| 341 | Ga0501038_0348650 | 3300049574 | Bacteria | 1153 |
| 342 | Ga0501038_0862456 | 3300049574 | Bacteria | 670 |
| 343 | Ga0501039_0034845 | 3300049575 | Bacteria | 3884 |
| 344 | Ga0501043_0005813 | 3300049579 | Bacteria | 9923 |
| 345 | Ga0501043_0027261 | 3300049579 | Bacteria | 4486 |
| 346 | Ga0501043_0151476 | 3300049579 | Bacteria | 1815 |
| 347 | Ga0501046_0002196 | 3300049580 | Bacteria | 18436 |
| 348 | Ga0501046_0066667 | 3300049580 | Bacteria | 2805 |
| 349 | Ga0501046_0068504 | 3300049580 | Bacteria | 2762 |
| 350 | Ga0501046_0272575 | 3300049580 | Bacteria | 1241 |
| 351 | Ga0501046_0372038 | 3300049580 | Bacteria | 1035 |
| 352 | Ga0501047_0054734 | 3300049581 | Bacteria | 3859 |
| 353 | Ga0501047_0135343 | 3300049581 | Bacteria | 2344 |
| 354 | Ga0501047_0180256 | 3300049581 | Bacteria | 1979 |
| 355 | Ga0501048_0001595 | 3300049582 | Bacteria | 17213 |
| 356 | Ga0501067_0002120 | 3300049583 | Bacteria | 10922 |
| 357 | Ga0501068_0033835 | 3300049584 | Bacteria | 3046 |
| 358 | Ga0501069_0005271 | 3300049585 | Bacteria | 6717 |
| 359 | Ga0501070_0007693 | 3300049586 | Bacteria | 9139 |
| 360 | Ga0501072_0023730 | 3300049588 | Bacteria | 4765 |
| 361 | Ga0501073_0041007 | 3300049589 | Bacteria | 3272 |
| 362 | Ga0501073_0185959 | 3300049589 | Bacteria | 1438 |
| 363 | Ga0501073_0486902 | 3300049589 | Bacteria | 853 |
| 364 | Ga0501074_0006923 | 3300049590 | Bacteria | 8185 |
| 365 | Ga0501076_0140467 | 3300049592 | Bacteria | 1962 |
| 366 | Ga0501079_0017694 | 3300049741 | Bacteria | 5444 |
| 367 | Ga0501080_0063730 | 3300049742 | Bacteria | 3429 |
| 368 | Ga0501080_0220922 | 3300049742 | Bacteria | 1734 |
| 369 | Ga0501080_0289771 | 3300049742 | Bacteria | 1486 |
| 370 | Ga0501080_0638584 | 3300049742 | Bacteria | 943 |
| 371 | Ga0501083_0012369 | 3300049744 | Bacteria | 5972 |
| 372 | Ga0501083_0037466 | 3300049744 | Bacteria | 3303 |
| 373 | Ga0501035_0102792 | 3300049822 | Bacteria | 2507 |
| 374 | Ga0501035_0164015 | 3300049822 | Bacteria | 1922 |
| 375 | Ga0501035_0204603 | 3300049822 | Bacteria | 1691 |
| 376 | Ga0501035_0433783 | 3300049822 | Bacteria | 1089 |
| 377 | Ga0501044_0047692 | 3300049823 | Bacteria | 4430 |
| 378 | Ga0501044_0058863 | 3300049823 | Bacteria | 3938 |
| 379 | Ga0501044_0078571 | 3300049823 | Bacteria | 3343 |
| 380 | Ga0501044_0406472 | 3300049823 | Bacteria | 1273 |
| 381 | nmdc:mga03683_1393_c1 | 3300050489 | Bacteria | 7192 |
| 382 | nmdc:mga03n38_1069_c1 | 3300050490 | Bacteria | 7557 |
| 383 | nmdc:mga00v17_67378_c1 | 3300050491 | Bacteria | 2212 |
| 384 | nmdc:mga0yw44_8703_c1 | 3300050492 | Bacteria | 5076 |
| 385 | nmdc:mga0k408_18844_c1 | 3300050493 | Bacteria | 3853 |
| 386 | nmdc:mga06z11_1924_c1 | 3300050494 | Bacteria | 7832 |
| 387 | nmdc:mga06z11_392765_c1 | 3300050494 | Bacteria | 834 |
| 388 | nmdc:mga04h51_383_c1 | 3300050495 | Bacteria | 10752 |
| 389 | nmdc:mga07m45_426681_c1 | 3300050496 | Bacteria | 769 |
| 390 | Ga0500643_000014 | 3300053087 | Bacteria | 318249 |
| 391 | Ga0500644_0304027 | 3300053088 | Bacteria | 683 |
| 392 | Ga0500566_0372756 | 3300053094 | Bacteria | 647 |
| 393 | Ga0500641_0209479 | 3300053096 | Bacteria | 830 |
| 394 | Ga0500650_0395297 | 3300053098 | Bacteria | 599 |
| 395 | Ga0500555_036129 | 3300053103 | Bacteria | 1386 |
| 396 | Ga0500593_205750 | 3300053117 | Bacteria | 706 |
| 397 | Ga0500594_0021048 | 3300053118 | Bacteria | 1632 |
| 398 | Ga0500594_0056065 | 3300053118 | Bacteria | 1123 |
| 399 | Ga0500595_000390 | 3300053119 | Bacteria | 28255 |
| 400 | Ga0500595_021288 | 3300053119 | Bacteria | 2317 |
| 401 | Ga0500595_054709 | 3300053119 | Bacteria | 1224 |
| 402 | Ga0500595_087748 | 3300053119 | Bacteria | 904 |
| 403 | Ga0500597_062620 | 3300053120 | Bacteria | 1600 |
| 404 | Ga0500642_0077175 | 3300053130 | Bacteria | 1525 |
| 405 | Ga0500568_0137526 | 3300053139 | Bacteria | 906 |
| 406 | Ga0500616_0114683 | 3300053153 | Bacteria | 1296 |
| 407 | Ga0500639_146681 | 3300053163 | Bacteria | 1094 |
| 408 | Ga0500636_0318539 | 3300053177 | Bacteria | 757 |
| 409 | Ga0500596_023331 | 3300053735 | Bacteria | 938 |
| 410 | Ga0501084_0021827 | 3300054114 | Bacteria | 5340 |
| 411 | Ga0501082_0007310 | 3300060353 | Bacteria | 9530 |
| 412 | Ga0501082_0039274 | 3300060353 | Bacteria | 4083 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_1698101 | Ga0436365_1698101_1597_2055 | 152 |
| 2 | 3300025972 | Ga0207668_11107731 | Ga0207668_111077312 | 156 |
| 3 | 3300041460 | Ga0451802_2127313 | Ga0451802_2127313_408_890 | 158 |
| 4 | 3300006038 | Ga0075365_10013719 | Ga0075365_100137195 | 161 |
| 5 | 3300006038 | Ga0075365_10075103 | Ga0075365_100751032 | 161 |
| 6 | 3300006042 | Ga0075368_10000440 | Ga0075368_100004407 | 161 |
| 7 | 3300006048 | Ga0075363_100000965 | Ga0075363_1000009653 | 161 |
| 8 | 3300006051 | Ga0075364_10001672 | Ga0075364_100016727 | 161 |
| 9 | 3300006177 | Ga0075362_10000905 | Ga0075362_100009053 | 161 |
| 10 | 3300006178 | Ga0075367_10005181 | Ga0075367_100051816 | 161 |
| 11 | 3300006186 | Ga0075369_10003725 | Ga0075369_100037252 | 161 |
| 12 | 3300006195 | Ga0075366_10000526 | Ga0075366_1000052612 | 161 |
| 13 | 3300006353 | Ga0075370_10009230 | Ga0075370_100092304 | 161 |
| 14 | 3300013102 | Ga0157371_10506743 | Ga0157371_105067432 | 161 |
| 15 | 3300027866 | Ga0209813_10000625 | Ga0209813_100006253 | 161 |
| 16 | 3300033179 | Ga0307507_10035940 | Ga0307507_100359403 | 161 |
| 17 | 3300050489 | nmdc:mga03683_1393_c1 | nmdc:mga03683_1393_c1_5544_6035 | 161 |
| 18 | 3300050490 | nmdc:mga03n38_1069_c1 | nmdc:mga03n38_1069_c1_77_568 | 161 |
| 19 | 3300050491 | nmdc:mga00v17_67378_c1 | nmdc:mga00v17_67378_c1_1381_1872 | 161 |
| 20 | 3300050492 | nmdc:mga0yw44_8703_c1 | nmdc:mga0yw44_8703_c1_113_604 | 161 |
| 21 | 3300050493 | nmdc:mga0k408_18844_c1 | nmdc:mga0k408_18844_c1_2205_2696 | 161 |
| 22 | 3300050494 | nmdc:mga06z11_1924_c1 | nmdc:mga06z11_1924_c1_341_832 | 161 |
| 23 | 3300050494 | nmdc:mga06z11_392765_c1 | nmdc:mga06z11_392765_c1_86_577 | 161 |
| 24 | 3300050495 | nmdc:mga04h51_383_c1 | nmdc:mga04h51_383_c1_6238_6729 | 161 |
| 25 | 3300050496 | nmdc:mga07m45_426681_c1 | nmdc:mga07m45_426681_c1_191_682 | 161 |
| 26 | 3300053096 | Ga0500641_0209479 | Ga0500641_0209479_11_502 | 161 |
| 27 | 3300053117 | Ga0500593_205750 | Ga0500593_205750_140_631 | 161 |
| 28 | 3300053118 | Ga0500594_0021048 | Ga0500594_0021048_1076_1567 | 161 |
| 29 | 3300031251 | Ga0265327_10031062 | Ga0265327_100310623 | 163 |
| 30 | 3300005327 | Ga0070658_10042656 | Ga0070658_100426564 | 164 |
| 31 | 3300006358 | Ga0068871_100994823 | Ga0068871_1009948232 | 166 |
| 32 | 3300010159 | Ga0099796_10018756 | Ga0099796_100187562 | 166 |
| 33 | 3300037068 | Ga0373925_0200239 | Ga0373925_0200239_572_1075 | 166 |
| 34 | 3300039437 | Ga0436365_0992819 | Ga0436365_0992819_141_641 | 166 |
| 35 | 3300046531 | Ga0495665_0153390 | Ga0495665_0153390_373_876 | 166 |
| 36 | 3300049574 | Ga0501038_0862456 | Ga0501038_0862456_140_652 | 166 |
| 37 | 3300005435 | Ga0070714_101350416 | Ga0070714_1013504161 | 167 |
| 38 | 3300005439 | Ga0070711_100132904 | Ga0070711_1001329042 | 167 |
| 39 | 3300005614 | Ga0068856_100415548 | Ga0068856_1004155482 | 167 |
| 40 | 3300005614 | Ga0068856_100879184 | Ga0068856_1008791842 | 167 |
| 41 | 3300006173 | Ga0070716_100840698 | Ga0070716_1008406982 | 167 |
| 42 | 3300006358 | Ga0068871_100051672 | Ga0068871_1000516722 | 167 |
| 43 | 3300009176 | Ga0105242_10010671 | Ga0105242_100106715 | 167 |
| 44 | 3300013307 | Ga0157372_10003598 | Ga0157372_1000359813 | 167 |
| 45 | 3300013307 | Ga0157372_10032901 | Ga0157372_100329015 | 167 |
| 46 | 3300013307 | Ga0157372_10046890 | Ga0157372_100468902 | 167 |
| 47 | 3300013307 | Ga0157372_10357509 | Ga0157372_103575092 | 167 |
| 48 | 3300014969 | Ga0157376_11257713 | Ga0157376_112577132 | 167 |
| 49 | 3300021377 | Ga0213874_10007393 | Ga0213874_100073933 | 167 |
| 50 | 3300021384 | Ga0213876_10000225 | Ga0213876_1000022548 | 167 |
| 51 | 3300025929 | Ga0207664_10739535 | Ga0207664_107395352 | 167 |
| 52 | 3300025934 | Ga0207686_10014940 | Ga0207686_100149405 | 167 |
| 53 | 3300026078 | Ga0207702_10770394 | Ga0207702_107703942 | 167 |
| 54 | 3300026078 | Ga0207702_10809718 | Ga0207702_108097182 | 167 |
| 55 | 3300035170 | Ga0373943_0014593 | Ga0373943_0014593_2872_3381 | 167 |
| 56 | 3300035171 | Ga0373946_0139774 | Ga0373946_0139774_36_545 | 167 |
| 57 | 3300035692 | Ga0373935_0009238 | Ga0373935_0009238_2980_3489 | 167 |
| 58 | 3300035725 | Ga0373947_0009411 | Ga0373947_0009411_1006_1515 | 167 |
| 59 | 3300037068 | Ga0373925_0002583 | Ga0373925_0002583_3289_3798 | 167 |
| 60 | 3300039437 | Ga0436365_0014930 | Ga0436365_0014930_45657_46169 | 167 |
| 61 | 3300039450 | Ga0436363_0026865 | Ga0436363_0026865_14_520 | 167 |
| 62 | 3300039450 | Ga0436363_1287658 | Ga0436363_1287658_81_593 | 167 |
| 63 | 3300046472 | Ga0495580_0003681 | Ga0495580_0003681_539_1051 | 167 |
| 64 | 3300046475 | Ga0495639_0194789 | Ga0495639_0194789_378_890 | 167 |
| 65 | 3300046683 | Ga0495658_0006807 | Ga0495658_0006807_727_1239 | 167 |
| 66 | 3300047319 | Ga0495674_0557773 | Ga0495674_0557773_136_645 | 167 |
| 67 | 3300053153 | Ga0500616_0114683 | Ga0500616_0114683_539_1048 | 167 |
| 68 | 3300005435 | Ga0070714_100241269 | Ga0070714_1002412692 | 168 |
| 69 | 3300005437 | Ga0070710_10636233 | Ga0070710_106362331 | 168 |
| 70 | 3300005548 | Ga0070665_100180637 | Ga0070665_1001806372 | 168 |
| 71 | 3300009094 | Ga0111539_10191349 | Ga0111539_101913492 | 168 |
| 72 | 3300025929 | Ga0207664_10204331 | Ga0207664_102043312 | 168 |
| 73 | 3300025933 | Ga0207706_10974168 | Ga0207706_109741682 | 168 |
| 74 | 3300028577 | Ga0265318_10043625 | Ga0265318_100436253 | 168 |
| 75 | 3300031235 | Ga0265330_10032648 | Ga0265330_100326484 | 168 |
| 76 | 3300031238 | Ga0265332_10108831 | Ga0265332_101088312 | 168 |
| 77 | 3300031239 | Ga0265328_10097955 | Ga0265328_100979552 | 168 |
| 78 | 3300031241 | Ga0265325_10015770 | Ga0265325_100157702 | 168 |
| 79 | 3300031247 | Ga0265340_10000021 | Ga0265340_1000002113 | 168 |
| 80 | 3300031247 | Ga0265340_10003362 | Ga0265340_100033625 | 168 |
| 81 | 3300031247 | Ga0265340_10068658 | Ga0265340_100686583 | 168 |
| 82 | 3300031249 | Ga0265339_10055770 | Ga0265339_100557702 | 168 |
| 83 | 3300031249 | Ga0265339_10089270 | Ga0265339_100892702 | 168 |
| 84 | 3300031250 | Ga0265331_10189889 | Ga0265331_101898892 | 168 |
| 85 | 3300031344 | Ga0265316_10002070 | Ga0265316_1000207021 | 168 |
| 86 | 3300031344 | Ga0265316_10049639 | Ga0265316_100496393 | 168 |
| 87 | 3300031344 | Ga0265316_10380236 | Ga0265316_103802362 | 168 |
| 88 | 3300031595 | Ga0265313_10063720 | Ga0265313_100637202 | 168 |
| 89 | 3300031595 | Ga0265313_10118864 | Ga0265313_101188642 | 168 |
| 90 | 3300031711 | Ga0265314_10000370 | Ga0265314_100003706 | 168 |
| 91 | 3300031712 | Ga0265342_10052161 | Ga0265342_100521613 | 168 |
| 92 | 3300003215 | JGI25153J46596_10003018 | JGI25153J46596_100030182 | 169 |
| 93 | 3300005327 | Ga0070658_10051759 | Ga0070658_100517592 | 169 |
| 94 | 3300005327 | Ga0070658_10240932 | Ga0070658_102409321 | 169 |
| 95 | 3300005329 | Ga0070683_100113131 | Ga0070683_1001131313 | 169 |
| 96 | 3300005330 | Ga0070690_100254800 | Ga0070690_1002548002 | 169 |
| 97 | 3300005335 | Ga0070666_10125769 | Ga0070666_101257692 | 169 |
| 98 | 3300005336 | Ga0070680_100723335 | Ga0070680_1007233352 | 169 |
| 99 | 3300005338 | Ga0068868_100020987 | Ga0068868_1000209874 | 169 |
| 100 | 3300005338 | Ga0068868_101001213 | Ga0068868_1010012131 | 169 |
| 101 | 3300005339 | Ga0070660_100308699 | Ga0070660_1003086992 | 169 |
| 102 | 3300005344 | Ga0070661_100242047 | Ga0070661_1002420473 | 169 |
| 103 | 3300005347 | Ga0070668_100226279 | Ga0070668_1002262791 | 169 |
| 104 | 3300005355 | Ga0070671_100182508 | Ga0070671_1001825082 | 169 |
| 105 | 3300005356 | Ga0070674_100196003 | Ga0070674_1001960032 | 169 |
| 106 | 3300005356 | Ga0070674_100691522 | Ga0070674_1006915221 | 169 |
| 107 | 3300005366 | Ga0070659_100199772 | Ga0070659_1001997722 | 169 |
| 108 | 3300005367 | Ga0070667_100030043 | Ga0070667_1000300432 | 169 |
| 109 | 3300005367 | Ga0070667_101118043 | Ga0070667_1011180432 | 169 |
| 110 | 3300005367 | Ga0070667_101431068 | Ga0070667_1014310681 | 169 |
| 111 | 3300005458 | Ga0070681_11465611 | Ga0070681_114656111 | 169 |
| 112 | 3300005535 | Ga0070684_100025863 | Ga0070684_1000258631 | 169 |
| 113 | 3300005539 | Ga0068853_100151736 | Ga0068853_1001517362 | 169 |
| 114 | 3300005548 | Ga0070665_100317342 | Ga0070665_1003173423 | 169 |
| 115 | 3300005548 | Ga0070665_100745398 | Ga0070665_1007453982 | 169 |
| 116 | 3300005563 | Ga0068855_100062730 | Ga0068855_1000627304 | 169 |
| 117 | 3300005563 | Ga0068855_100100880 | Ga0068855_1001008804 | 169 |
| 118 | 3300005563 | Ga0068855_100308437 | Ga0068855_1003084373 | 169 |
| 119 | 3300005577 | Ga0068857_100324696 | Ga0068857_1003246962 | 169 |
| 120 | 3300005614 | Ga0068856_100785812 | Ga0068856_1007858122 | 169 |
| 121 | 3300005617 | Ga0068859_101283338 | Ga0068859_1012833381 | 169 |
| 122 | 3300005719 | Ga0068861_100043871 | Ga0068861_1000438713 | 169 |
| 123 | 3300005841 | Ga0068863_100037524 | Ga0068863_1000375242 | 169 |
| 124 | 3300005842 | Ga0068858_100092535 | Ga0068858_1000925352 | 169 |
| 125 | 3300005842 | Ga0068858_100126240 | Ga0068858_1001262402 | 169 |
| 126 | 3300005844 | Ga0068862_101242549 | Ga0068862_1012425492 | 169 |
| 127 | 3300006237 | Ga0097621_100054697 | Ga0097621_1000546974 | 169 |
| 128 | 3300006237 | Ga0097621_100106936 | Ga0097621_1001069363 | 169 |
| 129 | 3300006237 | Ga0097621_100768744 | Ga0097621_1007687442 | 169 |
| 130 | 3300006358 | Ga0068871_100058907 | Ga0068871_1000589072 | 169 |
| 131 | 3300006358 | Ga0068871_100209463 | Ga0068871_1002094632 | 169 |
| 132 | 3300006881 | Ga0068865_100004725 | Ga0068865_1000047259 | 169 |
| 133 | 3300006931 | Ga0097620_101283560 | Ga0097620_1012835601 | 169 |
| 134 | 3300009093 | Ga0105240_10012030 | Ga0105240_100120308 | 169 |
| 135 | 3300009093 | Ga0105240_10688043 | Ga0105240_106880432 | 169 |
| 136 | 3300009093 | Ga0105240_11295699 | Ga0105240_112956992 | 169 |
| 137 | 3300009093 | Ga0105240_11770644 | Ga0105240_117706442 | 169 |
| 138 | 3300009098 | Ga0105245_11176369 | Ga0105245_111763691 | 169 |
| 139 | 3300009098 | Ga0105245_11202249 | Ga0105245_112022492 | 169 |
| 140 | 3300009148 | Ga0105243_10561668 | Ga0105243_105616682 | 169 |
| 141 | 3300009174 | Ga0105241_10130822 | Ga0105241_101308222 | 169 |
| 142 | 3300009174 | Ga0105241_10353971 | Ga0105241_103539712 | 169 |
| 143 | 3300009176 | Ga0105242_11052766 | Ga0105242_110527662 | 169 |
| 144 | 3300009177 | Ga0105248_10024136 | Ga0105248_100241364 | 169 |
| 145 | 3300009177 | Ga0105248_10598479 | Ga0105248_105984792 | 169 |
| 146 | 3300009177 | Ga0105248_11347772 | Ga0105248_113477722 | 169 |
| 147 | 3300009177 | Ga0105248_12244001 | Ga0105248_122440011 | 169 |
| 148 | 3300009545 | Ga0105237_10068601 | Ga0105237_100686014 | 169 |
| 149 | 3300009545 | Ga0105237_10212456 | Ga0105237_102124561 | 169 |
| 150 | 3300009545 | Ga0105237_11241600 | Ga0105237_112416002 | 169 |
| 151 | 3300009551 | Ga0105238_10247120 | Ga0105238_102471203 | 169 |
| 152 | 3300009551 | Ga0105238_10776911 | Ga0105238_107769112 | 169 |
| 153 | 3300009551 | Ga0105238_10812232 | Ga0105238_108122322 | 169 |
| 154 | 3300009551 | Ga0105238_11422515 | Ga0105238_114225151 | 169 |
| 155 | 3300009553 | Ga0105249_10400158 | Ga0105249_104001582 | 169 |
| 156 | 3300010375 | Ga0105239_10266624 | Ga0105239_102666242 | 169 |
| 157 | 3300010375 | Ga0105239_10503914 | Ga0105239_105039142 | 169 |
| 158 | 3300010375 | Ga0105239_11114824 | Ga0105239_111148242 | 169 |
| 159 | 3300010375 | Ga0105239_11901294 | Ga0105239_119012942 | 169 |
| 160 | 3300010375 | Ga0105239_12135166 | Ga0105239_121351662 | 169 |
| 161 | 3300013100 | Ga0157373_10708270 | Ga0157373_107082701 | 169 |
| 162 | 3300013105 | Ga0157369_10307772 | Ga0157369_103077722 | 169 |
| 163 | 3300013296 | Ga0157374_11105176 | Ga0157374_111051762 | 169 |
| 164 | 3300013297 | Ga0157378_10009866 | Ga0157378_100098669 | 169 |
| 165 | 3300013297 | Ga0157378_10664226 | Ga0157378_106642262 | 169 |
| 166 | 3300013297 | Ga0157378_10696576 | Ga0157378_106965762 | 169 |
| 167 | 3300013306 | Ga0163162_10928447 | Ga0163162_109284472 | 169 |
| 168 | 3300013306 | Ga0163162_10989454 | Ga0163162_109894542 | 169 |
| 169 | 3300013306 | Ga0163162_11037858 | Ga0163162_110378582 | 169 |
| 170 | 3300013307 | Ga0157372_10132231 | Ga0157372_101322312 | 169 |
| 171 | 3300013308 | Ga0157375_10038943 | Ga0157375_100389435 | 169 |
| 172 | 3300014325 | Ga0163163_10198702 | Ga0163163_101987023 | 169 |
| 173 | 3300014325 | Ga0163163_10698658 | Ga0163163_106986582 | 169 |
| 174 | 3300014325 | Ga0163163_11711168 | Ga0163163_117111681 | 169 |
| 175 | 3300014326 | Ga0157380_10347511 | Ga0157380_103475112 | 169 |
| 176 | 3300014969 | Ga0157376_10025599 | Ga0157376_100255994 | 169 |
| 177 | 3300014969 | Ga0157376_10413328 | Ga0157376_104133282 | 169 |
| 178 | 3300014969 | Ga0157376_10511709 | Ga0157376_105117091 | 169 |
| 179 | 3300017792 | Ga0163161_10184912 | Ga0163161_101849123 | 169 |
| 180 | 3300025261 | Ga0209233_1000964 | Ga0209233_10009643 | 169 |
| 181 | 3300025297 | Ga0209758_1000036 | Ga0209758_1000036232 | 169 |
| 182 | 3300025297 | Ga0209758_1035611 | Ga0209758_10356112 | 169 |
| 183 | 3300025899 | Ga0207642_10129097 | Ga0207642_101290972 | 169 |
| 184 | 3300025909 | Ga0207705_10028609 | Ga0207705_100286092 | 169 |
| 185 | 3300025912 | Ga0207707_11006322 | Ga0207707_110063222 | 169 |
| 186 | 3300025913 | Ga0207695_10052612 | Ga0207695_100526124 | 169 |
| 187 | 3300025913 | Ga0207695_10053055 | Ga0207695_100530552 | 169 |
| 188 | 3300025913 | Ga0207695_10164623 | Ga0207695_101646232 | 169 |
| 189 | 3300025914 | Ga0207671_10058895 | Ga0207671_100588952 | 169 |
| 190 | 3300025919 | Ga0207657_10110733 | Ga0207657_101107333 | 169 |
| 191 | 3300025921 | Ga0207652_10249463 | Ga0207652_102494632 | 169 |
| 192 | 3300025924 | Ga0207694_10652967 | Ga0207694_106529672 | 169 |
| 193 | 3300025924 | Ga0207694_10873713 | Ga0207694_108737131 | 169 |
| 194 | 3300025925 | Ga0207650_10929218 | Ga0207650_109292181 | 169 |
| 195 | 3300025927 | Ga0207687_10417885 | Ga0207687_104178852 | 169 |
| 196 | 3300025931 | Ga0207644_10396162 | Ga0207644_103961622 | 169 |
| 197 | 3300025932 | Ga0207690_10076015 | Ga0207690_100760152 | 169 |
| 198 | 3300025934 | Ga0207686_10413273 | Ga0207686_104132732 | 169 |
| 199 | 3300025935 | Ga0207709_11190700 | Ga0207709_111907001 | 169 |
| 200 | 3300025937 | Ga0207669_10294117 | Ga0207669_102941172 | 169 |
| 201 | 3300025938 | Ga0207704_10072895 | Ga0207704_100728953 | 169 |
| 202 | 3300025938 | Ga0207704_10139205 | Ga0207704_101392053 | 169 |
| 203 | 3300025940 | Ga0207691_10241027 | Ga0207691_102410272 | 169 |
| 204 | 3300025941 | Ga0207711_10046724 | Ga0207711_100467242 | 169 |
| 205 | 3300025941 | Ga0207711_10721432 | Ga0207711_107214322 | 169 |
| 206 | 3300025944 | Ga0207661_10443714 | Ga0207661_104437142 | 169 |
| 207 | 3300025945 | Ga0207679_10133854 | Ga0207679_101338542 | 169 |
| 208 | 3300025949 | Ga0207667_10138834 | Ga0207667_101388342 | 169 |
| 209 | 3300025949 | Ga0207667_10148405 | Ga0207667_101484052 | 169 |
| 210 | 3300025949 | Ga0207667_10370059 | Ga0207667_103700593 | 169 |
| 211 | 3300025960 | Ga0207651_10526933 | Ga0207651_105269332 | 169 |
| 212 | 3300025961 | Ga0207712_10816830 | Ga0207712_108168302 | 169 |
| 213 | 3300025986 | Ga0207658_10450449 | Ga0207658_104504492 | 169 |
| 214 | 3300026023 | Ga0207677_10394635 | Ga0207677_103946352 | 169 |
| 215 | 3300026035 | Ga0207703_10012145 | Ga0207703_100121456 | 169 |
| 216 | 3300026035 | Ga0207703_10188910 | Ga0207703_101889102 | 169 |
| 217 | 3300026041 | Ga0207639_10456432 | Ga0207639_104564322 | 169 |
| 218 | 3300026041 | Ga0207639_10546747 | Ga0207639_105467472 | 169 |
| 219 | 3300026078 | Ga0207702_10445162 | Ga0207702_104451622 | 169 |
| 220 | 3300026088 | Ga0207641_10010540 | Ga0207641_100105406 | 169 |
| 221 | 3300026088 | Ga0207641_11840447 | Ga0207641_118404471 | 169 |
| 222 | 3300026095 | Ga0207676_11145877 | Ga0207676_111458772 | 169 |
| 223 | 3300026116 | Ga0207674_10211073 | Ga0207674_102110732 | 169 |
| 224 | 3300026116 | Ga0207674_10276056 | Ga0207674_102760563 | 169 |
| 225 | 3300026121 | Ga0207683_10047741 | Ga0207683_100477414 | 169 |
| 226 | 3300028379 | Ga0268266_10108213 | Ga0268266_101082132 | 169 |
| 227 | 3300028379 | Ga0268266_10156276 | Ga0268266_101562762 | 169 |
| 228 | 3300028380 | Ga0268265_10335381 | Ga0268265_103353813 | 169 |
| 229 | 3300028380 | Ga0268265_10688174 | Ga0268265_106881742 | 169 |
| 230 | 3300028800 | Ga0265338_10095701 | Ga0265338_100957012 | 169 |
| 231 | 3300031250 | Ga0265331_10000006 | Ga0265331_1000000687 | 169 |
| 232 | 3300037418 | Ga0395900_0820690 | Ga0395900_0820690_78_587 | 169 |
| 233 | 3300037466 | Ga0395898_0178819 | Ga0395898_0178819_204_713 | 169 |
| 234 | 3300038443 | Ga0395901_1304928 | Ga0395901_1304928_11_520 | 169 |
| 235 | 3300039437 | Ga0436365_1793593 | Ga0436365_1793593_135_644 | 169 |
| 236 | 3300039447 | Ga0436361_1129526 | Ga0436361_1129526_222_734 | 169 |
| 237 | 3300039453 | Ga0436362_1114918 | Ga0436362_1114918_258_773 | 169 |
| 238 | 3300041452 | Ga0451793_0905697 | Ga0451793_0905697_13_522 | 169 |
| 239 | 3300045976 | Ga0466967_0623967 | Ga0466967_0623967_257_775 | 169 |
| 240 | 3300046452 | Ga0495617_133260 | Ga0495617_133260_159_668 | 169 |
| 241 | 3300046471 | Ga0495650_0055472 | Ga0495650_0055472_595_1104 | 169 |
| 242 | 3300046492 | Ga0495585_0155984 | Ga0495585_0155984_54_563 | 169 |
| 243 | 3300046514 | Ga0495618_0784459 | Ga0495618_0784459_25_534 | 169 |
| 244 | 3300046524 | Ga0495648_0295686 | Ga0495648_0295686_130_639 | 169 |
| 245 | 3300046538 | Ga0495609_0007772 | Ga0495609_0007772_613_1122 | 169 |
| 246 | 3300046539 | Ga0495621_0013772 | Ga0495621_0013772_395_904 | 169 |
| 247 | 3300046615 | Ga0495656_0066625 | Ga0495656_0066625_490_999 | 169 |
| 248 | 3300046683 | Ga0495658_0130522 | Ga0495658_0130522_519_1028 | 169 |
| 249 | 3300046794 | Ga0495589_0132521 | Ga0495589_0132521_363_872 | 169 |
| 250 | 3300047318 | Ga0495636_0018305 | Ga0495636_0018305_1951_2460 | 169 |
| 251 | 3300048903 | Ga0496100_0570477 | Ga0496100_0570477_331_840 | 169 |
| 252 | 3300049568 | Ga0501031_0020259 | Ga0501031_0020259_3222_3731 | 169 |
| 253 | 3300049568 | Ga0501031_0790913 | Ga0501031_0790913_31_543 | 169 |
| 254 | 3300049569 | Ga0501032_0010031 | Ga0501032_0010031_5353_5862 | 169 |
| 255 | 3300049570 | Ga0501033_0025987 | Ga0501033_0025987_3353_3862 | 169 |
| 256 | 3300049570 | Ga0501033_0086134 | Ga0501033_0086134_143_655 | 169 |
| 257 | 3300049570 | Ga0501033_0359283 | Ga0501033_0359283_449_958 | 169 |
| 258 | 3300049571 | Ga0501034_0091345 | Ga0501034_0091345_1349_1858 | 169 |
| 259 | 3300049572 | Ga0501036_0019828 | Ga0501036_0019828_4299_4808 | 169 |
| 260 | 3300049572 | Ga0501036_0193741 | Ga0501036_0193741_632_1144 | 169 |
| 261 | 3300049573 | Ga0501037_0019421 | Ga0501037_0019421_2741_3250 | 169 |
| 262 | 3300049573 | Ga0501037_0027488 | Ga0501037_0027488_2885_3397 | 169 |
| 263 | 3300049573 | Ga0501037_0562427 | Ga0501037_0562427_61_570 | 169 |
| 264 | 3300049574 | Ga0501038_0018768 | Ga0501038_0018768_1349_1858 | 169 |
| 265 | 3300049574 | Ga0501038_0226698 | Ga0501038_0226698_749_1258 | 169 |
| 266 | 3300049574 | Ga0501038_0348650 | Ga0501038_0348650_35_544 | 169 |
| 267 | 3300049575 | Ga0501039_0034845 | Ga0501039_0034845_596_1105 | 169 |
| 268 | 3300049579 | Ga0501043_0005813 | Ga0501043_0005813_3855_4364 | 169 |
| 269 | 3300049579 | Ga0501043_0027261 | Ga0501043_0027261_224_736 | 169 |
| 270 | 3300049579 | Ga0501043_0151476 | Ga0501043_0151476_486_995 | 169 |
| 271 | 3300049580 | Ga0501046_0002196 | Ga0501046_0002196_15423_15932 | 169 |
| 272 | 3300049580 | Ga0501046_0066667 | Ga0501046_0066667_529_1041 | 169 |
| 273 | 3300049580 | Ga0501046_0068504 | Ga0501046_0068504_1663_2175 | 169 |
| 274 | 3300049581 | Ga0501047_0135343 | Ga0501047_0135343_997_1506 | 169 |
| 275 | 3300049581 | Ga0501047_0180256 | Ga0501047_0180256_301_813 | 169 |
| 276 | 3300049582 | Ga0501048_0001595 | Ga0501048_0001595_4977_5486 | 169 |
| 277 | 3300049583 | Ga0501067_0002120 | Ga0501067_0002120_7792_8301 | 169 |
| 278 | 3300049585 | Ga0501069_0005271 | Ga0501069_0005271_4088_4597 | 169 |
| 279 | 3300049586 | Ga0501070_0007693 | Ga0501070_0007693_6987_7496 | 169 |
| 280 | 3300049588 | Ga0501072_0023730 | Ga0501072_0023730_3402_3911 | 169 |
| 281 | 3300049589 | Ga0501073_0041007 | Ga0501073_0041007_1735_2244 | 169 |
| 282 | 3300049589 | Ga0501073_0185959 | Ga0501073_0185959_26_535 | 169 |
| 283 | 3300049590 | Ga0501074_0006923 | Ga0501074_0006923_3985_4494 | 169 |
| 284 | 3300049592 | Ga0501076_0140467 | Ga0501076_0140467_604_1113 | 169 |
| 285 | 3300049741 | Ga0501079_0017694 | Ga0501079_0017694_1585_2094 | 169 |
| 286 | 3300049742 | Ga0501080_0063730 | Ga0501080_0063730_417_926 | 169 |
| 287 | 3300049742 | Ga0501080_0220922 | Ga0501080_0220922_708_1217 | 169 |
| 288 | 3300049742 | Ga0501080_0638584 | Ga0501080_0638584_390_902 | 169 |
| 289 | 3300049744 | Ga0501083_0012369 | Ga0501083_0012369_104_613 | 169 |
| 290 | 3300049822 | Ga0501035_0102792 | Ga0501035_0102792_945_1457 | 169 |
| 291 | 3300049822 | Ga0501035_0164015 | Ga0501035_0164015_997_1506 | 169 |
| 292 | 3300049822 | Ga0501035_0433783 | Ga0501035_0433783_274_783 | 169 |
| 293 | 3300049823 | Ga0501044_0047692 | Ga0501044_0047692_2765_3274 | 169 |
| 294 | 3300049823 | Ga0501044_0078571 | Ga0501044_0078571_1838_2350 | 169 |
| 295 | 3300049823 | Ga0501044_0406472 | Ga0501044_0406472_63_572 | 169 |
| 296 | 3300053088 | Ga0500644_0304027 | Ga0500644_0304027_158_673 | 169 |
| 297 | 3300053094 | Ga0500566_0372756 | Ga0500566_0372756_40_549 | 169 |
| 298 | 3300053098 | Ga0500650_0395297 | Ga0500650_0395297_39_548 | 169 |
| 299 | 3300053118 | Ga0500594_0056065 | Ga0500594_0056065_18_527 | 169 |
| 300 | 3300053119 | Ga0500595_054709 | Ga0500595_054709_214_723 | 169 |
| 301 | 3300053120 | Ga0500597_062620 | Ga0500597_062620_78_587 | 169 |
| 302 | 3300053130 | Ga0500642_0077175 | Ga0500642_0077175_741_1250 | 169 |
| 303 | 3300053139 | Ga0500568_0137526 | Ga0500568_0137526_263_772 | 169 |
| 304 | 3300053163 | Ga0500639_146681 | Ga0500639_146681_318_827 | 169 |
| 305 | 3300053177 | Ga0500636_0318539 | Ga0500636_0318539_150_659 | 169 |
| 306 | 3300054114 | Ga0501084_0021827 | Ga0501084_0021827_1627_2136 | 169 |
| 307 | 3300060353 | Ga0501082_0039274 | Ga0501082_0039274_874_1383 | 169 |
| 308 | 3300031238 | Ga0265332_10141750 | Ga0265332_101417502 | 170 |
| 309 | 3300031242 | Ga0265329_10023000 | Ga0265329_100230002 | 170 |
| 310 | 3300031344 | Ga0265316_10308281 | Ga0265316_103082812 | 170 |
| 311 | 3300031730 | Ga0307516_10086492 | Ga0307516_100864922 | 171 |
| 312 | 3300005577 | Ga0068857_100026423 | Ga0068857_1000264232 | 172 |
| 313 | 3300005844 | Ga0068862_100052027 | Ga0068862_1000520273 | 172 |
| 314 | 3300013307 | Ga0157372_12330939 | Ga0157372_123309392 | 172 |
| 315 | 3300025924 | Ga0207694_10149311 | Ga0207694_101493112 | 172 |
| 316 | 3300025972 | Ga0207668_10102022 | Ga0207668_101020223 | 172 |
| 317 | 3300026116 | Ga0207674_10040418 | Ga0207674_100404182 | 172 |
| 318 | 3300028380 | Ga0268265_10305547 | Ga0268265_103055472 | 172 |
| 319 | 3300031249 | Ga0265339_10162401 | Ga0265339_101624012 | 172 |
| 320 | 3300031711 | Ga0265314_10205980 | Ga0265314_102059802 | 172 |
| 321 | 3300048088 | Ga0495602_0275398 | Ga0495602_0275398_385_903 | 172 |
| 322 | 3300053087 | Ga0500643_000014 | Ga0500643_000014_212110_212628 | 172 |
| 323 | 3300053103 | Ga0500555_036129 | Ga0500555_036129_520_1038 | 172 |
| 324 | 3300053119 | Ga0500595_087748 | Ga0500595_087748_351_869 | 172 |
| 325 | 3300013297 | Ga0157378_11761577 | Ga0157378_117615772 | 173 |
| 326 | 3300013308 | Ga0157375_11236401 | Ga0157375_112364012 | 173 |
| 327 | 3300021384 | Ga0213876_10001860 | Ga0213876_1000186011 | 173 |
| 328 | 3300003214 | JGI25165J46597_1000013 | JGI25165J46597_10000139 | 174 |
| 329 | 3300005335 | Ga0070666_10148892 | Ga0070666_101488923 | 174 |
| 330 | 3300005337 | Ga0070682_100768151 | Ga0070682_1007681511 | 174 |
| 331 | 3300005344 | Ga0070661_100003375 | Ga0070661_1000033757 | 174 |
| 332 | 3300005354 | Ga0070675_100721391 | Ga0070675_1007213912 | 174 |
| 333 | 3300005458 | Ga0070681_10893696 | Ga0070681_108936962 | 174 |
| 334 | 3300005530 | Ga0070679_100108925 | Ga0070679_1001089252 | 174 |
| 335 | 3300005539 | Ga0068853_100194499 | Ga0068853_1001944992 | 174 |
| 336 | 3300005548 | Ga0070665_100014524 | Ga0070665_1000145245 | 174 |
| 337 | 3300005618 | Ga0068864_100097024 | Ga0068864_1000970241 | 174 |
| 338 | 3300005618 | Ga0068864_102034940 | Ga0068864_1020349401 | 174 |
| 339 | 3300005843 | Ga0068860_100007909 | Ga0068860_1000079092 | 174 |
| 340 | 3300006237 | Ga0097621_100000004 | Ga0097621_10000000442 | 174 |
| 341 | 3300006237 | Ga0097621_100050804 | Ga0097621_1000508045 | 174 |
| 342 | 3300006358 | Ga0068871_100000028 | Ga0068871_1000000283 | 174 |
| 343 | 3300006358 | Ga0068871_100039943 | Ga0068871_1000399432 | 174 |
| 344 | 3300006358 | Ga0068871_101381821 | Ga0068871_1013818211 | 174 |
| 345 | 3300009174 | Ga0105241_10044486 | Ga0105241_100444863 | 174 |
| 346 | 3300009176 | Ga0105242_10058055 | Ga0105242_100580553 | 174 |
| 347 | 3300009545 | Ga0105237_10533353 | Ga0105237_105333532 | 174 |
| 348 | 3300009551 | Ga0105238_10088964 | Ga0105238_100889642 | 174 |
| 349 | 3300011119 | Ga0105246_10593327 | Ga0105246_105933271 | 174 |
| 350 | 3300014325 | Ga0163163_10000111 | Ga0163163_1000011133 | 174 |
| 351 | 3300014968 | Ga0157379_10000904 | Ga0157379_100009042 | 174 |
| 352 | 3300014969 | Ga0157376_10420045 | Ga0157376_104200452 | 174 |
| 353 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013264 | 174 |
| 354 | 3300025893 | Ga0207682_10281163 | Ga0207682_102811632 | 174 |
| 355 | 3300025903 | Ga0207680_10186325 | Ga0207680_101863252 | 174 |
| 356 | 3300025909 | Ga0207705_10132281 | Ga0207705_101322813 | 174 |
| 357 | 3300025911 | Ga0207654_10002467 | Ga0207654_100024679 | 174 |
| 358 | 3300025913 | Ga0207695_10282504 | Ga0207695_102825042 | 174 |
| 359 | 3300025914 | Ga0207671_10363350 | Ga0207671_103633502 | 174 |
| 360 | 3300025919 | Ga0207657_10045311 | Ga0207657_100453114 | 174 |
| 361 | 3300025920 | Ga0207649_10000073 | Ga0207649_1000007312 | 174 |
| 362 | 3300025921 | Ga0207652_10104136 | Ga0207652_101041363 | 174 |
| 363 | 3300025924 | Ga0207694_10568488 | Ga0207694_105684882 | 174 |
| 364 | 3300025926 | Ga0207659_10532636 | Ga0207659_105326362 | 174 |
| 365 | 3300025934 | Ga0207686_10015854 | Ga0207686_100158543 | 174 |
| 366 | 3300025942 | Ga0207689_10233103 | Ga0207689_102331032 | 174 |
| 367 | 3300026041 | Ga0207639_10039705 | Ga0207639_100397054 | 174 |
| 368 | 3300026067 | Ga0207678_10248217 | Ga0207678_102482173 | 174 |
| 369 | 3300026095 | Ga0207676_10053359 | Ga0207676_100533592 | 174 |
| 370 | 3300028381 | Ga0268264_10153274 | Ga0268264_101532742 | 174 |
| 371 | 3300028800 | Ga0265338_10043723 | Ga0265338_100437234 | 174 |
| 372 | 3300031238 | Ga0265332_10025264 | Ga0265332_100252642 | 174 |
| 373 | 3300031241 | Ga0265325_10004925 | Ga0265325_100049256 | 174 |
| 374 | 3300031249 | Ga0265339_10009825 | Ga0265339_100098255 | 174 |
| 375 | 3300031250 | Ga0265331_10000823 | Ga0265331_1000082312 | 174 |
| 376 | 3300031251 | Ga0265327_10000074 | Ga0265327_10000074133 | 174 |
| 377 | 3300031344 | Ga0265316_10050999 | Ga0265316_100509995 | 174 |
| 378 | 3300031595 | Ga0265313_10008006 | Ga0265313_100080065 | 174 |
| 379 | 3300031711 | Ga0265314_10065200 | Ga0265314_100652002 | 174 |
| 380 | 3300031711 | Ga0265314_10076858 | Ga0265314_100768582 | 174 |
| 381 | 3300031711 | Ga0265314_10209975 | Ga0265314_102099752 | 174 |
| 382 | 3300031712 | Ga0265342_10228314 | Ga0265342_102283142 | 174 |
| 383 | 3300031712 | Ga0265342_10293623 | Ga0265342_102936231 | 174 |
| 384 | 3300031730 | Ga0307516_10075012 | Ga0307516_100750124 | 174 |
| 385 | 3300046454 | Ga0495592_0188789 | Ga0495592_0188789_322_846 | 174 |
| 386 | 3300046543 | Ga0495645_0248037 | Ga0495645_0248037_617_1174 | 174 |
| 387 | 3300046557 | Ga0495622_0011212 | Ga0495622_0011212_2402_2926 | 174 |
| 388 | 3300046675 | Ga0495657_0143026 | Ga0495657_0143026_37_561 | 174 |
| 389 | 3300046694 | Ga0495649_0042200 | Ga0495649_0042200_1937_2461 | 174 |
| 390 | 3300046809 | Ga0495600_0242670 | Ga0495600_0242670_185_742 | 174 |
| 391 | 3300047323 | Ga0495683_0168356 | Ga0495683_0168356_426_950 | 174 |
| 392 | 3300048924 | Ga0496121_0002103 | Ga0496121_0002103_30255_30779 | 174 |
| 393 | 3300049569 | Ga0501032_0114470 | Ga0501032_0114470_943_1485 | 174 |
| 394 | 3300049570 | Ga0501033_0005872 | Ga0501033_0005872_6736_7278 | 174 |
| 395 | 3300049571 | Ga0501034_0856060 | Ga0501034_0856060_101_628 | 174 |
| 396 | 3300049571 | Ga0501034_1212180 | Ga0501034_1212180_43_585 | 174 |
| 397 | 3300049572 | Ga0501036_0661431 | Ga0501036_0661431_158_700 | 174 |
| 398 | 3300049573 | Ga0501037_0420433 | Ga0501037_0420433_179_721 | 174 |
| 399 | 3300049574 | Ga0501038_0037225 | Ga0501038_0037225_2217_2759 | 174 |
| 400 | 3300049580 | Ga0501046_0272575 | Ga0501046_0272575_559_1101 | 174 |
| 401 | 3300049580 | Ga0501046_0372038 | Ga0501046_0372038_461_1003 | 174 |
| 402 | 3300049581 | Ga0501047_0054734 | Ga0501047_0054734_1073_1615 | 174 |
| 403 | 3300049584 | Ga0501068_0033835 | Ga0501068_0033835_1089_1631 | 174 |
| 404 | 3300049589 | Ga0501073_0486902 | Ga0501073_0486902_133_675 | 174 |
| 405 | 3300049742 | Ga0501080_0289771 | Ga0501080_0289771_118_660 | 174 |
| 406 | 3300049744 | Ga0501083_0037466 | Ga0501083_0037466_2362_2889 | 174 |
| 407 | 3300049822 | Ga0501035_0204603 | Ga0501035_0204603_130_672 | 174 |
| 408 | 3300049823 | Ga0501044_0058863 | Ga0501044_0058863_2370_2912 | 174 |
| 409 | 3300053119 | Ga0500595_000390 | Ga0500595_000390_19766_20290 | 174 |
| 410 | 3300053119 | Ga0500595_021288 | Ga0500595_021288_95_619 | 174 |
| 411 | 3300053735 | Ga0500596_023331 | Ga0500596_023331_234_758 | 174 |
| 412 | 3300060353 | Ga0501082_0007310 | Ga0501082_0007310_2052_2579 | 174 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b7d-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine | 0.9696 | 10 | 171 |
| 6b7b-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole | 0.9676 | 10 | 171 |
| 3l93-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from yersinia pestis. | 0.9664 | 11 | 169 |
| 8i8i-assembly2.cif.gz_C-2 | crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution | 0.9662 | 11 | 170 |
| 6g6v-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. | 0.964 | 11 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.956 | 11 | 170 | 3.40.50.620 |
| 3nbkD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9495 | 11 | 169 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9491 | 11 | 170 | 3.40.50.620 |
| 4natB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9446 | 8 | 170 | 3.40.50.620 |
| 3nd7D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9377 | 10 | 168 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A5V280-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9842 | 11 | 174 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A5FXQ8-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9803 | 10 | 171 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A7G9SKH7-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9795 | 11 | 171 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A3A0EP61-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9794 | 9 | 173 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-B8GVE7-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.979 | 11 | 172 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar