F437880

General Info

Members Datasets Scaffolds Average Seq Length
412 347 176 157

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0058963|Ga0495638_0058963_1055_1573
Length 172
Sequence MKSMGSMTDQSHADTNTAPDAIEFECDLPEPPEKVWRALTVPELLAAWMMPNDISPETGSRFAFAGPEAAIECEIIDAEPERLLRYSWRERPQPGDAGPQDRLDSPLDSIVTFTLARTVSGGTHLRIVHDGFARTAMPAVAMAGAGCRLSLGSRNPRRPAAANTPLLLLRAA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
12 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
13 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
14 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
15 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
16 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
17 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
18 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
19 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
20 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
21 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
22 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
23 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
24 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
25 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
26 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
27 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
28 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
29 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
30 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
31 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
32 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
33 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
34 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
35 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
36 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
37 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
38 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
39 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
40 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
41 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
42 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
43 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
44 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
45 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
46 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
47 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
48 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
49 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
50 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
51 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
52 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
53 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
54 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
55 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
56 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
57 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
58 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
59 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
60 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
61 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
62 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
63 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
64 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
65 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
66 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
67 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
68 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
69 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
70 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
71 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
72 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
73 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
74 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
75 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
76 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
77 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
78 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
79 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
80 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
81 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
82 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
83 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
84 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
85 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
86 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
87 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
88 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
89 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
90 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
91 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
92 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
93 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
94 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
95 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
96 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
97 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
98 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
99 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
100 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
101 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
102 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
103 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
104 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
105 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
106 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
107 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
108 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
109 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
110 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
111 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
112 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
113 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
114 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
115 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
116 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
117 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
118 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
119 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
120 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
121 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
122 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
123 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
124 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
125 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
126 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
127 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
128 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
129 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
130 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
131 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
132 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
133 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
134 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
135 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
136 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
137 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
138 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
139 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
140 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
141 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
142 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
143 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
144 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
145 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
146 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
147 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
148 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
149 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
150 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
151 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
152 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
153 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
154 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
155 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
156 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
157 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
158 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
159 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
160 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
161 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
162 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
163 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
164 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
165 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
166 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
167 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
168 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
169 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
170 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
171 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
172 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
173 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
174 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
175 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
176 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
177 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
178 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
179 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
180 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
181 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
182 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
183 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
184 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
185 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
186 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
187 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
188 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
189 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
190 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
191 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
192 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
193 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
194 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
195 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
196 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
197 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
198 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
199 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
200 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
201 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
202 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
203 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
204 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
205 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
206 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
207 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
208 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
209 3004167301 Mesorhizobium loti 582 Isolate Unclassified
210 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
211 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
212 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
213 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
214 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
215 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
216 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
217 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
218 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
219 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
220 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
221 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
222 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
223 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
224 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
225 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
226 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
227 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
228 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
229 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
230 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
231 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
232 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
233 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
234 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
235 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
236 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
237 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
238 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
239 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
240 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
241 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
242 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
243 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
244 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
245 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
246 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
247 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
248 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
249 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
250 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
251 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
252 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
253 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
254 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
255 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
256 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
257 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
258 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
259 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
260 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
261 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
262 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
263 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
264 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
265 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
267 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
268 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
270 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
289 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
290 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
291 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
292 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
293 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
294 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
295 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
298 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
299 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
300 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
304 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
313 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
314 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
319 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
325 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
328 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
329 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
330 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
331 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
332 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
333 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
334 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
335 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
336 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
337 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
338 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
339 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
340 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
341 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
342 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
343 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
344 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
345 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
346 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
347 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 42.72
Metatranscriptomes 0
Isolates 57.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.35
Nodule 50
Rhizoplane 2.43
Rhizosphere 24.27
Stem 0
Stem Tuber 0
Unclassified 9.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10010716 3300001989 Bacteria 3399
2 JGI24735J21928_10030266 3300002067 Bacteria 1609
3 JGI25156J39149_1004603 3300002705 Bacteria 4162
4 JGI25157J39369_1000136 3300002741 Bacteria 61418
5 JGI25165J46597_1000087 3300003214 Bacteria 170335
6 JGI25165J46597_1000139 3300003214 Bacteria 121216
7 Ga0055542_1000775 3300003762 Bacteria 24034
8 Ga0055542_1001096 3300003762 Bacteria 16438
9 Ga0055529_1003883 3300003763 Bacteria 2368
10 Ga0065715_10061952 3300005293 Bacteria 971
11 Ga0070666_10374270 3300005335 Bacteria 1022
12 Ga0070660_100355666 3300005339 Bacteria 1207
13 Ga0070661_100769006 3300005344 Bacteria 789
14 Ga0070668_100485191 3300005347 Bacteria 1068
15 Ga0070674_101414364 3300005356 Bacteria 623
16 Ga0070667_100388553 3300005367 Bacteria 1268
17 Ga0070667_101342831 3300005367 Bacteria 670
18 Ga0070663_100498532 3300005455 Bacteria 1011
19 Ga0068853_100052118 3300005539 Bacteria 3524
20 Ga0068853_100071337 3300005539 Bacteria 3025
21 Ga0068853_101015761 3300005539 Bacteria 799
22 Ga0068853_101027516 3300005539 Bacteria 794
23 Ga0068853_101156389 3300005539 Bacteria 747
24 Ga0070665_101182672 3300005548 Bacteria 776
25 Ga0070665_101318475 3300005548 Bacteria 732
26 Ga0068855_100412289 3300005563 Bacteria 1479
27 Ga0068857_100058913 3300005577 Bacteria 3411
28 Ga0068854_100919572 3300005578 Bacteria 770
29 Ga0068854_101166940 3300005578 Bacteria 689
30 Ga0068856_100383084 3300005614 Bacteria 1425
31 Ga0068852_100080759 3300005616 Bacteria 2884
32 Ga0081455_10249075 3300005937 Bacteria 1300
33 Ga0075365_10028017 3300006038 Bacteria 3590
34 Ga0075365_10088195 3300006038 Bacteria 2110
35 Ga0075365_10343205 3300006038 Bacteria 1052
36 Ga0075368_10046102 3300006042 Bacteria 1724
37 Ga0075363_100016337 3300006048 Bacteria 3665
38 Ga0075363_100081499 3300006048 Bacteria 1770
39 Ga0075363_100159900 3300006048 Bacteria 1275
40 Ga0075363_100338812 3300006048 Bacteria 877
41 Ga0075364_10329081 3300006051 Bacteria 1040
42 Ga0075364_10482249 3300006051 Bacteria 848
43 Ga0075362_10048842 3300006177 Bacteria 1888
44 Ga0075362_10501252 3300006177 Bacteria 621
45 Ga0075367_10022865 3300006178 Bacteria 3512
46 Ga0075367_10056250 3300006178 Bacteria 2337
47 Ga0075367_10101895 3300006178 Bacteria 1756
48 Ga0075367_10511048 3300006178 Bacteria 762
49 Ga0075369_10017256 3300006186 Bacteria 2922
50 Ga0075369_10263643 3300006186 Bacteria 801
51 Ga0075366_10343500 3300006195 Bacteria 915
52 Ga0075370_10089242 3300006353 Bacteria 1778
53 Ga0075370_10367944 3300006353 Bacteria 860
54 Ga0105240_10518614 3300009093 Bacteria 1323
55 Ga0105240_10663909 3300009093 Bacteria 1141
56 Ga0105240_10810666 3300009093 Bacteria 1013
57 Ga0105240_10997810 3300009093 Bacteria 896
58 Ga0105240_11267685 3300009093 Bacteria 778
59 Ga0105241_10085431 3300009174 Bacteria 2480
60 Ga0105237_10011710 3300009545 Bacteria 9275
61 Ga0105237_10119290 3300009545 Bacteria 2632
62 Ga0105237_10306547 3300009545 Bacteria 1591
63 Ga0105237_10716514 3300009545 Bacteria 1007
64 Ga0105238_10157357 3300009551 Bacteria 2247
65 Ga0105238_10600626 3300009551 Bacteria 1108
66 Ga0105238_10636913 3300009551 Bacteria 1076
67 Ga0105239_10052947 3300010375 Bacteria 4452
68 Ga0105239_10060355 3300010375 Bacteria 4162
69 Ga0105239_10324605 3300010375 Bacteria 1736
70 Ga0105239_12008841 3300010375 Bacteria 671
71 Ga0157370_10738510 3300013104 Bacteria 897
72 Ga0157369_10277827 3300013105 Bacteria 1744
73 Ga0157369_10434499 3300013105 Bacteria 1360
74 Ga0163163_11211853 3300014325 Bacteria 817
75 Ga0157376_10149902 3300014969 Bacteria 2102
76 Ga0209646_1005935 3300025246 Bacteria 2087
77 Ga0209026_1000002 3300025250 Bacteria 1136158
78 Ga0209148_1000072 3300025254 Bacteria 325292
79 Ga0209759_1000238 3300025256 Bacteria 81844
80 Ga0209233_1000027 3300025261 Bacteria 652089
81 Ga0209455_1000133 3300025272 Bacteria 155670
82 Ga0209758_1004666 3300025297 Bacteria 11205
83 Ga0207647_10007295 3300025904 Bacteria 8002
84 Ga0207647_10246978 3300025904 Bacteria 1024
85 Ga0207654_10626564 3300025911 Bacteria 769
86 Ga0207695_10133453 3300025913 Bacteria 2438
87 Ga0207695_10717231 3300025913 Bacteria 880
88 Ga0207695_10750252 3300025913 Bacteria 856
89 Ga0207671_10080777 3300025914 Bacteria 2438
90 Ga0207671_10167906 3300025914 Bacteria 1702
91 Ga0207671_10262702 3300025914 Bacteria 1359
92 Ga0207657_10067335 3300025919 Bacteria 3045
93 Ga0207694_10011467 3300025924 Bacteria 6689
94 Ga0207694_10303552 3300025924 Bacteria 1315
95 Ga0207687_10085856 3300025927 Bacteria 2284
96 Ga0207706_10407616 3300025933 Bacteria 1178
97 Ga0207691_10916497 3300025940 Bacteria 733
98 Ga0207667_10374174 3300025949 Bacteria 1452
99 Ga0207640_10694877 3300025981 Bacteria 871
100 Ga0207640_10805073 3300025981 Bacteria 814
101 Ga0207658_10811288 3300025986 Bacteria 850
102 Ga0207658_10942419 3300025986 Bacteria 787
103 Ga0207639_10007716 3300026041 Bacteria 7347
104 Ga0207639_10095870 3300026041 Bacteria 2385
105 Ga0207639_10878230 3300026041 Bacteria 838
106 Ga0207678_10159521 3300026067 Bacteria 1926
107 Ga0207674_10049988 3300026116 Bacteria 4274
108 Ga0207683_10526335 3300026121 Bacteria 1093
109 Ga0207698_10139586 3300026142 Bacteria 2085
110 Ga0268266_10219196 3300028379 Bacteria 1748
111 Ga0268266_10398361 3300028379 Bacteria 1301
112 Ga0307513_10121454 3300031456 Bacteria 2579
113 Ga0395900_0120094 3300037418 Bacteria 2697
114 Ga0395900_0778444 3300037418 Bacteria 886
115 Ga0395898_0142492 3300037466 Bacteria 2295
116 Ga0395905_0083642 3300037471 Bacteria 2990
117 Ga0395905_0126819 3300037471 Bacteria 2400
118 Ga0395905_0534247 3300037471 Bacteria 1073
119 Ga0395901_0106272 3300038443 Bacteria 2946
120 Ga0395901_0200580 3300038443 Bacteria 2091
121 Ga0395901_0229592 3300038443 Bacteria 1938
122 Ga0439438_037695 3300041405 Bacteria 1264
123 Ga0451804_0053516 3300041463 Bacteria 760
124 Ga0466972_0097485 3300044658 Bacteria 1392
125 Ga0466963_0976148 3300044694 Bacteria 597
126 Ga0495638_0058963 3300046460 Bacteria 2378
127 Ga0495610_0114722 3300046512 Bacteria 1189
128 Ga0495643_0013750 3300046522 Bacteria 4834
129 Ga0495654_0234722 3300046530 Bacteria 770
130 Ga0495668_0111931 3300046616 Bacteria 1493
131 Ga0495625_0025308 3300046660 Bacteria 4502
132 Ga0495669_0321555 3300046684 Bacteria 747
133 Ga0495649_0535565 3300046694 Bacteria 581
134 Ga0495660_0079674 3300046810 Bacteria 1720
135 Ga0496100_0525244 3300048903 Bacteria 914
136 Ga0496102_0101372 3300048905 Bacteria 2674
137 Ga0496105_0495982 3300048908 Bacteria 959
138 Ga0496105_0653955 3300048908 Bacteria 811
139 Ga0496112_0083144 3300048915 Bacteria 3166
140 Ga0496113_0099540 3300048916 Bacteria 2252
141 Ga0496113_0861566 3300048916 Bacteria 718
142 Ga0496114_0395663 3300048917 Bacteria 1224
143 Ga0496118_0082833 3300048921 Bacteria 2246
144 Ga0496118_0407326 3300048921 Bacteria 704
145 Ga0496119_0058856 3300048922 Bacteria 2312
146 Ga0496119_0144643 3300048922 Bacteria 1280
147 Ga0496120_0009952 3300048923 Bacteria 6687
148 Ga0496124_0137897 3300048927 Bacteria 1929
149 Ga0496125_0082905 3300048928 Bacteria 2442
150 Ga0496126_0135127 3300048929 Bacteria 2128
151 Ga0496126_0220502 3300048929 Bacteria 1593
152 nmdc:mga03683_209529_c1 3300050489 Bacteria 896
153 nmdc:mga03683_598177_c1 3300050489 Bacteria 540
154 nmdc:mga03n38_117032_c1 3300050490 Bacteria 1305
155 nmdc:mga03n38_77763_c1 3300050490 Bacteria 1552
156 nmdc:mga00v17_160382_c1 3300050491 Bacteria 1447
157 nmdc:mga0yw44_161074_c1 3300050492 Bacteria 1469
158 nmdc:mga0yw44_170025_c1 3300050492 Bacteria 1431
159 nmdc:mga0k408_59239_c1 3300050493 Bacteria 2224
160 nmdc:mga06z11_109951_c1 3300050494 Bacteria 1525
161 nmdc:mga06z11_237194_c1 3300050494 Bacteria 1070
162 nmdc:mga06z11_59403_c1 3300050494 Bacteria 1987
163 nmdc:mga04h51_96181_c1 3300050495 Bacteria 1073
164 nmdc:mga07m45_24381_c1 3300050496 Bacteria 3313
165 nmdc:mga07m45_338095_c1 3300050496 Bacteria 875
166 nmdc:mga0sz30_1064_c2 3300050516 Bacteria 4118
167 nmdc:mga0sz30_61555_c1 3300050516 Bacteria 1604
168 Ga0500610_0015016 3300053079 Bacteria 3652
169 Ga0500651_0117980 3300053093 Bacteria 1614
170 Ga0500595_127226 3300053119 Bacteria 718
171 Ga0500568_0143024 3300053139 Bacteria 886
172 Ga0500604_0046180 3300053151 Bacteria 1331
173 Ga0500620_000496 3300053155 Bacteria 6901
174 Ga0500620_061651 3300053155 Bacteria 1277
175 Ga0500627_0069074 3300053158 Bacteria 1562
176 Ga0500627_0351718 3300053158 Bacteria 635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2878788777 2878794258 126
2 iso_pu_bacteria 2958041894 2958057377 127
3 3300046530 Ga0495654_0234722 Ga0495654_0234722_221_649 133
4 iso_pu_bacteria 2906393657 2906399258 135
5 iso_pu_bacteria 2906401398 2906402757 139
6 3300006177 Ga0075362_10501252 Ga0075362_105012521 144
7 3300006178 Ga0075367_10056250 Ga0075367_100562503 144
8 3300050489 nmdc:mga03683_209529_c1 nmdc:mga03683_209529_c1_73_561 144
9 3300050494 nmdc:mga06z11_237194_c1 nmdc:mga06z11_237194_c1_172_660 144
10 iso_pu_bacteria 2643221551 2643775531 145
11 iso_pu_bacteria 2643221555 2643793977 145
12 iso_pu_bacteria 2874139085 2874145220 145
13 iso_pu_bacteria 2509276022 2509396870 146
14 iso_pu_bacteria 2856320880 2856325854 146
15 iso_pu_bacteria 2869278585 2869278634 146
16 iso_pu_bacteria 2878738818 2878743417 146
17 iso_pu_bacteria 2888337043 2888340150 146
18 iso_pu_bacteria 2924718760 2924726346 146
19 iso_pu_bacteria 2924776078 2924781229 146
20 iso_pu_bacteria 2937877337 2937878990 146
21 iso_pu_bacteria 2937972304 2937975264 146
22 iso_pu_bacteria 2958034702 2958034750 146
23 iso_pu_bacteria 2958041894 2958043122 146
24 iso_pu_bacteria 2958064165 2958067000 146
25 iso_pu_bacteria 2958084443 2958086164 146
26 iso_pu_bacteria 2958092219 2958100841 146
27 iso_pu_bacteria 2958144490 2958149506 146
28 iso_pu_bacteria 2968016561 2968017842 146
29 iso_pu_bacteria 2970469710 2970471983 146
30 iso_pu_bacteria 2970593180 2970593230 146
31 iso_pu_bacteria 2996348954 2996350916 146
32 iso_pu_bacteria 3004275668 3004277614 146
33 iso_pu_bacteria 3004289098 3004296839 146
34 iso_pu_bacteria 2885312484 2885317126 148
35 iso_pu_bacteria 2937822353 2937827291 149
36 3300005937 Ga0081455_10249075 Ga0081455_102490752 150
37 iso_pu_bacteria 2508501123 2509117029 150
38 iso_pu_bacteria 2512875024 2512958604 150
39 iso_pu_bacteria 2513237164 2514034980 150
40 iso_pu_bacteria 2597489875 2597814086 150
41 iso_pu_bacteria 2882632389 2882633853 150
42 3300048922 Ga0496119_0058856 Ga0496119_0058856_622_1098 151
43 3300048923 Ga0496120_0009952 Ga0496120_0009952_1903_2379 151
44 iso_pu_bacteria 2588253730 2588516556 151
45 iso_pu_bacteria 2924762789 2924768972 151
46 iso_pu_bacteria 2987666974 2987670650 151
47 3300005339 Ga0070660_100355666 Ga0070660_1003556661 152
48 3300005367 Ga0070667_100388553 Ga0070667_1003885532 152
49 3300005455 Ga0070663_100498532 Ga0070663_1004985321 152
50 3300005539 Ga0068853_101015761 Ga0068853_1010157612 152
51 3300005578 Ga0068854_101166940 Ga0068854_1011669402 152
52 3300005616 Ga0068852_100080759 Ga0068852_1000807592 152
53 3300006038 Ga0075365_10028017 Ga0075365_100280173 152
54 3300006042 Ga0075368_10046102 Ga0075368_100461023 152
55 3300006048 Ga0075363_100016337 Ga0075363_1000163376 152
56 3300006178 Ga0075367_10022865 Ga0075367_100228654 152
57 3300006353 Ga0075370_10089242 Ga0075370_100892423 152
58 3300009093 Ga0105240_10663909 Ga0105240_106639092 152
59 3300009093 Ga0105240_10810666 Ga0105240_108106662 152
60 3300009545 Ga0105237_10119290 Ga0105237_101192903 152
61 3300009551 Ga0105238_10600626 Ga0105238_106006262 152
62 3300010375 Ga0105239_10324605 Ga0105239_103246052 152
63 3300013105 Ga0157369_10434499 Ga0157369_104344992 152
64 3300025913 Ga0207695_10717231 Ga0207695_107172312 152
65 3300025914 Ga0207671_10262702 Ga0207671_102627022 152
66 3300025919 Ga0207657_10067335 Ga0207657_100673352 152
67 3300025981 Ga0207640_10694877 Ga0207640_106948772 152
68 3300026041 Ga0207639_10095870 Ga0207639_100958702 152
69 3300026067 Ga0207678_10159521 Ga0207678_101595212 152
70 3300026121 Ga0207683_10526335 Ga0207683_105263352 152
71 3300026142 Ga0207698_10139586 Ga0207698_101395863 152
72 3300046660 Ga0495625_0025308 Ga0495625_0025308_2527_2997 152
73 3300048908 Ga0496105_0653955 Ga0496105_0653955_286_756 152
74 3300048917 Ga0496114_0395663 Ga0496114_0395663_443_913 152
75 3300048927 Ga0496124_0137897 Ga0496124_0137897_1287_1760 152
76 3300050494 nmdc:mga06z11_109951_c1 nmdc:mga06z11_109951_c1_196_666 152
77 3300050495 nmdc:mga04h51_96181_c1 nmdc:mga04h51_96181_c1_62_532 152
78 3300050496 nmdc:mga07m45_24381_c1 nmdc:mga07m45_24381_c1_619_1089 152
79 3300053093 Ga0500651_0117980 Ga0500651_0117980_43_513 152
80 3300053158 Ga0500627_0351718 Ga0500627_0351718_50_520 152
81 iso_pu_bacteria 2503198000 2503202222 152
82 iso_pu_bacteria 2509276018 2509370701 152
83 iso_pu_bacteria 2513237305 2514418942 152
84 iso_pu_bacteria 2687453392 2688599416 152
85 iso_pu_bacteria 2721755686 2723576376 152
86 iso_pu_bacteria 2856334872 2856340034 152
87 iso_pu_bacteria 2857367948 2857368568 152
88 iso_pu_bacteria 2869234852 2869239590 152
89 iso_pu_bacteria 2869249662 2869253171 152
90 iso_pu_bacteria 2869264136 2869266559 152
91 iso_pu_bacteria 2871451962 2871458156 152
92 iso_pu_bacteria 2871459585 2871462364 152
93 iso_pu_bacteria 2874109183 2874114686 152
94 iso_pu_bacteria 2874131515 2874137982 152
95 iso_pu_bacteria 2876363079 2876365449 152
96 iso_pu_bacteria 2876369609 2876375393 152
97 iso_pu_bacteria 2878781027 2878788450 152
98 iso_pu_bacteria 2881147464 2881152853 152
99 iso_pu_bacteria 2885326080 2885327480 152
100 iso_pu_bacteria 2888343758 2888347474 152
101 iso_pu_bacteria 2903448605 2903455615 152
102 iso_pu_bacteria 2903521522 2903522805 152
103 iso_pu_bacteria 2903528002 2903532995 152
104 iso_pu_bacteria 2906363423 2906365856 152
105 iso_pu_bacteria 2906370794 2906373937 152
106 iso_pu_bacteria 2922151315 2922157458 152
107 iso_pu_bacteria 2924754689 2924759548 152
108 iso_pu_bacteria 2937848649 2937849126 152
109 iso_pu_bacteria 2937868953 2937869716 152
110 iso_pu_bacteria 2958122699 2958123128 152
111 iso_pu_bacteria 2965032056 2965037790 152
112 iso_pu_bacteria 2965040258 2965043890 152
113 iso_pu_bacteria 2965089291 2965095806 152
114 iso_pu_bacteria 2965110997 2965117102 152
115 iso_pu_bacteria 2970489779 2970495831 152
116 iso_pu_bacteria 2970540015 2970544282 152
117 iso_pu_bacteria 2977872689 2977875408 152
118 iso_pu_bacteria 2977915119 2977919634 152
119 iso_pu_bacteria 2977922695 2977923095 152
120 iso_pu_bacteria 2977950692 2977952626 152
121 iso_pu_bacteria 2977957713 2977958992 152
122 iso_pu_bacteria 2977986579 2977989089 152
123 iso_pu_bacteria 2979793036 2979798417 152
124 iso_pu_bacteria 2987673487 2987675129 152
125 iso_pu_bacteria 3004167301 3004169597 152
126 iso_pu_bacteria 3004195979 3004196865 152
127 iso_pu_bacteria 3004211236 3004211675 152
128 iso_pu_bacteria 3004218560 3004218922 152
129 iso_pu_bacteria 3004232784 3004238885 152
130 iso_pu_bacteria 3004239961 3004242640 152
131 iso_pu_bacteria 649633066 649873920 152
132 iso_pu_bacteria 8004361976 8004363782 152
133 iso_pu_bacteria 8004395343 8004403552 152
134 3300005293 Ga0065715_10061952 Ga0065715_100619522 153
135 3300005356 Ga0070674_101414364 Ga0070674_1014143642 153
136 3300005548 Ga0070665_101182672 Ga0070665_1011826722 153
137 3300006048 Ga0075363_100081499 Ga0075363_1000814993 153
138 3300006051 Ga0075364_10329081 Ga0075364_103290812 153
139 3300006177 Ga0075362_10048842 Ga0075362_100488422 153
140 3300006178 Ga0075367_10511048 Ga0075367_105110482 153
141 3300006195 Ga0075366_10343500 Ga0075366_103435002 153
142 3300009551 Ga0105238_10636913 Ga0105238_106369133 153
143 3300014969 Ga0157376_10149902 Ga0157376_101499024 153
144 3300025933 Ga0207706_10407616 Ga0207706_104076162 153
145 3300025940 Ga0207691_10916497 Ga0207691_109164972 153
146 3300025986 Ga0207658_10942419 Ga0207658_109424192 153
147 3300028379 Ga0268266_10398361 Ga0268266_103983612 153
148 3300031456 Ga0307513_10121454 Ga0307513_101214543 153
149 3300041405 Ga0439438_037695 Ga0439438_037695_309_782 153
150 3300041463 Ga0451804_0053516 Ga0451804_0053516_159_632 153
151 3300046512 Ga0495610_0114722 Ga0495610_0114722_10_483 153
152 3300046522 Ga0495643_0013750 Ga0495643_0013750_3278_3751 153
153 3300046684 Ga0495669_0321555 Ga0495669_0321555_13_486 153
154 3300046694 Ga0495649_0535565 Ga0495649_0535565_92_565 153
155 3300046810 Ga0495660_0079674 Ga0495660_0079674_1143_1616 153
156 3300050489 nmdc:mga03683_598177_c1 nmdc:mga03683_598177_c1_44_517 153
157 3300050490 nmdc:mga03n38_77763_c1 nmdc:mga03n38_77763_c1_27_494 153
158 3300050492 nmdc:mga0yw44_170025_c1 nmdc:mga0yw44_170025_c1_664_1143 153
159 3300050493 nmdc:mga0k408_59239_c1 nmdc:mga0k408_59239_c1_1145_1624 153
160 3300050516 nmdc:mga0sz30_61555_c1 nmdc:mga0sz30_61555_c1_410_883 153
161 3300053079 Ga0500610_0015016 Ga0500610_0015016_2119_2592 153
162 3300053151 Ga0500604_0046180 Ga0500604_0046180_234_707 153
163 3300053155 Ga0500620_000496 Ga0500620_000496_4368_4835 153
164 3300053155 Ga0500620_061651 Ga0500620_061651_656_1129 153
165 3300053158 Ga0500627_0069074 Ga0500627_0069074_120_593 153
166 iso_pu_bacteria 2510065059 2510317492 153
167 iso_pu_bacteria 2844009547 2844014694 153
168 iso_pu_bacteria 2856328259 2856328968 153
169 iso_pu_bacteria 2869169390 2869174781 153
170 iso_pu_bacteria 2869242130 2869248317 153
171 iso_pu_bacteria 2869256925 2869262525 153
172 iso_pu_bacteria 2869271264 2869276167 153
173 iso_pu_bacteria 2871435913 2871438317 153
174 iso_pu_bacteria 2874116593 2874117789 153
175 iso_pu_bacteria 2874162495 2874167268 153
176 iso_pu_bacteria 2876386047 2876386071 153
177 iso_pu_bacteria 2876399893 2876405871 153
178 iso_pu_bacteria 2876406927 2876407646 153
179 iso_pu_bacteria 2878774303 2878774802 153
180 iso_pu_bacteria 2885305155 2885310317 153
181 iso_pu_bacteria 2885334103 2885341436 153
182 iso_pu_bacteria 2906386501 2906389296 153
183 iso_pu_bacteria 2906408224 2906412652 153
184 iso_pu_bacteria 2922172374 2922177097 153
185 iso_pu_bacteria 2924710171 2924711480 153
186 iso_pu_bacteria 2924741084 2924745201 153
187 iso_pu_bacteria 2924748358 2924750719 153
188 iso_pu_bacteria 2937861824 2937866859 153
189 iso_pu_bacteria 2937980651 2937981197 153
190 iso_pu_bacteria 2958108152 2958115113 153
191 iso_pu_bacteria 2958137437 2958142068 153
192 iso_pu_bacteria 2958158011 2958160338 153
193 iso_pu_bacteria 2961136820 2961137641 153
194 iso_pu_bacteria 2961183825 2961189103 153
195 iso_pu_bacteria 2965025482 2965029517 153
196 iso_pu_bacteria 2965102966 2965109163 153
197 iso_pu_bacteria 2968138860 2968143940 153
198 iso_pu_bacteria 2970510686 2970512679 153
199 iso_pu_bacteria 2970532167 2970538464 153
200 iso_pu_bacteria 2970547951 2970550045 153
201 iso_pu_bacteria 2970619444 2970621103 153
202 iso_pu_bacteria 2970627176 2970631149 153
203 iso_pu_bacteria 2977851361 2977858085 153
204 iso_pu_bacteria 2977898635 2977905829 153
205 iso_pu_bacteria 2977935797 2977941414 153
206 iso_pu_bacteria 2979764755 2979770529 153
207 iso_pu_bacteria 2979772303 2979776715 153
208 iso_pu_bacteria 2987645492 2987648696 153
209 iso_pu_bacteria 2996386984 2996392575 153
210 iso_pu_bacteria 3004248173 3004254302 153
211 iso_pu_bacteria 8004300914 8004303253 153
212 iso_pu_bacteria 8004312739 8004314619 153
213 iso_pu_bacteria 8004695233 8004699786 153
214 iso_pu_bacteria 8004727605 8004733071 153
215 3300003762 Ga0055542_1000775 Ga0055542_100077522 154
216 3300003762 Ga0055542_1001096 Ga0055542_100109619 154
217 3300003763 Ga0055529_1003883 Ga0055529_10038833 154
218 3300005335 Ga0070666_10374270 Ga0070666_103742702 154
219 3300005344 Ga0070661_100769006 Ga0070661_1007690062 154
220 3300006038 Ga0075365_10343205 Ga0075365_103432052 154
221 3300006048 Ga0075363_100159900 Ga0075363_1001599002 154
222 3300009093 Ga0105240_10997810 Ga0105240_109978102 154
223 3300009174 Ga0105241_10085431 Ga0105241_100854314 154
224 3300009545 Ga0105237_10306547 Ga0105237_103065473 154
225 3300010375 Ga0105239_10060355 Ga0105239_100603552 154
226 3300013104 Ga0157370_10738510 Ga0157370_107385101 154
227 3300014325 Ga0163163_11211853 Ga0163163_112118532 154
228 3300025254 Ga0209148_1000072 Ga0209148_1000072252 154
229 3300025272 Ga0209455_1000133 Ga0209455_100013333 154
230 3300025911 Ga0207654_10626564 Ga0207654_106265642 154
231 3300025914 Ga0207671_10167906 Ga0207671_101679062 154
232 3300025924 Ga0207694_10303552 Ga0207694_103035523 154
233 3300025927 Ga0207687_10085856 Ga0207687_100858561 154
234 3300026041 Ga0207639_10878230 Ga0207639_108782302 154
235 3300048915 Ga0496112_0083144 Ga0496112_0083144_2306_2782 154
236 3300048916 Ga0496113_0099540 Ga0496113_0099540_461_937 154
237 3300048921 Ga0496118_0082833 Ga0496118_0082833_879_1355 154
238 3300048922 Ga0496119_0144643 Ga0496119_0144643_368_862 154
239 3300048929 Ga0496126_0135127 Ga0496126_0135127_1194_1670 154
240 3300050490 nmdc:mga03n38_117032_c1 nmdc:mga03n38_117032_c1_281_751 154
241 3300053119 Ga0500595_127226 Ga0500595_127226_32_526 154
242 3300053139 Ga0500568_0143024 Ga0500568_0143024_167_661 154
243 iso_pu_bacteria 2512875016 2512930879 154
244 iso_pu_bacteria 2599185301 2599938069 154
245 iso_pu_bacteria 2693429783 2694632202 154
246 iso_pu_bacteria 2693429784 2694634390 154
247 iso_pu_bacteria 2847670302 2847676306 154
248 iso_pu_bacteria 2856314179 2856316090 154
249 iso_pu_bacteria 2856342000 2856343706 154
250 iso_pu_bacteria 2856349417 2856351934 154
251 iso_pu_bacteria 2856364286 2856368832 154
252 iso_pu_bacteria 2857349434 2857350197 154
253 iso_pu_bacteria 2869285874 2869291327 154
254 iso_pu_bacteria 2871429161 2871433607 154
255 iso_pu_bacteria 2874123672 2874125987 154
256 iso_pu_bacteria 2874146452 2874153208 154
257 iso_pu_bacteria 2874155637 2874160473 154
258 iso_pu_bacteria 2876377896 2876381803 154
259 iso_pu_bacteria 2876392853 2876394981 154
260 iso_pu_bacteria 2876413966 2876419499 154
261 iso_pu_bacteria 2878035449 2878040358 154
262 iso_pu_bacteria 2878745973 2878751218 154
263 iso_pu_bacteria 2881155292 2881156349 154
264 iso_pu_bacteria 2881161766 2881168320 154
265 iso_pu_bacteria 2881853255 2881857157 154
266 iso_pu_bacteria 2885350715 2885356286 154
267 iso_pu_bacteria 2889010040 2889011466 154
268 iso_pu_bacteria 2889016732 2889016803 154
269 iso_pu_bacteria 2903492973 2903501716 154
270 iso_pu_bacteria 2904659560 2904661612 154
271 iso_pu_bacteria 2906308376 2906313159 154
272 iso_pu_bacteria 2906321335 2906325870 154
273 iso_pu_bacteria 2906354277 2906362303 154
274 iso_pu_bacteria 2906414383 2906416227 154
275 iso_pu_bacteria 2922185730 2922187720 154
276 iso_pu_bacteria 2937813078 2937820690 154
277 iso_pu_bacteria 2938014810 2938019389 154
278 iso_pu_bacteria 2958100919 2958106749 154
279 iso_pu_bacteria 2958130278 2958135727 154
280 iso_pu_bacteria 2958172287 2958173160 154
281 iso_pu_bacteria 2958179912 2958185218 154
282 iso_pu_bacteria 2961077736 2961083485 154
283 iso_pu_bacteria 2961114664 2961116765 154
284 iso_pu_bacteria 2961127735 2961132809 154
285 iso_pu_bacteria 2963644680 2963648346 154
286 iso_pu_bacteria 2965119406 2965124173 154
287 iso_pu_bacteria 2968083720 2968084859 154
288 iso_pu_bacteria 2968110612 2968112672 154
289 iso_pu_bacteria 2968117919 2968123095 154
290 iso_pu_bacteria 2970524798 2970531722 154
291 iso_pu_bacteria 2977843712 2977848988 154
292 iso_pu_bacteria 2977864932 2977872521 154
293 iso_pu_bacteria 2977942078 2977948237 154
294 iso_pu_bacteria 2977971508 2977974048 154
295 iso_pu_bacteria 2979710463 2979713212 154
296 iso_pu_bacteria 2979742915 2979743205 154
297 iso_pu_bacteria 2987636660 2987637385 154
298 iso_pu_bacteria 3004203850 3004206218 154
299 iso_pu_bacteria 3004334049 3004340993 154
300 iso_pu_bacteria 637000159 637073925 154
301 iso_pu_bacteria 8004387939 8004394117 154
302 iso_pu_bacteria 8004640170 8004646686 154
303 iso_pu_bacteria 8004714634 8004719416 154
304 3300006038 Ga0075365_10088195 Ga0075365_100881952 155
305 3300006048 Ga0075363_100338812 Ga0075363_1003388122 155
306 3300006051 Ga0075364_10482249 Ga0075364_104822491 155
307 3300006186 Ga0075369_10017256 Ga0075369_100172561 155
308 3300050491 nmdc:mga00v17_160382_c1 nmdc:mga00v17_160382_c1_671_1147 155
309 3300050494 nmdc:mga06z11_59403_c1 nmdc:mga06z11_59403_c1_206_679 155
310 3300050516 nmdc:mga0sz30_1064_c2 nmdc:mga0sz30_1064_c2_1370_1846 155
311 iso_pu_bacteria 3004268573 3004275209 155
312 3300003214 JGI25165J46597_1000087 JGI25165J46597_100008761 156
313 3300003214 JGI25165J46597_1000139 JGI25165J46597_100013944 156
314 3300025261 Ga0209233_1000027 Ga0209233_1000027321 156
315 iso_pu_bacteria 2508501127 2509140631 156
316 iso_pu_bacteria 2871495908 2871500738 156
317 iso_pu_bacteria 2878760144 2878764827 156
318 iso_pu_bacteria 2878767105 2878771928 156
319 iso_pu_bacteria 2903540706 2903545551 156
320 iso_pu_bacteria 2937994558 2937999401 156
321 iso_pu_bacteria 2958165035 2958169875 156
322 iso_pu_bacteria 2961163497 2961168335 156
323 iso_pu_bacteria 2965018300 2965023154 156
324 iso_pu_bacteria 2968171901 2968176735 156
325 iso_pu_bacteria 2970554993 2970559674 156
326 iso_pu_bacteria 2987659509 2987664349 156
327 iso_pu_bacteria 3004188549 3004193404 156
328 iso_pu_bacteria 8055617313 8055621540 156
329 3300002705 JGI25156J39149_1004603 JGI25156J39149_10046036 157
330 3300002741 JGI25157J39369_1000136 JGI25157J39369_100013662 157
331 3300009093 Ga0105240_11267685 Ga0105240_112676852 157
332 3300025246 Ga0209646_1005935 Ga0209646_10059352 157
333 3300025250 Ga0209026_1000002 Ga0209026_1000002329 157
334 3300025256 Ga0209759_1000238 Ga0209759_100023815 157
335 3300025913 Ga0207695_10750252 Ga0207695_107502522 157
336 3300037418 Ga0395900_0120094 Ga0395900_0120094_2140_2613 157
337 3300038443 Ga0395901_0106272 Ga0395901_0106272_893_1366 157
338 3300038443 Ga0395901_0229592 Ga0395901_0229592_1393_1866 157
339 3300044694 Ga0466963_0976148 Ga0466963_0976148_39_512 157
340 3300048921 Ga0496118_0407326 Ga0496118_0407326_163_639 157
341 iso_pu_bacteria 2791355123 2792748529 157
342 iso_pu_bacteria 2841734538 2841740023 157
343 iso_pu_bacteria 2844002411 2844006448 157
344 iso_pu_bacteria 2871474448 2871475317 157
345 iso_pu_bacteria 2924733363 2924736241 157
346 iso_pu_bacteria 2937836603 2937837778 157
347 iso_pu_bacteria 2958071322 2958077517 157
348 iso_pu_bacteria 3000135777 3000138479 157
349 iso_pu_bacteria 8004633249 8004634066 157
350 3300005539 Ga0068853_100052118 Ga0068853_1000521184 158
351 3300005539 Ga0068853_101027516 Ga0068853_1010275162 158
352 3300005539 Ga0068853_101156389 Ga0068853_1011563892 158
353 3300009093 Ga0105240_10518614 Ga0105240_105186142 158
354 3300009545 Ga0105237_10011710 Ga0105237_100117109 158
355 3300009545 Ga0105237_10716514 Ga0105237_107165142 158
356 3300009551 Ga0105238_10157357 Ga0105238_101573574 158
357 3300010375 Ga0105239_12008841 Ga0105239_120088412 158
358 3300013105 Ga0157369_10277827 Ga0157369_102778273 158
359 3300025904 Ga0207647_10246978 Ga0207647_102469782 158
360 3300025913 Ga0207695_10133453 Ga0207695_101334532 158
361 3300025914 Ga0207671_10080777 Ga0207671_100807772 158
362 3300025924 Ga0207694_10011467 Ga0207694_100114675 158
363 3300026041 Ga0207639_10007716 Ga0207639_100077167 158
364 3300037418 Ga0395900_0778444 Ga0395900_0778444_147_623 158
365 3300037466 Ga0395898_0142492 Ga0395898_0142492_1104_1580 158
366 3300037471 Ga0395905_0083642 Ga0395905_0083642_1534_2010 158
367 3300037471 Ga0395905_0126819 Ga0395905_0126819_336_812 158
368 3300037471 Ga0395905_0534247 Ga0395905_0534247_309_785 158
369 3300038443 Ga0395901_0200580 Ga0395901_0200580_1304_1780 158
370 3300044658 Ga0466972_0097485 Ga0466972_0097485_643_1119 158
371 3300048903 Ga0496100_0525244 Ga0496100_0525244_305_784 158
372 3300048905 Ga0496102_0101372 Ga0496102_0101372_2042_2521 158
373 3300048928 Ga0496125_0082905 Ga0496125_0082905_1266_1745 158
374 3300048929 Ga0496126_0220502 Ga0496126_0220502_322_801 158
375 3300050492 nmdc:mga0yw44_161074_c1 nmdc:mga0yw44_161074_c1_121_609 158
376 iso_pu_bacteria 2874168670 2874176211 158
377 3300005347 Ga0070668_100485191 Ga0070668_1004851912 159
378 3300005548 Ga0070665_101318475 Ga0070665_1013184752 159
379 3300028379 Ga0268266_10219196 Ga0268266_102191962 159
380 3300046616 Ga0495668_0111931 Ga0495668_0111931_66_575 159
381 iso_pu_bacteria 2643221627 2644152970 159
382 iso_pu_bacteria 2756170246 2756675886 159
383 iso_pu_bacteria 2847686936 2847692957 159
384 iso_pu_bacteria 2871444079 2871449094 159
385 iso_pu_bacteria 2937891427 2937892882 159
386 iso_pu_bacteria 2965062239 2965065580 159
387 iso_pu_bacteria 2968091066 2968091801 159
388 iso_pu_bacteria 2968128360 2968129863 159
389 iso_pu_bacteria 2996341866 2996345254 159
390 iso_pu_bacteria 8004445564 8004445768 159
391 3300048908 Ga0496105_0495982 Ga0496105_0495982_317_832 160
392 3300048916 Ga0496113_0861566 Ga0496113_0861566_93_608 160
393 3300046460 Ga0495638_0058963 Ga0495638_0058963_1055_1573 161
394 3300001989 JGI24739J22299_10010716 JGI24739J22299_100107162 163
395 3300002067 JGI24735J21928_10030266 JGI24735J21928_100302663 163
396 3300005367 Ga0070667_101342831 Ga0070667_1013428311 163
397 3300005539 Ga0068853_100071337 Ga0068853_1000713375 163
398 3300005563 Ga0068855_100412289 Ga0068855_1004122893 163
399 3300005577 Ga0068857_100058913 Ga0068857_1000589132 163
400 3300005578 Ga0068854_100919572 Ga0068854_1009195721 163
401 3300005614 Ga0068856_100383084 Ga0068856_1003830843 163
402 3300006178 Ga0075367_10101895 Ga0075367_101018953 163
403 3300006186 Ga0075369_10263643 Ga0075369_102636432 163
404 3300006353 Ga0075370_10367944 Ga0075370_103679441 163
405 3300010375 Ga0105239_10052947 Ga0105239_100529477 163
406 3300025297 Ga0209758_1004666 Ga0209758_100466612 163
407 3300025904 Ga0207647_10007295 Ga0207647_100072954 163
408 3300025949 Ga0207667_10374174 Ga0207667_103741743 163
409 3300025981 Ga0207640_10805073 Ga0207640_108050731 163
410 3300025986 Ga0207658_10811288 Ga0207658_108112882 163
411 3300026116 Ga0207674_10049988 Ga0207674_100499887 163
412 3300050496 nmdc:mga07m45_338095_c1 nmdc:mga07m45_338095_c1_354_845 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

29

151

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qck-assembly1.cif.gz_A crystal structure of 3-ketosteroid-9-alpha-hydroxylase (ksha) from m. tuberculosis in complex with 4-androstene-3,17-dione 0.7953 74 122
1vjh-assembly1.cif.gz_A crystal structure of gene product of at1g24000 from arabidopsis thaliana 0.7422 13 122
6mna-assembly1.cif.gz_A crystal structure of lpqn involved in cell envelope biogenesis of mycobacterium tuberculosis 0.723 75 122
1xn6-assembly1.cif.gz_A solution structure of northeast structural genomics target protein bcr68 encoded in gene q816v6 of b. cereus 0.7207 13 125
1xn5-assembly1.cif.gz_A solution structure of bacillus halodurans protein bh1534: the northeast structural genomics consortium target bhr29 0.6981 13 125
ID Description Score Start End Superfamily
4qdcA02 Alpha Beta;Alpha-Beta Complex;Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1;Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 0.7856 74 122 3.90.380.10
af_B6SH63_306_429_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7338 9 123 3.30.310.80
1xn6A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7207 13 125 3.30.530.20
af_I1MSU0_301_424_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7155 9 122 3.30.310.80
af_A0A1D6FG83_297_420_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7141 8 124 3.30.310.80
ID Description Score Start End GO Terms
AF-A0A1S1Q9I0-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.7576 13 124
AF-A0A3A4UNL8-F1-model_v4 DEAD/DEAH box helicase 0.7066 74 122 GO:0006289
GO:0036297
GO:0043138
AF-A0A7S4IFF3-F1-model_v4 GST C-terminal domain-containing protein 0.6695 14 124
AF-A0A1A1XRR6-F1-model_v4 deleted 0.6668 13 126
AF-A0A0Q6M4D1-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.6641 13 126

Feature Viewer

pLDDT pTM Quality
61.88 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map