F437855

General Info

Members Datasets Scaffolds Average Seq Length
412 212 412 116

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0689509|Ga0395898_0689509_105_497
Length 130
Sequence MKIFSCAAWHNVAVPDSLRQFKTEIFQALANPTRIAILDELRDGELTVGDLGKRLSVEQSNLSQHLAIMRARQILIGRKSGSQVFYSVRDPLIFKLLDLMRVYFQNQVSESIVLLEAMEGKPRRKSASRR

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
209 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 0.49
Rhizosphere 97.33
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10000766 3300005295 Bacteria 12749
2 Ga0070658_10013401 3300005327 Bacteria 6578
3 Ga0070658_11345460 3300005327 Bacteria 620
4 Ga0070676_10390462 3300005328 Bacteria 966
5 Ga0070676_11561113 3300005328 Bacteria 509
6 Ga0070683_100033399 3300005329 Bacteria 4692
7 Ga0070683_100371028 3300005329 Bacteria 1363
8 Ga0070680_100007056 3300005336 Bacteria 8564
9 Ga0070682_100081419 3300005337 Bacteria 2096
10 Ga0070660_100076863 3300005339 Bacteria 2615
11 Ga0070660_100353666 3300005339 Unclassified 1210
12 Ga0070689_100058220 3300005340 Bacteria 3001
13 Ga0070691_10175783 3300005341 Bacteria 1112
14 Ga0070668_100277885 3300005347 Bacteria 1398
15 Ga0070675_100249464 3300005354 Bacteria 1553
16 Ga0070671_100057776 3300005355 Unclassified 3229
17 Ga0070673_100041204 3300005364 Bacteria 3549
18 Ga0070673_100236903 3300005364 Unclassified 1585
19 Ga0070659_100155871 3300005366 Unclassified 1865
20 Ga0070709_10526214 3300005434 Unclassified 902
21 Ga0070714_100334922 3300005435 Unclassified 1418
22 Ga0070714_100623911 3300005435 Unclassified 1036
23 Ga0070714_101076908 3300005435 Bacteria 783
24 Ga0070714_101986945 3300005435 Unclassified 567
25 Ga0070713_100023568 3300005436 Bacteria 4779
26 Ga0070713_100054356 3300005436 Unclassified 3322
27 Ga0070713_100070300 3300005436 Bacteria 2955
28 Ga0070713_100985232 3300005436 Unclassified 813
29 Ga0070713_101446959 3300005436 Bacteria 667
30 Ga0070713_101707358 3300005436 Unclassified 611
31 Ga0070711_100199509 3300005439 Bacteria 1543
32 Ga0070711_101968547 3300005439 Bacteria 514
33 Ga0070705_100939595 3300005440 Bacteria 698
34 Ga0070700_101425035 3300005441 Unclassified 586
35 Ga0070708_101876069 3300005445 Unclassified 556
36 Ga0070663_101554113 3300005455 Bacteria 589
37 Ga0070678_100413745 3300005456 Bacteria 1174
38 Ga0070662_100118076 3300005457 Bacteria 2030
39 Ga0070662_100174309 3300005457 Unclassified 1691
40 Ga0070662_101522238 3300005457 Unclassified 577
41 Ga0070681_10011903 3300005458 Bacteria 8627
42 Ga0070681_10302787 3300005458 Bacteria 1508
43 Ga0070681_10984954 3300005458 Unclassified 763
44 Ga0070681_11022999 3300005458 Bacteria 746
45 Ga0068867_100007090 3300005459 Bacteria 7921
46 Ga0068867_100172460 3300005459 Unclassified 1714
47 Ga0068867_100270584 3300005459 Bacteria 1389
48 Ga0070685_10243786 3300005466 Unclassified 1187
49 Ga0070685_10425195 3300005466 Bacteria 925
50 Ga0070706_100858653 3300005467 Bacteria 839
51 Ga0070698_101298643 3300005471 Unclassified 678
52 Ga0070698_102198897 3300005471 Unclassified 505
53 Ga0070699_100794100 3300005518 Bacteria 866
54 Ga0070679_100020869 3300005530 Bacteria 6390
55 Ga0070679_100071399 3300005530 Unclassified 3463
56 Ga0070679_101558639 3300005530 Bacteria 608
57 Ga0070684_100052726 3300005535 Unclassified 3538
58 Ga0070684_100598824 3300005535 Bacteria 1025
59 Ga0068853_100194728 3300005539 Bacteria 1843
60 Ga0068853_100290643 3300005539 Bacteria 1509
61 Ga0070672_100315026 3300005543 Bacteria 1329
62 Ga0070672_100401265 3300005543 Bacteria 1175
63 Ga0070693_100038451 3300005547 Bacteria 2674
64 Ga0070693_100513026 3300005547 Bacteria 852
65 Ga0070693_100534171 3300005547 Unclassified 837
66 Ga0070665_100170167 3300005548 Bacteria 2180
67 Ga0070665_100687470 3300005548 Unclassified 1036
68 Ga0068855_100019398 3300005563 Bacteria 8170
69 Ga0068855_100156008 3300005563 Bacteria 2593
70 Ga0068855_101356233 3300005563 Bacteria 734
71 Ga0068855_101521885 3300005563 Unclassified 686
72 Ga0070664_100168857 3300005564 Unclassified 1940
73 Ga0070664_101180089 3300005564 Unclassified 722
74 Ga0068857_100040558 3300005577 Bacteria 4128
75 Ga0068857_100370769 3300005577 Bacteria 1328
76 Ga0068857_101316255 3300005577 Bacteria 701
77 Ga0068857_101419910 3300005577 Bacteria 675
78 Ga0068854_100065209 3300005578 Unclassified 2647
79 Ga0068854_100155598 3300005578 Unclassified 1766
80 Ga0068856_100124661 3300005614 Bacteria 2579
81 Ga0068856_100401461 3300005614 Unclassified 1390
82 Ga0068856_100474137 3300005614 Unclassified 1272
83 Ga0068856_100628893 3300005614 Bacteria 1094
84 Ga0068856_100801185 3300005614 Bacteria 962
85 Ga0068856_101874158 3300005614 Bacteria 611
86 Ga0068856_101981039 3300005614 Bacteria 593
87 Ga0068852_100013857 3300005616 Bacteria 6183
88 Ga0068852_100032052 3300005616 Bacteria 4347
89 Ga0068852_100431644 3300005616 Bacteria 1301
90 Ga0068852_100773743 3300005616 Bacteria 973
91 Ga0068859_100157083 3300005617 Bacteria 2352
92 Ga0068864_100110994 3300005618 Bacteria 2443
93 Ga0068864_101174030 3300005618 Bacteria 766
94 Ga0068866_10059192 3300005718 Unclassified 1981
95 Ga0068866_10212115 3300005718 Unclassified 1163
96 Ga0068866_10244601 3300005718 Bacteria 1094
97 Ga0068861_101520672 3300005719 Bacteria 657
98 Ga0068851_10534396 3300005834 Bacteria 707
99 Ga0068858_100925821 3300005842 Bacteria 853
100 Ga0068860_100178192 3300005843 Unclassified 2054
101 Ga0070717_10472991 3300006028 Bacteria 1131
102 Ga0070717_10558597 3300006028 Unclassified 1037
103 Ga0075364_10426790 3300006051 Bacteria 905
104 Ga0070716_100579891 3300006173 Unclassified 841
105 Ga0070712_100007100 3300006175 Bacteria 6988
106 Ga0070712_100675784 3300006175 Unclassified 879
107 Ga0075367_10087426 3300006178 Bacteria 1893
108 Ga0075366_10744287 3300006195 Bacteria 609
109 Ga0097621_100095364 3300006237 Bacteria 2495
110 Ga0068871_100026564 3300006358 Bacteria 4519
111 Ga0068871_100208556 3300006358 Unclassified 1689
112 Ga0068871_100420111 3300006358 Bacteria 1194
113 Ga0068871_100627522 3300006358 Bacteria 979
114 Ga0075428_100170969 3300006844 Unclassified 2355
115 Ga0075431_100133626 3300006847 Unclassified 2558
116 Ga0075429_100242435 3300006880 Unclassified 1579
117 Ga0068865_100441094 3300006881 Bacteria 1074
118 Ga0068865_100561829 3300006881 Unclassified 960
119 Ga0097620_100097451 3300006931 Unclassified 2994
120 Ga0097620_100157085 3300006931 Bacteria 2352
121 Ga0105240_10003156 3300009093 Bacteria 25926
122 Ga0105240_10022140 3300009093 Bacteria 8432
123 Ga0105240_10029710 3300009093 Bacteria 7113
124 Ga0105240_10128746 3300009093 Unclassified 3039
125 Ga0105240_10198743 3300009093 Bacteria 2351
126 Ga0105240_10438199 3300009093 Bacteria 1465
127 Ga0105240_10475207 3300009093 Bacteria 1394
128 Ga0105240_10703417 3300009093 Bacteria 1103
129 Ga0105240_12049475 3300009093 Unclassified 594
130 Ga0105240_12278122 3300009093 Unclassified 561
131 Ga0111539_10138634 3300009094 Unclassified 2849
132 Ga0105245_10064333 3300009098 Bacteria 3314
133 Ga0105247_10228851 3300009101 Bacteria 1262
134 Ga0114129_10015309 3300009147 Bacteria 10913
135 Ga0105243_10022153 3300009148 Bacteria 4828
136 Ga0105243_10078144 3300009148 Bacteria 2693
137 Ga0105243_10262446 3300009148 Bacteria 1547
138 Ga0105241_10007571 3300009174 Bacteria 7985
139 Ga0105241_10344112 3300009174 Bacteria 1293
140 Ga0105241_10943874 3300009174 Unclassified 804
141 Ga0105241_11476625 3300009174 Bacteria 653
142 Ga0105242_10009698 3300009176 Bacteria 7380
143 Ga0105242_10022688 3300009176 Bacteria 4941
144 Ga0105248_10002915 3300009177 Bacteria 18984
145 Ga0105248_10128575 3300009177 Bacteria 2858
146 Ga0105248_10636598 3300009177 Unclassified 1203
147 Ga0105248_11058989 3300009177 Bacteria 916
148 Ga0105237_10003159 3300009545 Bacteria 19813
149 Ga0105237_10061007 3300009545 Bacteria 3771
150 Ga0105237_10192195 3300009545 Bacteria 2041
151 Ga0105237_10621551 3300009545 Unclassified 1087
152 Ga0105237_10635596 3300009545 Unclassified 1074
153 Ga0105237_10682684 3300009545 Bacteria 1034
154 Ga0105237_10778135 3300009545 Bacteria 964
155 Ga0105237_11504394 3300009545 Bacteria 680
156 Ga0105238_10006182 3300009551 Bacteria 11889
157 Ga0105238_10078448 3300009551 Bacteria 3292
158 Ga0105238_10178668 3300009551 Bacteria 2099
159 Ga0105238_10572416 3300009551 Bacteria 1135
160 Ga0105238_10607367 3300009551 Unclassified 1102
161 Ga0105249_10374236 3300009553 Bacteria 1449
162 Ga0105249_10564131 3300009553 Unclassified 1190
163 Ga0105249_12473517 3300009553 Unclassified 592
164 Ga0105239_10003289 3300010375 Bacteria 19927
165 Ga0105239_10317959 3300010375 Unclassified 1755
166 Ga0105246_10070547 3300011119 Unclassified 2458
167 Ga0105246_10164327 3300011119 Bacteria 1694
168 Ga0157373_11009444 3300013100 Bacteria 621
169 Ga0157373_11154653 3300013100 Unclassified 582
170 Ga0157370_10009462 3300013104 Bacteria 10405
171 Ga0157370_10089948 3300013104 Bacteria 2883
172 Ga0157370_10098068 3300013104 Bacteria 2749
173 Ga0157370_10170888 3300013104 Bacteria 2021
174 Ga0157370_10694300 3300013104 Bacteria 929
175 Ga0157370_10804751 3300013104 Unclassified 855
176 Ga0157369_10089196 3300013105 Bacteria 3292
177 Ga0157369_10313393 3300013105 Bacteria 1631
178 Ga0157369_10332382 3300013105 Bacteria 1579
179 Ga0157369_10407460 3300013105 Unclassified 1410
180 Ga0157369_10467730 3300013105 Unclassified 1305
181 Ga0157369_11022409 3300013105 Unclassified 846
182 Ga0157369_11563515 3300013105 Unclassified 671
183 Ga0157369_12232070 3300013105 Unclassified 555
184 Ga0157374_10085121 3300013296 Unclassified 3006
185 Ga0157374_10356701 3300013296 Bacteria 1453
186 Ga0157374_10519313 3300013296 Unclassified 1197
187 Ga0157374_11902591 3300013296 Bacteria 621
188 Ga0157378_10369619 3300013297 Bacteria 1406
189 Ga0157378_10441805 3300013297 Bacteria 1290
190 Ga0157378_10687358 3300013297 Bacteria 1042
191 Ga0157378_12027680 3300013297 Unclassified 625
192 Ga0163162_10410887 3300013306 Bacteria 1486
193 Ga0163162_10522814 3300013306 Unclassified 1316
194 Ga0157372_10096521 3300013307 Bacteria 3369
195 Ga0157372_10178438 3300013307 Unclassified 2459
196 Ga0157372_10528685 3300013307 Bacteria 1375
197 Ga0157372_10855894 3300013307 Unclassified 1055
198 Ga0157372_12275450 3300013307 Unclassified 622
199 Ga0157375_10411085 3300013308 Unclassified 1519
200 Ga0157375_11178076 3300013308 Unclassified 898
201 Ga0163163_10183233 3300014325 Bacteria 2141
202 Ga0163163_11181334 3300014325 Bacteria 828
203 Ga0163163_11849096 3300014325 Bacteria 664
204 Ga0157377_10334471 3300014745 Unclassified 1011
205 Ga0157379_10278746 3300014968 Bacteria 1521
206 Ga0157379_10982268 3300014968 Unclassified 804
207 Ga0157379_12616624 3300014968 Unclassified 505
208 Ga0157376_12058773 3300014969 Unclassified 609
209 Ga0157376_12771087 3300014969 Bacteria 530
210 Ga0207692_11210383 3300025898 Unclassified 502
211 Ga0207642_10052123 3300025899 Bacteria 1855
212 Ga0207642_10616583 3300025899 Unclassified 677
213 Ga0207685_10178907 3300025905 Unclassified 982
214 Ga0207699_10336422 3300025906 Bacteria 1062
215 Ga0207645_10483346 3300025907 Bacteria 838
216 Ga0207645_11114105 3300025907 Bacteria 532
217 Ga0207705_10021180 3300025909 Bacteria 4637
218 Ga0207705_10023776 3300025909 Bacteria 4372
219 Ga0207654_10030771 3300025911 Bacteria 2950
220 Ga0207654_10032194 3300025911 Unclassified 2895
221 Ga0207654_10133533 3300025911 Bacteria 1574
222 Ga0207707_10307751 3300025912 Bacteria 1369
223 Ga0207707_10760430 3300025912 Bacteria 810
224 Ga0207695_10030062 3300025913 Bacteria 5988
225 Ga0207695_10058097 3300025913 Bacteria 4016
226 Ga0207695_10240043 3300025913 Bacteria 1714
227 Ga0207695_10387425 3300025913 Bacteria 1283
228 Ga0207695_11049308 3300025913 Bacteria 695
229 Ga0207695_11312110 3300025913 Unclassified 604
230 Ga0207671_10265350 3300025914 Bacteria 1352
231 Ga0207671_10373545 3300025914 Bacteria 1132
232 Ga0207671_10554341 3300025914 Bacteria 916
233 Ga0207693_10010453 3300025915 Bacteria 7532
234 Ga0207663_10049741 3300025916 Bacteria 2602
235 Ga0207663_10167937 3300025916 Bacteria 1555
236 Ga0207663_10254073 3300025916 Bacteria 1295
237 Ga0207663_10276394 3300025916 Bacteria 1246
238 Ga0207663_10649104 3300025916 Unclassified 833
239 Ga0207660_10126663 3300025917 Bacteria 1940
240 Ga0207657_10000582 3300025919 Bacteria 38829
241 Ga0207657_10348804 3300025919 Unclassified 1167
242 Ga0207649_10257422 3300025920 Bacteria 1260
243 Ga0207652_10182162 3300025921 Unclassified 1888
244 Ga0207652_10809553 3300025921 Bacteria 831
245 Ga0207652_11040829 3300025921 Unclassified 718
246 Ga0207652_11673864 3300025921 Bacteria 541
247 Ga0207694_10008599 3300025924 Bacteria 7711
248 Ga0207694_10118134 3300025924 Bacteria 2115
249 Ga0207687_10133870 3300025927 Unclassified 1872
250 Ga0207700_10016613 3300025928 Bacteria 4894
251 Ga0207700_10126862 3300025928 Bacteria 2077
252 Ga0207700_10149283 3300025928 Unclassified 1930
253 Ga0207700_10525707 3300025928 Unclassified 1048
254 Ga0207700_10532279 3300025928 Unclassified 1042
255 Ga0207664_10180264 3300025929 Unclassified 1813
256 Ga0207664_10697026 3300025929 Bacteria 913
257 Ga0207664_11149234 3300025929 Unclassified 693
258 Ga0207664_11429442 3300025929 Unclassified 613
259 Ga0207644_10031429 3300025931 Unclassified 3699
260 Ga0207690_10149042 3300025932 Unclassified 1733
261 Ga0207686_10010636 3300025934 Bacteria 5014
262 Ga0207686_10059969 3300025934 Unclassified 2406
263 Ga0207709_10292555 3300025935 Unclassified 1208
264 Ga0207709_10523595 3300025935 Bacteria 928
265 Ga0207704_10383238 3300025938 Unclassified 1104
266 Ga0207704_10555093 3300025938 Unclassified 934
267 Ga0207704_11317799 3300025938 Bacteria 618
268 Ga0207691_10483966 3300025940 Bacteria 1052
269 Ga0207691_10951198 3300025940 Bacteria 718
270 Ga0207711_10008399 3300025941 Bacteria 8639
271 Ga0207711_10446393 3300025941 Bacteria 1204
272 Ga0207661_10015679 3300025944 Bacteria 5583
273 Ga0207661_11020368 3300025944 Unclassified 762
274 Ga0207679_11131550 3300025945 Unclassified 718
275 Ga0207667_10118872 3300025949 Bacteria 2724
276 Ga0207667_10138550 3300025949 Unclassified 2505
277 Ga0207667_10232353 3300025949 Bacteria 1888
278 Ga0207667_10302507 3300025949 Unclassified 1634
279 Ga0207667_10934217 3300025949 Unclassified 858
280 Ga0207651_10088741 3300025960 Unclassified 2255
281 Ga0207712_10756493 3300025961 Bacteria 852
282 Ga0207668_10045730 3300025972 Bacteria 2987
283 Ga0207640_10152953 3300025981 Bacteria 1697
284 Ga0207640_10356869 3300025981 Unclassified 1176
285 Ga0207658_10783862 3300025986 Bacteria 865
286 Ga0207703_10034675 3300026035 Bacteria 4006
287 Ga0207703_10890650 3300026035 Bacteria 852
288 Ga0207708_10690584 3300026075 Bacteria 872
289 Ga0207702_10038010 3300026078 Bacteria 4032
290 Ga0207702_10212236 3300026078 Bacteria 1800
291 Ga0207702_10466473 3300026078 Bacteria 1227
292 Ga0207702_10615120 3300026078 Bacteria 1067
293 Ga0207702_11012384 3300026078 Unclassified 824
294 Ga0207648_10015891 3300026089 Bacteria 6899
295 Ga0207648_10248360 3300026089 Bacteria 1586
296 Ga0207676_10179421 3300026095 Unclassified 1853
297 Ga0207676_11454053 3300026095 Unclassified 682
298 Ga0207674_10113363 3300026116 Bacteria 2684
299 Ga0207674_10237555 3300026116 Bacteria 1769
300 Ga0207675_101402590 3300026118 Bacteria 719
301 Ga0207683_10316093 3300026121 Bacteria 1430
302 Ga0207698_10042282 3300026142 Unclassified 3403
303 Ga0207698_10563878 3300026142 Unclassified 1118
304 Ga0207698_12011634 3300026142 Unclassified 592
305 Ga0207428_10160090 3300027907 Bacteria 1710
306 Ga0268266_10123869 3300028379 Bacteria 2304
307 Ga0265340_10036721 3300031247 Bacteria 2428
308 Ga0265313_10002192 3300031595 Bacteria 17287
309 Ga0265314_10000658 3300031711 Bacteria 42283
310 Ga0373945_0291831 3300035116 Unclassified 697
311 Ga0373953_0199908 3300035117 Bacteria 864
312 Ga0373953_0292744 3300035117 Bacteria 710
313 Ga0373956_0175521 3300035119 Bacteria 1012
314 Ga0373955_0527862 3300035172 Unclassified 721
315 Ga0373935_0852472 3300035692 Unclassified 674
316 Ga0373935_1408737 3300035692 Unclassified 521
317 Ga0373927_0143111 3300035695 Unclassified 1565
318 Ga0373933_0127292 3300035724 Bacteria 1599
319 Ga0373947_0434310 3300035725 Bacteria 888
320 Ga0373947_0935146 3300035725 Unclassified 592
321 Ga0373937_0007483 3300036401 Bacteria 9452
322 Ga0373937_0481363 3300036401 Bacteria 1179
323 Ga0373937_0998147 3300036401 Unclassified 786
324 Ga0373925_0226022 3300037068 Bacteria 1495
325 Ga0373925_0712994 3300037068 Bacteria 827
326 Ga0395900_0753520 3300037418 Unclassified 904
327 Ga0395900_0944321 3300037418 Unclassified 784
328 Ga0395898_0689509 3300037466 Unclassified 963
329 Ga0436364_0663637 3300037853 Unclassified 1790
330 Ga0395901_0439842 3300038443 Unclassified 1335
331 Ga0436360_0145110 3300039438 Bacteria 817
332 Ga0451853_3873312 3300041512 Bacteria 1354
333 Ga0439445_0022222 3300042004 Bacteria 1599
334 Ga0453683_0126034 3300044673 Bacteria 1612
335 Ga0495592_0908462 3300046454 Unclassified 517
336 Ga0495580_0012992 3300046472 Bacteria 6376
337 Ga0495580_0189740 3300046472 Bacteria 1418
338 Ga0495580_0274417 3300046472 Bacteria 1151
339 Ga0495580_0433554 3300046472 Archaea 883
340 Ga0495582_0586056 3300046473 Unclassified 645
341 Ga0495664_0382764 3300046477 Bacteria 846
342 Ga0495594_0604554 3300046499 Unclassified 622
343 Ga0495652_0529870 3300046529 Bacteria 813
344 Ga0495665_0626006 3300046531 Unclassified 537
345 Ga0495586_0899136 3300046535 Unclassified 510
346 Ga0495645_0217507 3300046543 Bacteria 1287
347 Ga0495623_0310445 3300046679 Bacteria 869
348 Ga0495658_0092855 3300046683 Unclassified 1790
349 Ga0495613_0005655 3300046689 Bacteria 9370
350 Ga0495581_0027754 3300047315 Bacteria 3284
351 Ga0495684_0172309 3300047471 Bacteria 1609
352 Ga0495602_0180136 3300048088 Bacteria 1631
353 Ga0495614_0040727 3300048089 Unclassified 1994
354 Ga0496106_0943576 3300048909 Unclassified 680
355 Ga0496115_0528214 3300048918 Unclassified 945
356 Ga0496126_0107072 3300048929 Bacteria 2439
357 Ga0501031_0003876 3300049568 Bacteria 9625
358 Ga0501032_0008711 3300049569 Bacteria 7388
359 Ga0501032_0930750 3300049569 Unclassified 547
360 Ga0501036_0000509 3300049572 Bacteria 27878
361 Ga0501037_0101562 3300049573 Bacteria 2075
362 Ga0501038_0045973 3300049574 Bacteria 3786
363 Ga0501039_0047121 3300049575 Bacteria 3331
364 Ga0501039_0575382 3300049575 Bacteria 883
365 Ga0501040_0436149 3300049576 Bacteria 942
366 Ga0501040_1217530 3300049576 Unclassified 546
367 Ga0501041_0114187 3300049577 Bacteria 1677
368 Ga0501042_0182672 3300049578 Bacteria 1513
369 Ga0501042_0224862 3300049578 Bacteria 1354
370 Ga0501042_0698159 3300049578 Bacteria 738
371 Ga0501043_0007023 3300049579 Bacteria 8960
372 Ga0501046_0019504 3300049580 Bacteria 5624
373 Ga0501047_0166344 3300049581 Bacteria 2075
374 Ga0501067_0026926 3300049583 Bacteria 3183
375 Ga0501068_0003801 3300049584 Bacteria 8183
376 Ga0501068_1043661 3300049584 Unclassified 540
377 Ga0501069_0001200 3300049585 Bacteria 12621
378 Ga0501070_0312256 3300049586 Bacteria 1279
379 Ga0501071_0314655 3300049587 Bacteria 1188
380 Ga0501072_0031187 3300049588 Bacteria 4170
381 Ga0501072_0741484 3300049588 Unclassified 771
382 Ga0501073_0002034 3300049589 Bacteria 15107
383 Ga0501074_0037690 3300049590 Bacteria 3503
384 Ga0501074_0440696 3300049590 Bacteria 924
385 Ga0501075_0054919 3300049591 Unclassified 2997
386 Ga0501075_0528889 3300049591 Unclassified 900
387 Ga0501075_1090701 3300049591 Bacteria 606
388 Ga0501076_0009033 3300049592 Bacteria 7338
389 Ga0501076_0062249 3300049592 Bacteria 2971
390 Ga0501076_0256133 3300049592 Bacteria 1432
391 Ga0501076_0303183 3300049592 Unclassified 1310
392 Ga0501077_0055943 3300049593 Unclassified 2504
393 Ga0501079_0003379 3300049741 Bacteria 11709
394 Ga0501079_1143021 3300049741 Unclassified 613
395 Ga0501080_0000586 3300049742 Bacteria 28744
396 Ga0501081_0115324 3300049743 Bacteria 1909
397 Ga0501081_0156787 3300049743 Bacteria 1638
398 Ga0501083_0334488 3300049744 Bacteria 985
399 Ga0501035_0011856 3300049822 Bacteria 8070
400 Ga0501045_0031789 3300049824 Bacteria 3823
401 Ga0501045_0408627 3300049824 Bacteria 1010
402 nmdc:mga06z11_512194_c1 3300050494 Bacteria 727
403 nmdc:mga05p37_109956_c1 3300050507 Bacteria 3390
404 nmdc:mga09592_312662_c1 3300050508 Unclassified 1361
405 nmdc:mga08y16_88832_c1 3300050511 Unclassified 3221
406 Ga0500555_000033 3300053103 Bacteria 85640
407 Ga0500645_000010 3300053730 Bacteria 186517
408 Ga0501084_0000529 3300054114 Bacteria 29217
409 Ga0501084_0533402 3300054114 Bacteria 992
410 Ga0501082_0024046 3300060353 Bacteria 5254
411 Ga0530510_0035372 3300061734 Bacteria 3600
412 Ga0530510_1452490 3300061734 Bacteria 526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_10010453 Ga0207693_100104532 109
2 3300005340 Ga0070689_100058220 Ga0070689_1000582203 112
3 3300005436 Ga0070713_101446959 Ga0070713_1014469592 112
4 3300005439 Ga0070711_101968547 Ga0070711_1019685471 112
5 3300005457 Ga0070662_100118076 Ga0070662_1001180762 112
6 3300005459 Ga0068867_100270584 Ga0068867_1002705841 112
7 3300005466 Ga0070685_10425195 Ga0070685_104251951 112
8 3300005539 Ga0068853_100194728 Ga0068853_1001947282 112
9 3300005577 Ga0068857_100040558 Ga0068857_1000405583 112
10 3300005577 Ga0068857_101316255 Ga0068857_1013162552 112
11 3300005614 Ga0068856_100124661 Ga0068856_1001246611 112
12 3300005616 Ga0068852_100431644 Ga0068852_1004316442 112
13 3300005618 Ga0068864_101174030 Ga0068864_1011740302 112
14 3300005718 Ga0068866_10244601 Ga0068866_102446012 112
15 3300005719 Ga0068861_101520672 Ga0068861_1015206722 112
16 3300005843 Ga0068860_100178192 Ga0068860_1001781922 112
17 3300006358 Ga0068871_100627522 Ga0068871_1006275222 112
18 3300006880 Ga0075429_100242435 Ga0075429_1002424351 112
19 3300006931 Ga0097620_100097451 Ga0097620_1000974513 112
20 3300009093 Ga0105240_10003156 Ga0105240_1000315625 112
21 3300009093 Ga0105240_10198743 Ga0105240_101987433 112
22 3300009147 Ga0114129_10015309 Ga0114129_100153098 112
23 3300009174 Ga0105241_10943874 Ga0105241_109438742 112
24 3300009545 Ga0105237_10003159 Ga0105237_1000315919 112
25 3300009545 Ga0105237_10192195 Ga0105237_101921954 112
26 3300009551 Ga0105238_10607367 Ga0105238_106073672 112
27 3300009553 Ga0105249_10374236 Ga0105249_103742362 112
28 3300011119 Ga0105246_10164327 Ga0105246_101643272 112
29 3300013100 Ga0157373_11154653 Ga0157373_111546531 112
30 3300013296 Ga0157374_11902591 Ga0157374_119025912 112
31 3300013297 Ga0157378_12027680 Ga0157378_120276801 112
32 3300013307 Ga0157372_12275450 Ga0157372_122754501 112
33 3300013308 Ga0157375_11178076 Ga0157375_111780761 112
34 3300014325 Ga0163163_11849096 Ga0163163_118490962 112
35 3300014745 Ga0157377_10334471 Ga0157377_103344712 112
36 3300025899 Ga0207642_10052123 Ga0207642_100521232 112
37 3300025961 Ga0207712_10756493 Ga0207712_107564932 112
38 3300026089 Ga0207648_10248360 Ga0207648_102483603 112
39 3300026118 Ga0207675_101402590 Ga0207675_1014025902 112
40 3300050507 nmdc:mga05p37_109956_c1 nmdc:mga05p37_109956_c1_1450_1800 112
41 3300050508 nmdc:mga09592_312662_c1 nmdc:mga09592_312662_c1_35_385 112
42 3300005295 Ga0065707_10000766 Ga0065707_100007665 113
43 3300005327 Ga0070658_10013401 Ga0070658_100134012 113
44 3300005327 Ga0070658_11345460 Ga0070658_113454601 113
45 3300005328 Ga0070676_10390462 Ga0070676_103904621 113
46 3300005328 Ga0070676_11561113 Ga0070676_115611131 113
47 3300005329 Ga0070683_100033399 Ga0070683_1000333992 113
48 3300005329 Ga0070683_100371028 Ga0070683_1003710282 113
49 3300005336 Ga0070680_100007056 Ga0070680_1000070565 113
50 3300005337 Ga0070682_100081419 Ga0070682_1000814192 113
51 3300005339 Ga0070660_100076863 Ga0070660_1000768633 113
52 3300005339 Ga0070660_100353666 Ga0070660_1003536662 113
53 3300005341 Ga0070691_10175783 Ga0070691_101757832 113
54 3300005347 Ga0070668_100277885 Ga0070668_1002778852 113
55 3300005354 Ga0070675_100249464 Ga0070675_1002494642 113
56 3300005355 Ga0070671_100057776 Ga0070671_1000577762 113
57 3300005364 Ga0070673_100041204 Ga0070673_1000412042 113
58 3300005364 Ga0070673_100236903 Ga0070673_1002369032 113
59 3300005366 Ga0070659_100155871 Ga0070659_1001558712 113
60 3300005434 Ga0070709_10526214 Ga0070709_105262141 113
61 3300005435 Ga0070714_100334922 Ga0070714_1003349222 113
62 3300005435 Ga0070714_100623911 Ga0070714_1006239112 113
63 3300005435 Ga0070714_101076908 Ga0070714_1010769081 113
64 3300005435 Ga0070714_101986945 Ga0070714_1019869451 113
65 3300005436 Ga0070713_100023568 Ga0070713_1000235682 113
66 3300005436 Ga0070713_100054356 Ga0070713_1000543562 113
67 3300005436 Ga0070713_100070300 Ga0070713_1000703003 113
68 3300005436 Ga0070713_100985232 Ga0070713_1009852322 113
69 3300005436 Ga0070713_101707358 Ga0070713_1017073581 113
70 3300005439 Ga0070711_100199509 Ga0070711_1001995092 113
71 3300005440 Ga0070705_100939595 Ga0070705_1009395951 113
72 3300005441 Ga0070700_101425035 Ga0070700_1014250351 113
73 3300005445 Ga0070708_101876069 Ga0070708_1018760691 113
74 3300005455 Ga0070663_101554113 Ga0070663_1015541131 113
75 3300005456 Ga0070678_100413745 Ga0070678_1004137452 113
76 3300005457 Ga0070662_100174309 Ga0070662_1001743092 113
77 3300005457 Ga0070662_101522238 Ga0070662_1015222381 113
78 3300005458 Ga0070681_10011903 Ga0070681_100119034 113
79 3300005458 Ga0070681_10302787 Ga0070681_103027872 113
80 3300005458 Ga0070681_10984954 Ga0070681_109849542 113
81 3300005458 Ga0070681_11022999 Ga0070681_110229991 113
82 3300005459 Ga0068867_100007090 Ga0068867_1000070905 113
83 3300005459 Ga0068867_100172460 Ga0068867_1001724602 113
84 3300005466 Ga0070685_10243786 Ga0070685_102437862 113
85 3300005467 Ga0070706_100858653 Ga0070706_1008586532 113
86 3300005471 Ga0070698_101298643 Ga0070698_1012986432 113
87 3300005471 Ga0070698_102198897 Ga0070698_1021988971 113
88 3300005518 Ga0070699_100794100 Ga0070699_1007941002 113
89 3300005530 Ga0070679_100020869 Ga0070679_1000208692 113
90 3300005530 Ga0070679_100071399 Ga0070679_1000713992 113
91 3300005530 Ga0070679_101558639 Ga0070679_1015586391 113
92 3300005535 Ga0070684_100052726 Ga0070684_1000527265 113
93 3300005535 Ga0070684_100598824 Ga0070684_1005988242 113
94 3300005539 Ga0068853_100290643 Ga0068853_1002906432 113
95 3300005543 Ga0070672_100315026 Ga0070672_1003150262 113
96 3300005543 Ga0070672_100401265 Ga0070672_1004012652 113
97 3300005547 Ga0070693_100038451 Ga0070693_1000384512 113
98 3300005547 Ga0070693_100513026 Ga0070693_1005130261 113
99 3300005547 Ga0070693_100534171 Ga0070693_1005341712 113
100 3300005548 Ga0070665_100170167 Ga0070665_1001701672 113
101 3300005548 Ga0070665_100687470 Ga0070665_1006874702 113
102 3300005563 Ga0068855_100019398 Ga0068855_1000193982 113
103 3300005563 Ga0068855_100156008 Ga0068855_1001560082 113
104 3300005563 Ga0068855_101356233 Ga0068855_1013562331 113
105 3300005563 Ga0068855_101521885 Ga0068855_1015218852 113
106 3300005564 Ga0070664_100168857 Ga0070664_1001688572 113
107 3300005564 Ga0070664_101180089 Ga0070664_1011800891 113
108 3300005577 Ga0068857_100370769 Ga0068857_1003707691 113
109 3300005577 Ga0068857_101419910 Ga0068857_1014199101 113
110 3300005578 Ga0068854_100065209 Ga0068854_1000652092 113
111 3300005578 Ga0068854_100155598 Ga0068854_1001555982 113
112 3300005614 Ga0068856_100401461 Ga0068856_1004014612 113
113 3300005614 Ga0068856_100474137 Ga0068856_1004741372 113
114 3300005614 Ga0068856_100628893 Ga0068856_1006288932 113
115 3300005614 Ga0068856_100801185 Ga0068856_1008011852 113
116 3300005614 Ga0068856_101874158 Ga0068856_1018741581 113
117 3300005614 Ga0068856_101981039 Ga0068856_1019810391 113
118 3300005616 Ga0068852_100013857 Ga0068852_1000138579 113
119 3300005616 Ga0068852_100032052 Ga0068852_1000320522 113
120 3300005616 Ga0068852_100773743 Ga0068852_1007737432 113
121 3300005617 Ga0068859_100157083 Ga0068859_1001570832 113
122 3300005618 Ga0068864_100110994 Ga0068864_1001109942 113
123 3300005718 Ga0068866_10059192 Ga0068866_100591922 113
124 3300005718 Ga0068866_10212115 Ga0068866_102121152 113
125 3300005834 Ga0068851_10534396 Ga0068851_105343962 113
126 3300005842 Ga0068858_100925821 Ga0068858_1009258211 113
127 3300006028 Ga0070717_10472991 Ga0070717_104729912 113
128 3300006028 Ga0070717_10558597 Ga0070717_105585972 113
129 3300006051 Ga0075364_10426790 Ga0075364_104267902 113
130 3300006173 Ga0070716_100579891 Ga0070716_1005798912 113
131 3300006175 Ga0070712_100007100 Ga0070712_1000071005 113
132 3300006175 Ga0070712_100675784 Ga0070712_1006757841 113
133 3300006178 Ga0075367_10087426 Ga0075367_100874262 113
134 3300006195 Ga0075366_10744287 Ga0075366_107442872 113
135 3300006237 Ga0097621_100095364 Ga0097621_1000953643 113
136 3300006358 Ga0068871_100026564 Ga0068871_1000265643 113
137 3300006358 Ga0068871_100208556 Ga0068871_1002085562 113
138 3300006358 Ga0068871_100420111 Ga0068871_1004201112 113
139 3300006844 Ga0075428_100170969 Ga0075428_1001709694 113
140 3300006847 Ga0075431_100133626 Ga0075431_1001336262 113
141 3300006881 Ga0068865_100441094 Ga0068865_1004410942 113
142 3300006881 Ga0068865_100561829 Ga0068865_1005618292 113
143 3300006931 Ga0097620_100157085 Ga0097620_1001570852 113
144 3300009093 Ga0105240_10022140 Ga0105240_100221405 113
145 3300009093 Ga0105240_10029710 Ga0105240_100297109 113
146 3300009093 Ga0105240_10128746 Ga0105240_101287463 113
147 3300009093 Ga0105240_10438199 Ga0105240_104381992 113
148 3300009093 Ga0105240_10475207 Ga0105240_104752072 113
149 3300009093 Ga0105240_10703417 Ga0105240_107034172 113
150 3300009093 Ga0105240_12049475 Ga0105240_120494751 113
151 3300009093 Ga0105240_12278122 Ga0105240_122781222 113
152 3300009094 Ga0111539_10138634 Ga0111539_101386344 113
153 3300009098 Ga0105245_10064333 Ga0105245_100643333 113
154 3300009101 Ga0105247_10228851 Ga0105247_102288512 113
155 3300009148 Ga0105243_10022153 Ga0105243_100221532 113
156 3300009148 Ga0105243_10078144 Ga0105243_100781445 113
157 3300009148 Ga0105243_10262446 Ga0105243_102624462 113
158 3300009174 Ga0105241_10007571 Ga0105241_100075717 113
159 3300009174 Ga0105241_10344112 Ga0105241_103441122 113
160 3300009174 Ga0105241_11476625 Ga0105241_114766252 113
161 3300009176 Ga0105242_10009698 Ga0105242_100096985 113
162 3300009176 Ga0105242_10022688 Ga0105242_100226885 113
163 3300009177 Ga0105248_10002915 Ga0105248_100029153 113
164 3300009177 Ga0105248_10128575 Ga0105248_101285752 113
165 3300009177 Ga0105248_10636598 Ga0105248_106365982 113
166 3300009177 Ga0105248_11058989 Ga0105248_110589892 113
167 3300009545 Ga0105237_10061007 Ga0105237_100610074 113
168 3300009545 Ga0105237_10621551 Ga0105237_106215512 113
169 3300009545 Ga0105237_10635596 Ga0105237_106355962 113
170 3300009545 Ga0105237_10682684 Ga0105237_106826842 113
171 3300009545 Ga0105237_10778135 Ga0105237_107781352 113
172 3300009545 Ga0105237_11504394 Ga0105237_115043942 113
173 3300009551 Ga0105238_10006182 Ga0105238_100061827 113
174 3300009551 Ga0105238_10078448 Ga0105238_100784483 113
175 3300009551 Ga0105238_10178668 Ga0105238_101786682 113
176 3300009551 Ga0105238_10572416 Ga0105238_105724162 113
177 3300009553 Ga0105249_10564131 Ga0105249_105641312 113
178 3300009553 Ga0105249_12473517 Ga0105249_124735171 113
179 3300010375 Ga0105239_10003289 Ga0105239_1000328917 113
180 3300010375 Ga0105239_10317959 Ga0105239_103179592 113
181 3300011119 Ga0105246_10070547 Ga0105246_100705472 113
182 3300013100 Ga0157373_11009444 Ga0157373_110094442 113
183 3300013104 Ga0157370_10009462 Ga0157370_100094622 113
184 3300013104 Ga0157370_10089948 Ga0157370_100899482 113
185 3300013104 Ga0157370_10098068 Ga0157370_100980681 113
186 3300013104 Ga0157370_10170888 Ga0157370_101708884 113
187 3300013104 Ga0157370_10694300 Ga0157370_106943001 113
188 3300013104 Ga0157370_10804751 Ga0157370_108047512 113
189 3300013105 Ga0157369_10089196 Ga0157369_100891962 113
190 3300013105 Ga0157369_10313393 Ga0157369_103133934 113
191 3300013105 Ga0157369_10332382 Ga0157369_103323821 113
192 3300013105 Ga0157369_10407460 Ga0157369_104074602 113
193 3300013105 Ga0157369_10467730 Ga0157369_104677301 113
194 3300013105 Ga0157369_11022409 Ga0157369_110224092 113
195 3300013105 Ga0157369_11563515 Ga0157369_115635152 113
196 3300013105 Ga0157369_12232070 Ga0157369_122320702 113
197 3300013296 Ga0157374_10085121 Ga0157374_100851212 113
198 3300013296 Ga0157374_10356701 Ga0157374_103567012 113
199 3300013296 Ga0157374_10519313 Ga0157374_105193132 113
200 3300013297 Ga0157378_10369619 Ga0157378_103696192 113
201 3300013297 Ga0157378_10441805 Ga0157378_104418051 113
202 3300013297 Ga0157378_10687358 Ga0157378_106873582 113
203 3300013306 Ga0163162_10410887 Ga0163162_104108872 113
204 3300013306 Ga0163162_10522814 Ga0163162_105228142 113
205 3300013307 Ga0157372_10096521 Ga0157372_100965214 113
206 3300013307 Ga0157372_10178438 Ga0157372_101784381 113
207 3300013307 Ga0157372_10528685 Ga0157372_105286852 113
208 3300013307 Ga0157372_10855894 Ga0157372_108558942 113
209 3300013308 Ga0157375_10411085 Ga0157375_104110852 113
210 3300014325 Ga0163163_10183233 Ga0163163_101832332 113
211 3300014325 Ga0163163_11181334 Ga0163163_111813342 113
212 3300014968 Ga0157379_10278746 Ga0157379_102787462 113
213 3300014968 Ga0157379_10982268 Ga0157379_109822682 113
214 3300014968 Ga0157379_12616624 Ga0157379_126166242 113
215 3300014969 Ga0157376_12058773 Ga0157376_120587732 113
216 3300014969 Ga0157376_12771087 Ga0157376_127710872 113
217 3300025898 Ga0207692_11210383 Ga0207692_112103831 113
218 3300025899 Ga0207642_10616583 Ga0207642_106165832 113
219 3300025905 Ga0207685_10178907 Ga0207685_101789072 113
220 3300025906 Ga0207699_10336422 Ga0207699_103364222 113
221 3300025907 Ga0207645_10483346 Ga0207645_104833462 113
222 3300025907 Ga0207645_11114105 Ga0207645_111141052 113
223 3300025909 Ga0207705_10021180 Ga0207705_100211802 113
224 3300025909 Ga0207705_10023776 Ga0207705_100237762 113
225 3300025911 Ga0207654_10030771 Ga0207654_100307712 113
226 3300025911 Ga0207654_10032194 Ga0207654_100321944 113
227 3300025911 Ga0207654_10133533 Ga0207654_101335332 113
228 3300025912 Ga0207707_10307751 Ga0207707_103077512 113
229 3300025912 Ga0207707_10760430 Ga0207707_107604302 113
230 3300025913 Ga0207695_10030062 Ga0207695_100300622 113
231 3300025913 Ga0207695_10058097 Ga0207695_100580971 113
232 3300025913 Ga0207695_10240043 Ga0207695_102400432 113
233 3300025913 Ga0207695_10387425 Ga0207695_103874252 113
234 3300025913 Ga0207695_11049308 Ga0207695_110493082 113
235 3300025913 Ga0207695_11312110 Ga0207695_113121101 113
236 3300025914 Ga0207671_10265350 Ga0207671_102653502 113
237 3300025914 Ga0207671_10373545 Ga0207671_103735452 113
238 3300025914 Ga0207671_10554341 Ga0207671_105543412 113
239 3300025916 Ga0207663_10049741 Ga0207663_100497412 113
240 3300025916 Ga0207663_10167937 Ga0207663_101679371 113
241 3300025916 Ga0207663_10254073 Ga0207663_102540732 113
242 3300025916 Ga0207663_10276394 Ga0207663_102763942 113
243 3300025916 Ga0207663_10649104 Ga0207663_106491042 113
244 3300025917 Ga0207660_10126663 Ga0207660_101266632 113
245 3300025919 Ga0207657_10000582 Ga0207657_1000058220 113
246 3300025919 Ga0207657_10348804 Ga0207657_103488042 113
247 3300025920 Ga0207649_10257422 Ga0207649_102574222 113
248 3300025921 Ga0207652_10182162 Ga0207652_101821622 113
249 3300025921 Ga0207652_10809553 Ga0207652_108095532 113
250 3300025921 Ga0207652_11040829 Ga0207652_110408292 113
251 3300025921 Ga0207652_11673864 Ga0207652_116738641 113
252 3300025924 Ga0207694_10008599 Ga0207694_100085997 113
253 3300025924 Ga0207694_10118134 Ga0207694_101181342 113
254 3300025927 Ga0207687_10133870 Ga0207687_101338702 113
255 3300025928 Ga0207700_10016613 Ga0207700_100166132 113
256 3300025928 Ga0207700_10126862 Ga0207700_101268622 113
257 3300025928 Ga0207700_10149283 Ga0207700_101492832 113
258 3300025928 Ga0207700_10525707 Ga0207700_105257071 113
259 3300025928 Ga0207700_10532279 Ga0207700_105322792 113
260 3300025929 Ga0207664_10180264 Ga0207664_101802643 113
261 3300025929 Ga0207664_10697026 Ga0207664_106970261 113
262 3300025929 Ga0207664_11149234 Ga0207664_111492341 113
263 3300025929 Ga0207664_11429442 Ga0207664_114294422 113
264 3300025931 Ga0207644_10031429 Ga0207644_100314292 113
265 3300025932 Ga0207690_10149042 Ga0207690_101490422 113
266 3300025934 Ga0207686_10010636 Ga0207686_100106364 113
267 3300025934 Ga0207686_10059969 Ga0207686_100599692 113
268 3300025935 Ga0207709_10292555 Ga0207709_102925552 113
269 3300025935 Ga0207709_10523595 Ga0207709_105235952 113
270 3300025938 Ga0207704_10383238 Ga0207704_103832382 113
271 3300025938 Ga0207704_10555093 Ga0207704_105550932 113
272 3300025938 Ga0207704_11317799 Ga0207704_113177991 113
273 3300025940 Ga0207691_10483966 Ga0207691_104839662 113
274 3300025940 Ga0207691_10951198 Ga0207691_109511982 113
275 3300025941 Ga0207711_10008399 Ga0207711_100083992 113
276 3300025941 Ga0207711_10446393 Ga0207711_104463932 113
277 3300025944 Ga0207661_10015679 Ga0207661_100156795 113
278 3300025944 Ga0207661_11020368 Ga0207661_110203681 113
279 3300025945 Ga0207679_11131550 Ga0207679_111315502 113
280 3300025949 Ga0207667_10118872 Ga0207667_101188722 113
281 3300025949 Ga0207667_10138550 Ga0207667_101385502 113
282 3300025949 Ga0207667_10232353 Ga0207667_102323532 113
283 3300025949 Ga0207667_10302507 Ga0207667_103025072 113
284 3300025949 Ga0207667_10934217 Ga0207667_109342172 113
285 3300025960 Ga0207651_10088741 Ga0207651_100887412 113
286 3300025972 Ga0207668_10045730 Ga0207668_100457302 113
287 3300025981 Ga0207640_10152953 Ga0207640_101529532 113
288 3300025981 Ga0207640_10356869 Ga0207640_103568692 113
289 3300025986 Ga0207658_10783862 Ga0207658_107838622 113
290 3300026035 Ga0207703_10034675 Ga0207703_100346752 113
291 3300026035 Ga0207703_10890650 Ga0207703_108906502 113
292 3300026075 Ga0207708_10690584 Ga0207708_106905842 113
293 3300026078 Ga0207702_10038010 Ga0207702_100380102 113
294 3300026078 Ga0207702_10212236 Ga0207702_102122362 113
295 3300026078 Ga0207702_10466473 Ga0207702_104664732 113
296 3300026078 Ga0207702_10615120 Ga0207702_106151202 113
297 3300026078 Ga0207702_11012384 Ga0207702_110123842 113
298 3300026089 Ga0207648_10015891 Ga0207648_100158915 113
299 3300026095 Ga0207676_10179421 Ga0207676_101794212 113
300 3300026095 Ga0207676_11454053 Ga0207676_114540532 113
301 3300026116 Ga0207674_10113363 Ga0207674_101133632 113
302 3300026116 Ga0207674_10237555 Ga0207674_102375552 113
303 3300026121 Ga0207683_10316093 Ga0207683_103160932 113
304 3300026142 Ga0207698_10042282 Ga0207698_100422822 113
305 3300026142 Ga0207698_10563878 Ga0207698_105638782 113
306 3300026142 Ga0207698_12011634 Ga0207698_120116341 113
307 3300027907 Ga0207428_10160090 Ga0207428_101600901 113
308 3300028379 Ga0268266_10123869 Ga0268266_101238692 113
309 3300031247 Ga0265340_10036721 Ga0265340_100367213 113
310 3300031595 Ga0265313_10002192 Ga0265313_1000219215 113
311 3300031711 Ga0265314_10000658 Ga0265314_1000065826 113
312 3300035116 Ga0373945_0291831 Ga0373945_0291831_173_514 113
313 3300035117 Ga0373953_0199908 Ga0373953_0199908_441_797 113
314 3300035117 Ga0373953_0292744 Ga0373953_0292744_291_632 113
315 3300035119 Ga0373956_0175521 Ga0373956_0175521_505_846 113
316 3300035172 Ga0373955_0527862 Ga0373955_0527862_359_700 113
317 3300035692 Ga0373935_0852472 Ga0373935_0852472_155_511 113
318 3300035692 Ga0373935_1408737 Ga0373935_1408737_116_457 113
319 3300035695 Ga0373927_0143111 Ga0373927_0143111_753_1094 113
320 3300035724 Ga0373933_0127292 Ga0373933_0127292_560_901 113
321 3300035725 Ga0373947_0434310 Ga0373947_0434310_18_359 113
322 3300035725 Ga0373947_0935146 Ga0373947_0935146_79_435 113
323 3300036401 Ga0373937_0007483 Ga0373937_0007483_7001_7357 113
324 3300036401 Ga0373937_0481363 Ga0373937_0481363_193_549 113
325 3300036401 Ga0373937_0998147 Ga0373937_0998147_27_368 113
326 3300037068 Ga0373925_0226022 Ga0373925_0226022_796_1137 113
327 3300037068 Ga0373925_0712994 Ga0373925_0712994_330_671 113
328 3300037418 Ga0395900_0753520 Ga0395900_0753520_434_784 113
329 3300037418 Ga0395900_0944321 Ga0395900_0944321_14_373 113
330 3300037466 Ga0395898_0689509 Ga0395898_0689509_105_497 113
331 3300037853 Ga0436364_0663637 Ga0436364_0663637_1344_1700 113
332 3300038443 Ga0395901_0439842 Ga0395901_0439842_551_943 113
333 3300039438 Ga0436360_0145110 Ga0436360_0145110_438_794 113
334 3300041512 Ga0451853_3873312 Ga0451853_3873312_943_1284 113
335 3300042004 Ga0439445_0022222 Ga0439445_0022222_35_433 113
336 3300044673 Ga0453683_0126034 Ga0453683_0126034_1090_1446 113
337 3300046454 Ga0495592_0908462 Ga0495592_0908462_15_356 113
338 3300046472 Ga0495580_0012992 Ga0495580_0012992_2723_3064 113
339 3300046472 Ga0495580_0189740 Ga0495580_0189740_96_437 113
340 3300046472 Ga0495580_0274417 Ga0495580_0274417_130_471 113
341 3300046472 Ga0495580_0433554 Ga0495580_0433554_321_674 113
342 3300046473 Ga0495582_0586056 Ga0495582_0586056_293_634 113
343 3300046477 Ga0495664_0382764 Ga0495664_0382764_490_831 113
344 3300046499 Ga0495594_0604554 Ga0495594_0604554_72_473 113
345 3300046529 Ga0495652_0529870 Ga0495652_0529870_356_712 113
346 3300046531 Ga0495665_0626006 Ga0495665_0626006_95_520 113
347 3300046535 Ga0495586_0899136 Ga0495586_0899136_108_449 113
348 3300046543 Ga0495645_0217507 Ga0495645_0217507_332_673 113
349 3300046679 Ga0495623_0310445 Ga0495623_0310445_127_468 113
350 3300046683 Ga0495658_0092855 Ga0495658_0092855_1163_1519 113
351 3300046689 Ga0495613_0005655 Ga0495613_0005655_7557_7913 113
352 3300047315 Ga0495581_0027754 Ga0495581_0027754_1340_1696 113
353 3300047471 Ga0495684_0172309 Ga0495684_0172309_358_759 113
354 3300048088 Ga0495602_0180136 Ga0495602_0180136_407_763 113
355 3300048089 Ga0495614_0040727 Ga0495614_0040727_289_645 113
356 3300048909 Ga0496106_0943576 Ga0496106_0943576_191_532 113
357 3300048918 Ga0496115_0528214 Ga0496115_0528214_55_411 113
358 3300048929 Ga0496126_0107072 Ga0496126_0107072_1176_1517 113
359 3300049568 Ga0501031_0003876 Ga0501031_0003876_4602_4958 113
360 3300049569 Ga0501032_0008711 Ga0501032_0008711_5419_5775 113
361 3300049569 Ga0501032_0930750 Ga0501032_0930750_66_428 113
362 3300049572 Ga0501036_0000509 Ga0501036_0000509_4913_5269 113
363 3300049573 Ga0501037_0101562 Ga0501037_0101562_996_1352 113
364 3300049574 Ga0501038_0045973 Ga0501038_0045973_612_968 113
365 3300049575 Ga0501039_0047121 Ga0501039_0047121_1162_1518 113
366 3300049575 Ga0501039_0575382 Ga0501039_0575382_25_366 113
367 3300049576 Ga0501040_0436149 Ga0501040_0436149_117_458 113
368 3300049576 Ga0501040_1217530 Ga0501040_1217530_114_473 113
369 3300049577 Ga0501041_0114187 Ga0501041_0114187_1140_1502 113
370 3300049578 Ga0501042_0182672 Ga0501042_0182672_434_790 113
371 3300049578 Ga0501042_0224862 Ga0501042_0224862_112_474 113
372 3300049578 Ga0501042_0698159 Ga0501042_0698159_89_451 113
373 3300049579 Ga0501043_0007023 Ga0501043_0007023_1390_1746 113
374 3300049580 Ga0501046_0019504 Ga0501046_0019504_4417_4773 113
375 3300049581 Ga0501047_0166344 Ga0501047_0166344_868_1224 113
376 3300049583 Ga0501067_0026926 Ga0501067_0026926_1976_2332 113
377 3300049584 Ga0501068_0003801 Ga0501068_0003801_724_1080 113
378 3300049584 Ga0501068_1043661 Ga0501068_1043661_30_392 113
379 3300049585 Ga0501069_0001200 Ga0501069_0001200_9090_9446 113
380 3300049586 Ga0501070_0312256 Ga0501070_0312256_724_1080 113
381 3300049587 Ga0501071_0314655 Ga0501071_0314655_837_1178 113
382 3300049588 Ga0501072_0031187 Ga0501072_0031187_2947_3303 113
383 3300049588 Ga0501072_0741484 Ga0501072_0741484_374_736 113
384 3300049589 Ga0501073_0002034 Ga0501073_0002034_12344_12700 113
385 3300049590 Ga0501074_0037690 Ga0501074_0037690_2947_3303 113
386 3300049590 Ga0501074_0440696 Ga0501074_0440696_151_492 113
387 3300049591 Ga0501075_0054919 Ga0501075_0054919_207_548 113
388 3300049591 Ga0501075_0528889 Ga0501075_0528889_74_436 113
389 3300049591 Ga0501075_1090701 Ga0501075_1090701_142_504 113
390 3300049592 Ga0501076_0009033 Ga0501076_0009033_4915_5256 113
391 3300049592 Ga0501076_0062249 Ga0501076_0062249_162_518 113
392 3300049592 Ga0501076_0256133 Ga0501076_0256133_420_782 113
393 3300049592 Ga0501076_0303183 Ga0501076_0303183_483_845 113
394 3300049593 Ga0501077_0055943 Ga0501077_0055943_2060_2416 113
395 3300049741 Ga0501079_0003379 Ga0501079_0003379_4210_4566 113
396 3300049741 Ga0501079_1143021 Ga0501079_1143021_80_442 113
397 3300049742 Ga0501080_0000586 Ga0501080_0000586_1255_1611 113
398 3300049743 Ga0501081_0115324 Ga0501081_0115324_181_522 113
399 3300049743 Ga0501081_0156787 Ga0501081_0156787_643_1005 113
400 3300049744 Ga0501083_0334488 Ga0501083_0334488_20_361 113
401 3300049822 Ga0501035_0011856 Ga0501035_0011856_4210_4566 113
402 3300049824 Ga0501045_0031789 Ga0501045_0031789_377_733 113
403 3300049824 Ga0501045_0408627 Ga0501045_0408627_492_854 113
404 3300050494 nmdc:mga06z11_512194_c1 nmdc:mga06z11_512194_c1_270_611 113
405 3300050511 nmdc:mga08y16_88832_c1 nmdc:mga08y16_88832_c1_1465_1827 113
406 3300053103 Ga0500555_000033 Ga0500555_000033_34113_34454 113
407 3300053730 Ga0500645_000010 Ga0500645_000010_60892_61233 113
408 3300054114 Ga0501084_0000529 Ga0501084_0000529_26758_27114 113
409 3300054114 Ga0501084_0533402 Ga0501084_0533402_24_365 113
410 3300060353 Ga0501082_0024046 Ga0501082_0024046_4175_4531 113
411 3300061734 Ga0530510_0035372 Ga0530510_0035372_2559_2921 113
412 3300061734 Ga0530510_1452490 Ga0530510_1452490_132_494 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

31

74

0.97

PF12840

HTH_20

Helix-turn-helix domain

29

76

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f72-assembly1.cif.gz_B crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.9449 7 92
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9374 7 76
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9361 21 77
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.9321 33 76
1u2w-assembly1.cif.gz_B crystal structure of the staphylococcus aureus pi258 cadc 0.9287 7 92
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9472 18 74 1.10.10.10
3f72B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9449 7 92 1.10.10.10
af_Q58721_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9405 4 88 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9361 21 77 1.10.10.10
af_O53838_4_115_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.936 1 87 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q6DCW4-F1-model_v4 deleted 0.9964 1 108
AF-A0A2N9MKH2-F1-model_v4 Transcriptional regulator, ArsR family 0.9923 1 110 GO:0003700
AF-A0A354GSP3-F1-model_v4 Transcriptional regulator 0.9913 1 110 GO:0003700
AF-A0A522WBX3-F1-model_v4 ArsR family transcriptional regulator 0.9804 1 105 GO:0003700
AF-A0A832CSQ3-F1-model_v4 ArsR family transcriptional regulator 0.9784 7 92 GO:0003700

Feature Viewer

pLDDT pTM Quality
92.9 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map