F437838

General Info

Members Datasets Scaffolds Average Seq Length
412 283 824 142

Family's Representative Sequence

Representative Sequence 3300031649|Ga0307514_10017283|Ga0307514_100172834
Length 162
Sequence MRFHTGKWTTKSPCYGAPMSSIKKFQVTFDCADPERVARFWCEVLGYVAPAPPEGFDTWDDFNRTLPPEDQGSWFACSDPSGVGPRLFFQRVPEGKVVKNRVHLDVRAGTGLVGEERLATLEAECARLIALGAVHVLTQLADDENESCITLQDIEGNEFCLD

Samples

Sample ID Description Type Environment
1 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
47 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
85 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
86 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
184 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
239 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
240 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
241 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
242 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
243 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
244 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
245 2643221578 Streptomyces sp. Root63 Isolate Unclassified
246 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
247 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
248 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
249 2643221670 Streptomyces sp. Root431 Isolate Unclassified
250 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
251 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
252 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
253 2643221711 Terrabacter sp. Root85 Isolate Unclassified
254 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
255 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
256 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
257 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
258 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
259 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
260 2808606394 Promicromonospora sp. C35 Isolate Unclassified
261 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
262 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
263 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
264 2862574272 Streptomyces sp. AcE210 Isolate Nodule
265 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
266 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
267 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
268 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
269 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
270 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
271 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
272 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
273 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
274 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
275 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
276 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
277 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
278 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
279 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
280 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
281 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
282 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
283 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.14
Metatranscriptomes 1.46
Isolates 11.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.25
Nodule 0.24
Rhizoplane 7.52
Rhizosphere 71.36
Stem 0
Stem Tuber 0.24
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307514_10017283 3300031649 Bacteria 5938
2 ARcpr5oldR_c019176 3300000041 Bacteria 606
3 JGI24737J22298_10020695 3300001990 Bacteria 2099
4 JGI25160J50197_1000387 3300003354 Bacteria 28549
5 Ga0006562J51391_1097382 3300003578 Bacteria 2190
6 Ga0006562J51391_1114221 3300003578 Bacteria 1613
7 Ga0070658_10018746 3300005327 Bacteria 5544
8 Ga0070676_11019774 3300005328 Bacteria 622
9 Ga0070683_100012238 3300005329 Bacteria 7451
10 Ga0070661_100095501 3300005344 Bacteria 2205
11 Ga0070661_101812075 3300005344 Bacteria 518
12 Ga0070668_100000848 3300005347 Bacteria 21179
13 Ga0070708_100282959 3300005445 Bacteria 1561
14 Ga0070708_100371160 3300005445 Bacteria 1349
15 Ga0070708_100768684 3300005445 Bacteria 906
16 Ga0070681_10181112 3300005458 Bacteria 2028
17 Ga0070706_100069512 3300005467 Bacteria 3256
18 Ga0070706_100239818 3300005467 Bacteria 1693
19 Ga0070707_100352452 3300005468 Bacteria 1429
20 Ga0070707_100431744 3300005468 Bacteria 1278
21 Ga0070707_100432822 3300005468 Bacteria 1276
22 Ga0070698_100038853 3300005471 Bacteria 4904
23 Ga0070699_100625149 3300005518 Bacteria 982
24 Ga0070679_100051282 3300005530 Bacteria 4109
25 Ga0070684_100046428 3300005535 Bacteria 3763
26 Ga0070697_100047353 3300005536 Bacteria 3486
27 Ga0070696_100710665 3300005546 Bacteria 820
28 Ga0070664_100243802 3300005564 Bacteria 1614
29 Ga0068857_100152908 3300005577 Bacteria 2091
30 Ga0068856_100358970 3300005614 Bacteria 1476
31 Ga0068856_101692591 3300005614 Bacteria 645
32 Ga0068861_100300458 3300005719 Bacteria 1390
33 Ga0068860_100612362 3300005843 Bacteria 1095
34 Ga0068862_100014601 3300005844 Bacteria 6522
35 Ga0081455_10001225 3300005937 Bacteria 32099
36 Ga0081540_1000070 3300005983 Bacteria 111392
37 Ga0075365_10035170 3300006038 Bacteria 3239
38 Ga0075365_10323469 3300006038 Bacteria 1086
39 Ga0075368_10007306 3300006042 Bacteria 3895
40 Ga0075368_10197892 3300006042 Bacteria 850
41 Ga0075363_100014626 3300006048 Bacteria 3841
42 Ga0075363_100067602 3300006048 Bacteria 1937
43 Ga0075363_100120968 3300006048 Bacteria 1462
44 Ga0075364_10088173 3300006051 Bacteria 2057
45 Ga0075364_10112576 3300006051 Bacteria 1817
46 Ga0075362_10031311 3300006177 Bacteria 2301
47 Ga0075367_10028122 3300006178 Bacteria 3205
48 Ga0075367_10065272 3300006178 Bacteria 2179
49 Ga0075370_10015962 3300006353 Bacteria 4033
50 Ga0075430_100011936 3300006846 Bacteria 7397
51 Ga0075431_100000471 3300006847 Bacteria 33350
52 Ga0105251_10059069 3300009011 Bacteria 1810
53 Ga0105250_10443573 3300009092 Bacteria 581
54 Ga0105245_11855172 3300009098 Bacteria 656
55 Ga0114129_10073174 3300009147 Bacteria 4775
56 Ga0114129_11570944 3300009147 Bacteria 806
57 Ga0105243_11291715 3300009148 Bacteria 746
58 Ga0105242_10153221 3300009176 Bacteria 2012
59 Ga0105237_10003085 3300009545 Bacteria 20068
60 Ga0105239_10161234 3300010375 Bacteria 2505
61 Ga0105239_10286348 3300010375 Bacteria 1855
62 Ga0157347_1054963 3300012502 Bacteria 557
63 Ga0157326_1064674 3300012513 Bacteria 567
64 Ga0157369_10274611 3300013105 Bacteria 1756
65 Ga0163162_10030053 3300013306 Bacteria 5381
66 Ga0157372_10056853 3300013307 Bacteria 4372
67 Ga0157375_11686766 3300013308 Bacteria 750
68 Ga0157377_10826737 3300014745 Bacteria 685
69 Ga0157376_10210381 3300014969 Bacteria 1795
70 Ga0163161_10592595 3300017792 Bacteria 913
71 Ga0206356_10323886 3300020070 Bacteria 1819
72 Ga0206354_10310298 3300020081 Bacteria 1034
73 Ga0206354_11023962 3300020081 Bacteria 522
74 Ga0206353_12031985 3300020082 Bacteria 3013
75 Ga0207426_1000593 3300025302 Bacteria 47865
76 Ga0207426_1015622 3300025302 Bacteria 2749
77 Ga0207688_10187781 3300025901 Bacteria 1235
78 Ga0207647_10158530 3300025904 Bacteria 1321
79 Ga0207705_10318177 3300025909 Bacteria 1195
80 Ga0207684_10079786 3300025910 Bacteria 2784
81 Ga0207684_10665162 3300025910 Bacteria 887
82 Ga0207707_10010039 3300025912 Bacteria 8212
83 Ga0207657_10199396 3300025919 Bacteria 1611
84 Ga0207649_10142135 3300025920 Bacteria 1644
85 Ga0207652_10021330 3300025921 Bacteria 5347
86 Ga0207646_10072635 3300025922 Bacteria 3073
87 Ga0207646_10317546 3300025922 Bacteria 1408
88 Ga0207694_11445410 3300025924 Bacteria 581
89 Ga0207689_10417313 3300025942 Bacteria 1119
90 Ga0207661_10016080 3300025944 Bacteria 5514
91 Ga0207679_10482125 3300025945 Bacteria 1104
92 Ga0207668_10004243 3300025972 Bacteria 8405
93 Ga0207668_10012419 3300025972 Bacteria 5214
94 Ga0207668_10896114 3300025972 Bacteria 789
95 Ga0207677_10031607 3300026023 Bacteria 3392
96 Ga0207708_10241079 3300026075 Bacteria 1454
97 Ga0207702_10358729 3300026078 Bacteria 1397
98 Ga0207674_10024221 3300026116 Bacteria 6490
99 Ga0207675_100374241 3300026118 Bacteria 1400
100 Ga0209371_1034560 3300027312 Bacteria 1070
101 Ga0209813_10005077 3300027866 Bacteria 3180
102 Ga0209813_10075363 3300027866 Bacteria 1105
103 Ga0207428_11267166 3300027907 Bacteria 511
104 Ga0268264_10746400 3300028381 Bacteria 975
105 Ga0307515_10109703 3300028794 Bacteria 3238
106 Ga0307511_10000402 3300030521 Bacteria 46014
107 Ga0307511_10003059 3300030521 Bacteria 17261
108 Ga0307512_10074891 3300030522 Bacteria 2481
109 Ga0314311_1117880 3300030733 Bacteria 814
110 Ga0316179_1063522 3300030734 Bacteria 714
111 Ga0265340_10006749 3300031247 Bacteria 6281
112 Ga0307513_10020649 3300031456 Bacteria 7804
113 Ga0307513_10056023 3300031456 Bacteria 4213
114 Ga0307513_10092987 3300031456 Bacteria 3067
115 Ga0307513_10351087 3300031456 Bacteria 1222
116 Ga0307509_10015782 3300031507 Bacteria 8784
117 Ga0307408_100035566 3300031548 Bacteria 3497
118 Ga0307514_10077434 3300031649 Bacteria 2474
119 Ga0307514_10087553 3300031649 Bacteria 2282
120 Ga0307516_10006221 3300031730 Bacteria 14044
121 Ga0307405_10000521 3300031731 Bacteria 14517
122 Ga0307413_10064877 3300031824 Bacteria 2271
123 Ga0307518_10163539 3300031838 Bacteria 1526
124 Ga0307518_10231867 3300031838 Bacteria 1194
125 Ga0307410_10316086 3300031852 Bacteria 1237
126 Ga0307406_10553098 3300031901 Bacteria 942
127 Ga0307407_10004634 3300031903 Bacteria 5866
128 Ga0307409_102962104 3300031995 Bacteria 501
129 Ga0307416_100037709 3300032002 Bacteria 3722
130 Ga0307415_100000320 3300032126 Bacteria 20808
131 Ga0307415_100436303 3300032126 Bacteria 1128
132 Ga0307510_10067774 3300033180 Bacteria 3588
133 Ga0395900_0029767 3300037418 Bacteria 5604
134 Ga0395898_0202951 3300037466 Bacteria 1892
135 Ga0436364_0770446 3300037853 Bacteria 3039
136 Ga0395901_0204605 3300038443 Bacteria 2068
137 Ga0436363_1175362 3300039450 Bacteria 2308
138 Ga0439465_0015648 3300041413 Bacteria 2366
139 Ga0451800_1058959 3300041459 Bacteria 706
140 Ga0439431_0004706 3300041997 Bacteria 3002
141 Ga0439442_015951 3300042002 Bacteria 1549
142 Ga0439449_0303733 3300042007 Bacteria 603
143 Ga0466969_0014945 3300044656 Bacteria 4073
144 Ga0466969_0177007 3300044656 Bacteria 977
145 Ga0466972_0027140 3300044658 Bacteria 2834
146 Ga0466972_0032796 3300044658 Bacteria 2549
147 Ga0466965_0008033 3300044683 Bacteria 4871
148 Ga0466965_0306276 3300044683 Bacteria 863
149 Ga0466966_0107117 3300044684 Bacteria 1725
150 Ga0466961_0406108 3300044693 Bacteria 826
151 Ga0466963_0109398 3300044694 Bacteria 1896
152 Ga0466963_0143166 3300044694 Bacteria 1657
153 Ga0466968_0449262 3300044735 Bacteria 637
154 Ga0466970_0004988 3300044765 Bacteria 6557
155 Ga0466970_0089931 3300044765 Bacteria 1666
156 Ga0466970_0311574 3300044765 Bacteria 889
157 Ga0466960_0404801 3300044901 Bacteria 786
158 Ga0466967_0280600 3300045976 Bacteria 1598
159 Ga0466967_0866602 3300045976 Bacteria 898
160 Ga0495592_0061779 3300046454 Bacteria 2752
161 Ga0495603_0000444 3300046455 Bacteria 22690
162 Ga0495603_0001404 3300046455 Bacteria 14017
163 Ga0495603_0002401 3300046455 Bacteria 11007
164 Ga0495603_0002650 3300046455 Bacteria 10552
165 Ga0495603_0044870 3300046455 Bacteria 2637
166 Ga0495629_0013041 3300046459 Bacteria 6005
167 Ga0495629_0070297 3300046459 Bacteria 2442
168 Ga0495629_0115470 3300046459 Bacteria 1871
169 Ga0495629_0254985 3300046459 Bacteria 1206
170 Ga0495638_0279317 3300046460 Bacteria 908
171 Ga0495641_0206298 3300046461 Bacteria 881
172 Ga0495651_0063921 3300046462 Bacteria 2812
173 Ga0495651_0295489 3300046462 Bacteria 1088
174 Ga0495653_0026817 3300046463 Bacteria 4616
175 Ga0495580_0085772 3300046472 Bacteria 2193
176 Ga0495582_0781367 3300046473 Bacteria 552
177 Ga0495605_0006116 3300046474 Bacteria 6941
178 Ga0495605_0048296 3300046474 Bacteria 2084
179 Ga0495639_0054404 3300046475 Bacteria 1824
180 Ga0495662_0011901 3300046476 Bacteria 4251
181 Ga0495662_0015772 3300046476 Bacteria 3667
182 Ga0495662_0392745 3300046476 Bacteria 681
183 Ga0495664_0060001 3300046477 Bacteria 2264
184 Ga0495664_0427543 3300046477 Bacteria 794
185 Ga0495585_0029514 3300046492 Bacteria 3121
186 Ga0495585_0148969 3300046492 Bacteria 1221
187 Ga0495594_0000577 3300046499 Bacteria 18867
188 Ga0495594_0003916 3300046499 Bacteria 7656
189 Ga0495594_0686546 3300046499 Bacteria 579
190 Ga0495596_0145374 3300046500 Bacteria 921
191 Ga0495607_0049727 3300046501 Bacteria 2443
192 Ga0495583_0004210 3300046506 Bacteria 10469
193 Ga0495583_0442570 3300046506 Bacteria 509
194 Ga0495606_0014990 3300046507 Bacteria 6009
195 Ga0495608_0013882 3300046511 Bacteria 5592
196 Ga0495616_0059800 3300046513 Bacteria 1873
197 Ga0495618_0045688 3300046514 Bacteria 2763
198 Ga0495620_0047369 3300046515 Bacteria 1850
199 Ga0495620_0164813 3300046515 Bacteria 860
200 Ga0495628_0016249 3300046516 Bacteria 6210
201 Ga0495628_0020222 3300046516 Bacteria 5494
202 Ga0495628_0032601 3300046516 Bacteria 4204
203 Ga0495628_0368045 3300046516 Bacteria 1054
204 Ga0495630_1174743 3300046517 Bacteria 580
205 Ga0495631_0017433 3300046518 Bacteria 3398
206 Ga0495632_0481853 3300046519 Bacteria 536
207 Ga0495643_0018765 3300046522 Bacteria 4008
208 Ga0495648_0102101 3300046524 Bacteria 1581
209 Ga0495666_0006551 3300046526 Bacteria 5858
210 Ga0495666_0013076 3300046526 Bacteria 4136
211 Ga0495666_0101066 3300046526 Bacteria 1359
212 Ga0495652_0007681 3300046529 Bacteria 9931
213 Ga0495652_0080862 3300046529 Bacteria 2682
214 Ga0495652_0189698 3300046529 Bacteria 1569
215 Ga0495652_0348136 3300046529 Bacteria 1062
216 Ga0495665_0039263 3300046531 Bacteria 2522
217 Ga0495640_0018289 3300046533 Bacteria 5201
218 Ga0495586_0060280 3300046535 Bacteria 2063
219 Ga0495587_0090503 3300046536 Bacteria 1767
220 Ga0495645_0020482 3300046543 Bacteria 4773
221 Ga0495645_0025601 3300046543 Bacteria 4283
222 Ga0495633_0129135 3300046558 Bacteria 1169
223 Ga0495633_0184601 3300046558 Bacteria 960
224 Ga0495667_0104650 3300046559 Bacteria 1829
225 Ga0495667_0304911 3300046559 Bacteria 1009
226 Ga0495656_0123038 3300046615 Bacteria 1227
227 Ga0495668_0002830 3300046616 Bacteria 13794
228 Ga0495668_0080862 3300046616 Bacteria 1783
229 Ga0495634_0017571 3300046642 Bacteria 5101
230 Ga0495634_0053515 3300046642 Bacteria 2704
231 Ga0495634_0704406 3300046642 Bacteria 580
232 Ga0495625_0032477 3300046660 Bacteria 3869
233 Ga0495635_0012627 3300046663 Bacteria 5923
234 Ga0495635_0456240 3300046663 Bacteria 844
235 Ga0495588_0032420 3300046674 Bacteria 2634
236 Ga0495588_0034067 3300046674 Bacteria 2576
237 Ga0495657_0029600 3300046675 Bacteria 3839
238 Ga0495657_0046945 3300046675 Bacteria 2922
239 Ga0495657_0092791 3300046675 Bacteria 1933
240 Ga0495599_0643742 3300046678 Bacteria 614
241 Ga0495623_0048205 3300046679 Bacteria 2703
242 Ga0495623_0100130 3300046679 Bacteria 1766
243 Ga0495623_0157348 3300046679 Bacteria 1338
244 Ga0495646_0119359 3300046680 Bacteria 1493
245 Ga0495613_0009807 3300046689 Bacteria 7120
246 Ga0495613_0166187 3300046689 Bacteria 1567
247 Ga0495613_0290994 3300046689 Bacteria 1132
248 Ga0495613_0559800 3300046689 Bacteria 764
249 Ga0495624_0004170 3300046690 Bacteria 10624
250 Ga0495624_0035258 3300046690 Bacteria 3231
251 Ga0495670_0391223 3300046691 Bacteria 751
252 Ga0495649_0024339 3300046694 Bacteria 3377
253 Ga0495649_0158198 3300046694 Bacteria 1188
254 Ga0495589_0021403 3300046794 Bacteria 3305
255 Ga0495589_0070524 3300046794 Bacteria 1708
256 Ga0495600_0003001 3300046809 Bacteria 9856
257 Ga0495600_0106819 3300046809 Bacteria 1823
258 Ga0495660_0015402 3300046810 Bacteria 4418
259 Ga0495660_0118228 3300046810 Bacteria 1344
260 Ga0495581_0017575 3300047315 Bacteria 4154
261 Ga0495581_0104873 3300047315 Bacteria 1643
262 Ga0495581_0591037 3300047315 Bacteria 643
263 Ga0495604_0005397 3300047317 Bacteria 10141
264 Ga0495604_0007954 3300047317 Bacteria 8399
265 Ga0495604_0040545 3300047317 Bacteria 3656
266 Ga0495604_0072844 3300047317 Bacteria 2595
267 Ga0495604_0121576 3300047317 Bacteria 1889
268 Ga0495604_0748985 3300047317 Bacteria 618
269 Ga0495636_0039440 3300047318 Bacteria 1956
270 Ga0495674_0115324 3300047319 Bacteria 2274
271 Ga0495674_0141572 3300047319 Bacteria 2021
272 Ga0495676_0009589 3300047321 Bacteria 8813
273 Ga0495676_0057074 3300047321 Bacteria 3083
274 Ga0495680_0024638 3300047322 Bacteria 4990
275 Ga0495683_0023654 3300047323 Bacteria 3157
276 Ga0495683_0053626 3300047323 Bacteria 2010
277 Ga0495687_001760 3300047443 Bacteria 19147
278 Ga0495687_008337 3300047443 Bacteria 5948
279 Ga0495687_010387 3300047443 Bacteria 5110
280 Ga0495687_011187 3300047443 Bacteria 4843
281 Ga0495687_017537 3300047443 Bacteria 3568
282 Ga0495687_017922 3300047443 Bacteria 3514
283 Ga0495675_0054242 3300047444 Bacteria 2544
284 Ga0495675_0099166 3300047444 Bacteria 1824
285 Ga0495685_014013 3300047447 Bacteria 2721
286 Ga0495684_0028077 3300047471 Bacteria 4321
287 Ga0495686_0109858 3300047472 Bacteria 1655
288 Ga0495593_0002834 3300047673 Bacteria 10441
289 Ga0495593_0078158 3300047673 Bacteria 1714
290 Ga0495602_0186492 3300048088 Bacteria 1594
291 Ga0495614_0001704 3300048089 Bacteria 9589
292 Ga0495614_0244545 3300048089 Bacteria 820
293 Ga0496100_0019733 3300048903 Bacteria 4028
294 Ga0496100_0768420 3300048903 Bacteria 754
295 Ga0496101_0014373 3300048904 Bacteria 5318
296 Ga0496101_0035454 3300048904 Bacteria 3529
297 Ga0496101_0301017 3300048904 Bacteria 1256
298 Ga0496102_0026850 3300048905 Bacteria 5139
299 Ga0496102_0104696 3300048905 Bacteria 2632
300 Ga0496102_0135347 3300048905 Bacteria 2309
301 Ga0496102_0468177 3300048905 Bacteria 1181
302 Ga0496102_0978752 3300048905 Bacteria 767
303 Ga0496103_0004520 3300048906 Bacteria 8429
304 Ga0496103_0064899 3300048906 Bacteria 2277
305 Ga0496104_0002208 3300048907 Bacteria 16834
306 Ga0496104_0025790 3300048907 Bacteria 5420
307 Ga0496105_0009716 3300048908 Bacteria 7535
308 Ga0496105_0012876 3300048908 Bacteria 6629
309 Ga0496106_0510103 3300048909 Bacteria 966
310 Ga0496109_0756909 3300048912 Bacteria 909
311 Ga0496109_1607667 3300048912 Bacteria 584
312 Ga0496110_1109857 3300048913 Bacteria 699
313 Ga0496111_0146411 3300048914 Bacteria 1751
314 Ga0496112_0774952 3300048915 Bacteria 885
315 Ga0496112_0858689 3300048915 Bacteria 831
316 Ga0496112_1721321 3300048915 Bacteria 539
317 Ga0496113_0097919 3300048916 Bacteria 2270
318 Ga0496114_0012268 3300048917 Bacteria 6858
319 Ga0496114_0137590 3300048917 Bacteria 2112
320 Ga0496114_0195062 3300048917 Bacteria 1772
321 Ga0496114_0769384 3300048917 Bacteria 841
322 Ga0496114_1511449 3300048917 Bacteria 559
323 Ga0496118_0003443 3300048921 Bacteria 19918
324 Ga0496119_0132434 3300048922 Bacteria 1357
325 Ga0496120_0169445 3300048923 Bacteria 1081
326 Ga0496121_0049533 3300048924 Bacteria 3561
327 Ga0496123_0027556 3300048926 Bacteria 4229
328 Ga0495682_0138990 3300049460 Bacteria 868
329 Ga0501031_0008922 3300049568 Bacteria 6519
330 Ga0501034_0013145 3300049571 Bacteria 8530
331 Ga0501037_0006007 3300049573 Bacteria 8864
332 Ga0501038_0113213 3300049574 Bacteria 2245
333 Ga0501039_0106464 3300049575 Bacteria 2190
334 Ga0501043_0121871 3300049579 Bacteria 2045
335 Ga0501046_0446906 3300049580 Bacteria 930
336 Ga0501047_0193351 3300049581 Bacteria 1897
337 Ga0501073_0508102 3300049589 Bacteria 833
338 Ga0501074_0019176 3300049590 Bacteria 4966
339 Ga0501044_0005407 3300049823 Bacteria 14187
340 Ga0501044_0998306 3300049823 Bacteria 709
341 nmdc:mga03683_107281_c1 3300050489 Bacteria 1232
342 nmdc:mga03n38_24346_c1 3300050490 Bacteria 2475
343 nmdc:mga03n38_43888_c1 3300050490 Bacteria 1961
344 nmdc:mga00v17_25583_c2 3300050491 Bacteria 1485
345 nmdc:mga00v17_72576_c1 3300050491 Bacteria 2136
346 nmdc:mga0yw44_13482_c1 3300050492 Bacteria 4307
347 nmdc:mga0yw44_293691_c1 3300050492 Bacteria 1088
348 nmdc:mga06z11_20086_c1 3300050494 Bacteria 3083
349 nmdc:mga06z11_8749_c1 3300050494 Bacteria 4240
350 nmdc:mga04h51_10806_c1 3300050495 Bacteria 2518
351 nmdc:mga04h51_42965_c1 3300050495 Bacteria 1485
352 nmdc:mga07m45_360380_c1 3300050496 Bacteria 845
353 nmdc:mga07m45_425879_c1 3300050496 Bacteria 770
354 nmdc:mga07m45_44610_c1 3300050496 Bacteria 2489
355 nmdc:mga05p37_109774_c1 3300050507 Bacteria 3393
356 nmdc:mga09592_6335_c1 3300050508 Bacteria 9644
357 nmdc:mga0qj67_2079_c1 3300050509 Bacteria 14284
358 nmdc:mga06r32_5457_c1 3300050510 Bacteria 11451
359 nmdc:mga0n895_206967_c1 3300050512 Bacteria 1992
360 Ga0495601_0071914 3300053077 Bacteria 2209
361 Ga0495612_0288779 3300053078 Bacteria 734
362 Ga0495619_0050622 3300053085 Bacteria 2743
363 Ga0495619_0117172 3300053085 Bacteria 1824
364 Ga0500644_0000172 3300053088 Bacteria 41281
365 Ga0500600_0232467 3300053149 Bacteria 841
366 2515494222 2515154088 Bacteria 5526283
367 2516090530 2515154203 Bacteria 5458536
368 2547409819 2547132111 Bacteria 8013147
369 2585303076 2582581313 Bacteria 10042643
370 2585317917 2582581314 Bacteria 11452267
371 2586061953 2585427649 Bacteria 9053857
372 2643904181 2643221578 Bacteria 9213798
373 2643947010 2643221587 Bacteria 7586415
374 2644016154 2643221601 Bacteria 7493239
375 2644179638 2643221631 Bacteria 8168043
376 2644389857 2643221670 Bacteria 6497041
377 2644402536 2643221673 Bacteria 9196637
378 2644433518 2643221677 Bacteria 7584031
379 2644438607 2643221678 Bacteria 9540101
380 2644608361 2643221711 Bacteria 4865335
381 2738692870 2738541272 Bacteria 6848551
382 2739327189 2738543027 Bacteria 6409078
383 2739604809 2739367654 Bacteria 6049412
384 2753071888 2751185734 Bacteria 8863695
385 2760306145 2758568522 Bacteria 5953541
386 2760623246 2758568621 Bacteria 5967089
387 2809027989 2808606394 Bacteria 6248540
388 2812483372 2811994917 Bacteria 7761064
389 2819668075 2818991458 Bacteria 4794049
390 2862185600 2862178590 Bacteria 8583590
391 2862581770 2862574272 Bacteria 10567477
392 2867314800 2867312974 Bacteria 7058875
393 2867322186 2867319477 Bacteria 7069771
394 2868092964 2868088558 Bacteria 7609351
395 2870722257 2870721527 Bacteria 9689237
396 2884996547 2884994152 Bacteria 4492978
397 2899372629 2899370129 Bacteria 6781179
398 2918501440 2918501144 Bacteria 8668083
399 2928106487 2928104781 Bacteria 3877447
400 2946047177 2946045630 Bacteria 8527308
401 2946072470 2946072368 Bacteria 8999607
402 2946079910 2946072368 Bacteria 8999607
403 2966605224 2966598605 Bacteria 7676064
404 2990093694 2990088156 Bacteria 6657676
405 2995467612 2995463766 Bacteria 8577691
406 2997605011 2997600082 Bacteria 9896405
407 2997607894 2997600082 Bacteria 9896405
408 3006393976 3006393351 Bacteria 6615579
409 8008580934 8008574985 Bacteria 7815457
410 8025531362 8025530807 Bacteria 8495698
411 8054165905 8054160619 Bacteria 7783213
412 8056580961 8056579771 Bacteria 5840325
413 Ga0307514_10017283
414 ARcpr5oldR_c019176
415 JGI24737J22298_10020695
416 JGI25160J50197_1000387
417 Ga0006562J51391_1097382
418 Ga0006562J51391_1114221
419 Ga0070658_10018746
420 Ga0070676_11019774
421 Ga0070683_100012238
422 Ga0070661_100095501
423 Ga0070661_101812075
424 Ga0070668_100000848
425 Ga0070708_100282959
426 Ga0070708_100371160
427 Ga0070708_100768684
428 Ga0070681_10181112
429 Ga0070706_100069512
430 Ga0070706_100239818
431 Ga0070707_100352452
432 Ga0070707_100431744
433 Ga0070707_100432822
434 Ga0070698_100038853
435 Ga0070699_100625149
436 Ga0070679_100051282
437 Ga0070684_100046428
438 Ga0070697_100047353
439 Ga0070696_100710665
440 Ga0070664_100243802
441 Ga0068857_100152908
442 Ga0068856_100358970
443 Ga0068856_101692591
444 Ga0068861_100300458
445 Ga0068860_100612362
446 Ga0068862_100014601
447 Ga0081455_10001225
448 Ga0081540_1000070
449 Ga0075365_10035170
450 Ga0075365_10323469
451 Ga0075368_10007306
452 Ga0075368_10197892
453 Ga0075363_100014626
454 Ga0075363_100067602
455 Ga0075363_100120968
456 Ga0075364_10088173
457 Ga0075364_10112576
458 Ga0075362_10031311
459 Ga0075367_10028122
460 Ga0075367_10065272
461 Ga0075370_10015962
462 Ga0075430_100011936
463 Ga0075431_100000471
464 Ga0105251_10059069
465 Ga0105250_10443573
466 Ga0105245_11855172
467 Ga0114129_10073174
468 Ga0114129_11570944
469 Ga0105243_11291715
470 Ga0105242_10153221
471 Ga0105237_10003085
472 Ga0105239_10161234
473 Ga0105239_10286348
474 Ga0157347_1054963
475 Ga0157326_1064674
476 Ga0157369_10274611
477 Ga0163162_10030053
478 Ga0157372_10056853
479 Ga0157375_11686766
480 Ga0157377_10826737
481 Ga0157376_10210381
482 Ga0163161_10592595
483 Ga0206356_10323886
484 Ga0206354_10310298
485 Ga0206354_11023962
486 Ga0206353_12031985
487 Ga0207426_1000593
488 Ga0207426_1015622
489 Ga0207688_10187781
490 Ga0207647_10158530
491 Ga0207705_10318177
492 Ga0207684_10079786
493 Ga0207684_10665162
494 Ga0207707_10010039
495 Ga0207657_10199396
496 Ga0207649_10142135
497 Ga0207652_10021330
498 Ga0207646_10072635
499 Ga0207646_10317546
500 Ga0207694_11445410
501 Ga0207689_10417313
502 Ga0207661_10016080
503 Ga0207679_10482125
504 Ga0207668_10004243
505 Ga0207668_10012419
506 Ga0207668_10896114
507 Ga0207677_10031607
508 Ga0207708_10241079
509 Ga0207702_10358729
510 Ga0207674_10024221
511 Ga0207675_100374241
512 Ga0209371_1034560
513 Ga0209813_10005077
514 Ga0209813_10075363
515 Ga0207428_11267166
516 Ga0268264_10746400
517 Ga0307515_10109703
518 Ga0307511_10000402
519 Ga0307511_10003059
520 Ga0307512_10074891
521 Ga0314311_1117880
522 Ga0316179_1063522
523 Ga0265340_10006749
524 Ga0307513_10020649
525 Ga0307513_10056023
526 Ga0307513_10092987
527 Ga0307513_10351087
528 Ga0307509_10015782
529 Ga0307408_100035566
530 Ga0307514_10077434
531 Ga0307514_10087553
532 Ga0307516_10006221
533 Ga0307405_10000521
534 Ga0307413_10064877
535 Ga0307518_10163539
536 Ga0307518_10231867
537 Ga0307410_10316086
538 Ga0307406_10553098
539 Ga0307407_10004634
540 Ga0307409_102962104
541 Ga0307416_100037709
542 Ga0307415_100000320
543 Ga0307415_100436303
544 Ga0307510_10067774
545 Ga0395900_0029767
546 Ga0395898_0202951
547 Ga0436364_0770446
548 Ga0395901_0204605
549 Ga0436363_1175362
550 Ga0439465_0015648
551 Ga0451800_1058959
552 Ga0439431_0004706
553 Ga0439442_015951
554 Ga0439449_0303733
555 Ga0466969_0014945
556 Ga0466969_0177007
557 Ga0466972_0027140
558 Ga0466972_0032796
559 Ga0466965_0008033
560 Ga0466965_0306276
561 Ga0466966_0107117
562 Ga0466961_0406108
563 Ga0466963_0109398
564 Ga0466963_0143166
565 Ga0466968_0449262
566 Ga0466970_0004988
567 Ga0466970_0089931
568 Ga0466970_0311574
569 Ga0466960_0404801
570 Ga0466967_0280600
571 Ga0466967_0866602
572 Ga0495592_0061779
573 Ga0495603_0000444
574 Ga0495603_0001404
575 Ga0495603_0002401
576 Ga0495603_0002650
577 Ga0495603_0044870
578 Ga0495629_0013041
579 Ga0495629_0070297
580 Ga0495629_0115470
581 Ga0495629_0254985
582 Ga0495638_0279317
583 Ga0495641_0206298
584 Ga0495651_0063921
585 Ga0495651_0295489
586 Ga0495653_0026817
587 Ga0495580_0085772
588 Ga0495582_0781367
589 Ga0495605_0006116
590 Ga0495605_0048296
591 Ga0495639_0054404
592 Ga0495662_0011901
593 Ga0495662_0015772
594 Ga0495662_0392745
595 Ga0495664_0060001
596 Ga0495664_0427543
597 Ga0495585_0029514
598 Ga0495585_0148969
599 Ga0495594_0000577
600 Ga0495594_0003916
601 Ga0495594_0686546
602 Ga0495596_0145374
603 Ga0495607_0049727
604 Ga0495583_0004210
605 Ga0495583_0442570
606 Ga0495606_0014990
607 Ga0495608_0013882
608 Ga0495616_0059800
609 Ga0495618_0045688
610 Ga0495620_0047369
611 Ga0495620_0164813
612 Ga0495628_0016249
613 Ga0495628_0020222
614 Ga0495628_0032601
615 Ga0495628_0368045
616 Ga0495630_1174743
617 Ga0495631_0017433
618 Ga0495632_0481853
619 Ga0495643_0018765
620 Ga0495648_0102101
621 Ga0495666_0006551
622 Ga0495666_0013076
623 Ga0495666_0101066
624 Ga0495652_0007681
625 Ga0495652_0080862
626 Ga0495652_0189698
627 Ga0495652_0348136
628 Ga0495665_0039263
629 Ga0495640_0018289
630 Ga0495586_0060280
631 Ga0495587_0090503
632 Ga0495645_0020482
633 Ga0495645_0025601
634 Ga0495633_0129135
635 Ga0495633_0184601
636 Ga0495667_0104650
637 Ga0495667_0304911
638 Ga0495656_0123038
639 Ga0495668_0002830
640 Ga0495668_0080862
641 Ga0495634_0017571
642 Ga0495634_0053515
643 Ga0495634_0704406
644 Ga0495625_0032477
645 Ga0495635_0012627
646 Ga0495635_0456240
647 Ga0495588_0032420
648 Ga0495588_0034067
649 Ga0495657_0029600
650 Ga0495657_0046945
651 Ga0495657_0092791
652 Ga0495599_0643742
653 Ga0495623_0048205
654 Ga0495623_0100130
655 Ga0495623_0157348
656 Ga0495646_0119359
657 Ga0495613_0009807
658 Ga0495613_0166187
659 Ga0495613_0290994
660 Ga0495613_0559800
661 Ga0495624_0004170
662 Ga0495624_0035258
663 Ga0495670_0391223
664 Ga0495649_0024339
665 Ga0495649_0158198
666 Ga0495589_0021403
667 Ga0495589_0070524
668 Ga0495600_0003001
669 Ga0495600_0106819
670 Ga0495660_0015402
671 Ga0495660_0118228
672 Ga0495581_0017575
673 Ga0495581_0104873
674 Ga0495581_0591037
675 Ga0495604_0005397
676 Ga0495604_0007954
677 Ga0495604_0040545
678 Ga0495604_0072844
679 Ga0495604_0121576
680 Ga0495604_0748985
681 Ga0495636_0039440
682 Ga0495674_0115324
683 Ga0495674_0141572
684 Ga0495676_0009589
685 Ga0495676_0057074
686 Ga0495680_0024638
687 Ga0495683_0023654
688 Ga0495683_0053626
689 Ga0495687_001760
690 Ga0495687_008337
691 Ga0495687_010387
692 Ga0495687_011187
693 Ga0495687_017537
694 Ga0495687_017922
695 Ga0495675_0054242
696 Ga0495675_0099166
697 Ga0495685_014013
698 Ga0495684_0028077
699 Ga0495686_0109858
700 Ga0495593_0002834
701 Ga0495593_0078158
702 Ga0495602_0186492
703 Ga0495614_0001704
704 Ga0495614_0244545
705 Ga0496100_0019733
706 Ga0496100_0768420
707 Ga0496101_0014373
708 Ga0496101_0035454
709 Ga0496101_0301017
710 Ga0496102_0026850
711 Ga0496102_0104696
712 Ga0496102_0135347
713 Ga0496102_0468177
714 Ga0496102_0978752
715 Ga0496103_0004520
716 Ga0496103_0064899
717 Ga0496104_0002208
718 Ga0496104_0025790
719 Ga0496105_0009716
720 Ga0496105_0012876
721 Ga0496106_0510103
722 Ga0496109_0756909
723 Ga0496109_1607667
724 Ga0496110_1109857
725 Ga0496111_0146411
726 Ga0496112_0774952
727 Ga0496112_0858689
728 Ga0496112_1721321
729 Ga0496113_0097919
730 Ga0496114_0012268
731 Ga0496114_0137590
732 Ga0496114_0195062
733 Ga0496114_0769384
734 Ga0496114_1511449
735 Ga0496118_0003443
736 Ga0496119_0132434
737 Ga0496120_0169445
738 Ga0496121_0049533
739 Ga0496123_0027556
740 Ga0495682_0138990
741 Ga0501031_0008922
742 Ga0501034_0013145
743 Ga0501037_0006007
744 Ga0501038_0113213
745 Ga0501039_0106464
746 Ga0501043_0121871
747 Ga0501046_0446906
748 Ga0501047_0193351
749 Ga0501073_0508102
750 Ga0501074_0019176
751 Ga0501044_0005407
752 Ga0501044_0998306
753 nmdc:mga03683_107281_c1
754 nmdc:mga03n38_24346_c1
755 nmdc:mga03n38_43888_c1
756 nmdc:mga00v17_25583_c2
757 nmdc:mga00v17_72576_c1
758 nmdc:mga0yw44_13482_c1
759 nmdc:mga0yw44_293691_c1
760 nmdc:mga06z11_20086_c1
761 nmdc:mga06z11_8749_c1
762 nmdc:mga04h51_10806_c1
763 nmdc:mga04h51_42965_c1
764 nmdc:mga07m45_360380_c1
765 nmdc:mga07m45_425879_c1
766 nmdc:mga07m45_44610_c1
767 nmdc:mga05p37_109774_c1
768 nmdc:mga09592_6335_c1
769 nmdc:mga0qj67_2079_c1
770 nmdc:mga06r32_5457_c1
771 nmdc:mga0n895_206967_c1
772 Ga0495601_0071914
773 Ga0495612_0288779
774 Ga0495619_0050622
775 Ga0495619_0117172
776 Ga0500644_0000172
777 Ga0500600_0232467
778 2515494222
779 2516090530
780 2547409819
781 2585303076
782 2585317917
783 2586061953
784 2643904181
785 2643947010
786 2644016154
787 2644179638
788 2644389857
789 2644402536
790 2644433518
791 2644438607
792 2644608361
793 2738692870
794 2739327189
795 2739604809
796 2753071888
797 2760306145
798 2760623246
799 2809027989
800 2812483372
801 2819668075
802 2862185600
803 2862581770
804 2867314800
805 2867322186
806 2868092964
807 2870722257
808 2884996547
809 2899372629
810 2918501440
811 2928106487
812 2946047177
813 2946072470
814 2946079910
815 2966605224
816 2990093694
817 2995467612
818 2997605011
819 2997607894
820 3006393976
821 8008580934
822 8025531362
823 8054165905
824 8056580961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

26

161

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zu5-assembly1.cif.gz_SE0 structure of the paranosema locustae ribosome in complex with lso2 0.773 110 137
6tmf-assembly1.cif.gz_F structure of an archaeal abce1-bound ribosomal post-splitting complex 0.7409 112 137
2kjz-assembly1.cif.gz_B solution nmr structure of protein atc0852 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att2. 0.7316 3 138
8p5d-assembly1.cif.gz_SE0 spraguea lophii ribosome in the closed conformation by cryo sub tomogram averaging 0.7288 110 137
6th6-assembly1.cif.gz_Af cryo-em structure of t. kodakarensis 70s ribosome 0.727 112 137
ID Description Score Start End Superfamily
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8289 3 138 3.10.180.10
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8025 3 138 3.10.180.10
3vcxB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.785 7 67 3.30.720.120
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7825 96 138 3.30.460.40
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7675 9 138 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6A8RF46-F1-model_v4 deleted 0.9442 85 139
AF-A0A4V2EXV8-F1-model_v4 Glyoxalase-like domain-containing protein 0.9238 1 139
AF-A0A2G7C126-F1-model_v4 deleted 0.9229 1 139
AF-A0A1C5EIB2-F1-model_v4 Glyoxalase-like domain-containing protein 0.9208 1 139
AF-A0A7W7G6T5-F1-model_v4 Glyoxalase-like domain-containing protein 0.9189 3 139

Map