F437825

General Info

Members Datasets Scaffolds Average Seq Length
412 192 824 316

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10154676|Ga0207709_101546761
Length 337
Sequence MDGPLTPRDVAAPDPVAPAAGSAVDAGGATRPIAGRRQVFLPSEVDPTVFDEGFLRQLERLLVLMRSPVRGGLKGGRRSVKRGQSVEFADYRDYALGDDLRQLDWNVYARLERLFVKLFIEEEDVTVTLLVDASASMAAGRPAKLLFAKRAAAALGYIGLASEDRVTVSALAGRVARRRAAMRGSGRIFRLLSDLSAIQPADGPTDLVAAARHAAAQLHGRGVVILFSDLLDPGADRIIRELAATGSELIVMHVLSPEELDPALEGDVRLVDVETGDGIDVTVDLATLDAYQARLAAWKGGFADLAAKRRASYVDLSSDTNLAVLMFNELRRRRVLG

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
127 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 7.52
Rhizosphere 92.23
Stem 0
Stem Tuber 0
Unclassified 6.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10154676 3300025935 Bacteria 1592
2 Ga0070683_100388399 3300005329 Bacteria 1330
3 Ga0070690_100011561 3300005330 Bacteria 5166
4 Ga0070670_100015783 3300005331 Bacteria 6483
5 Ga0070677_10092039 3300005333 Bacteria 1321
6 Ga0068869_100195725 3300005334 Bacteria 1592
7 Ga0070680_100000001 3300005336 Bacteria 276263
8 Ga0070682_100143400 3300005337 Bacteria 1631
9 Ga0070682_100176004 3300005337 Bacteria 1490
10 Ga0070689_100043155 3300005340 Bacteria 3464
11 Ga0070687_100016077 3300005343 Bacteria 3402
12 Ga0070687_100020942 3300005343 Bacteria 3066
13 Ga0070661_100065372 3300005344 Bacteria 2673
14 Ga0070668_100079082 3300005347 Bacteria 2574
15 Ga0070669_100039621 3300005353 Bacteria 3424
16 Ga0070675_100045727 3300005354 Bacteria 3583
17 Ga0070674_100014674 3300005356 Bacteria 4874
18 Ga0070674_100041054 3300005356 Bacteria 3133
19 Ga0070688_100012574 3300005365 Bacteria 4745
20 Ga0070659_100139015 3300005366 Bacteria 1977
21 Ga0070667_100230868 3300005367 Bacteria 1650
22 Ga0070667_100480081 3300005367 Bacteria 1138
23 Ga0070703_10053591 3300005406 Bacteria 1298
24 Ga0070701_10011010 3300005438 Bacteria 4023
25 Ga0070705_100004902 3300005440 Bacteria 6519
26 Ga0070705_100033982 3300005440 Bacteria 2847
27 Ga0070705_100086189 3300005440 Bacteria 1944
28 Ga0070700_100040560 3300005441 Bacteria 2851
29 Ga0070694_100051038 3300005444 Bacteria 2791
30 Ga0070694_100285971 3300005444 Unclassified 1259
31 Ga0070694_100311159 3300005444 Unclassified 1210
32 Ga0070694_100401140 3300005444 Bacteria 1073
33 Ga0070708_100002051 3300005445 Bacteria 15526
34 Ga0070708_100098276 3300005445 Bacteria 2677
35 Ga0070663_100273041 3300005455 Bacteria 1345
36 Ga0070678_100284395 3300005456 Bacteria 1400
37 Ga0070662_100012593 3300005457 Bacteria 5611
38 Ga0070681_10073671 3300005458 Bacteria 3377
39 Ga0070681_10075439 3300005458 Bacteria 3332
40 Ga0068867_100038658 3300005459 Bacteria 3474
41 Ga0070706_100000469 3300005467 Bacteria 47854
42 Ga0070706_100011189 3300005467 Bacteria 8331
43 Ga0070706_100028463 3300005467 Bacteria 5144
44 Ga0070707_100000163 3300005468 Bacteria 63764
45 Ga0070707_100054863 3300005468 Bacteria 3821
46 Ga0070707_100079430 3300005468 Bacteria 3166
47 Ga0070707_100099275 3300005468 Bacteria 2820
48 Ga0070707_100557164 3300005468 Unclassified 1108
49 Ga0070698_100031527 3300005471 Bacteria 5495
50 Ga0070698_100037670 3300005471 Bacteria 4985
51 Ga0070698_100055503 3300005471 Bacteria 4016
52 Ga0070698_100075145 3300005471 Bacteria 3384
53 Ga0070698_100125735 3300005471 Bacteria 2521
54 Ga0070698_100152529 3300005471 Bacteria 2257
55 Ga0070699_100000999 3300005518 Bacteria 26314
56 Ga0070699_100014334 3300005518 Bacteria 6815
57 Ga0070699_100021185 3300005518 Bacteria 5604
58 Ga0070699_100131948 3300005518 Bacteria 2202
59 Ga0070699_100175230 3300005518 Unclassified 1901
60 Ga0070699_100247912 3300005518 Bacteria 1591
61 Ga0070679_100213619 3300005530 Bacteria 1892
62 Ga0070684_100049547 3300005535 Bacteria 3645
63 Ga0070684_100063070 3300005535 Unclassified 3248
64 Ga0070697_100019155 3300005536 Bacteria 5403
65 Ga0070697_100034922 3300005536 Bacteria 4055
66 Ga0068853_100066079 3300005539 Bacteria 3140
67 Ga0070686_100034581 3300005544 Bacteria 3115
68 Ga0070695_100091407 3300005545 Bacteria 2033
69 Ga0070695_100157848 3300005545 Bacteria 1589
70 Ga0070696_100008766 3300005546 Bacteria 6766
71 Ga0070696_100008899 3300005546 Bacteria 6719
72 Ga0070696_100223162 3300005546 Bacteria 1415
73 Ga0070696_100269414 3300005546 Bacteria 1294
74 Ga0070693_100067489 3300005547 Bacteria 2097
75 Ga0070704_100169067 3300005549 Unclassified 1736
76 Ga0070704_100269291 3300005549 Bacteria 1407
77 Ga0068855_100299189 3300005563 Bacteria 1782
78 Ga0070664_100116164 3300005564 Bacteria 2340
79 Ga0070664_100207544 3300005564 Bacteria 1750
80 Ga0068854_100068730 3300005578 Bacteria 2584
81 Ga0068864_100040109 3300005618 Bacteria 4005
82 Ga0068864_100260035 3300005618 Bacteria 1614
83 Ga0068863_100270558 3300005841 Bacteria 1645
84 Ga0068858_100025090 3300005842 Bacteria 5547
85 Ga0068858_100043955 3300005842 Bacteria 4142
86 Ga0068860_100023016 3300005843 Bacteria 6025
87 Ga0081539_10021496 3300005985 Bacteria 4308
88 Ga0081539_10043966 3300005985 Bacteria 2583
89 Ga0081539_10087125 3300005985 Bacteria 1623
90 Ga0097621_100074975 3300006237 Bacteria 2803
91 Ga0075428_100000704 3300006844 Bacteria 34559
92 Ga0075428_100006327 3300006844 Bacteria 13171
93 Ga0075433_10076051 3300006852 Bacteria 2956
94 Ga0075433_10172459 3300006852 Bacteria 1925
95 Ga0075434_100008539 3300006871 Bacteria 9527
96 Ga0075434_100022520 3300006871 Bacteria 6135
97 Ga0075434_100118560 3300006871 Bacteria 2660
98 Ga0075429_100174555 3300006880 Bacteria 1883
99 Ga0075429_100396766 3300006880 Bacteria 1208
100 Ga0075436_100134994 3300006914 Bacteria 1732
101 Ga0075435_100056435 3300007076 Bacteria 3175
102 Ga0105250_10078408 3300009092 Bacteria 1338
103 Ga0111539_10006974 3300009094 Bacteria 14500
104 Ga0111539_10267137 3300009094 Bacteria 1991
105 Ga0111539_10291951 3300009094 Bacteria 1897
106 Ga0111539_10358624 3300009094 Bacteria 1697
107 Ga0105245_10009519 3300009098 Bacteria 8472
108 Ga0105245_10095345 3300009098 Bacteria 2745
109 Ga0105245_10279548 3300009098 Unclassified 1631
110 Ga0105245_10348788 3300009098 Bacteria 1466
111 Ga0105245_10373818 3300009098 Bacteria 1418
112 Ga0105247_10202369 3300009101 Bacteria 1335
113 Ga0114129_10114381 3300009147 Bacteria 3720
114 Ga0114129_10221423 3300009147 Bacteria 2552
115 Ga0105243_10203853 3300009148 Bacteria 1736
116 Ga0105242_10297437 3300009176 Bacteria 1472
117 Ga0105248_10180659 3300009177 Bacteria 2378
118 Ga0105248_10237263 3300009177 Bacteria 2053
119 Ga0105248_10254951 3300009177 Bacteria 1975
120 Ga0105248_10269146 3300009177 Bacteria 1918
121 Ga0105237_10410489 3300009545 Bacteria 1359
122 Ga0105249_10041006 3300009553 Bacteria 4206
123 Ga0105249_10172095 3300009553 Unclassified 2101
124 Ga0105246_10057482 3300011119 Bacteria 2691
125 Ga0105246_10189874 3300011119 Unclassified 1589
126 Ga0157378_10012334 3300013297 Bacteria 7483
127 Ga0157378_10233613 3300013297 Unclassified 1753
128 Ga0157378_10511220 3300013297 Bacteria 1201
129 Ga0157375_10001409 3300013308 Bacteria 20699
130 Ga0157375_10856128 3300013308 Bacteria 1055
131 Ga0163163_10011650 3300014325 Bacteria 7988
132 Ga0163163_10023311 3300014325 Bacteria 5872
133 Ga0163163_10046899 3300014325 Bacteria 4245
134 Ga0163163_10113918 3300014325 Bacteria 2735
135 Ga0163163_10191586 3300014325 Bacteria 2093
136 Ga0163163_10191902 3300014325 Bacteria 2091
137 Ga0163163_10383019 3300014325 Unclassified 1464
138 Ga0157380_10041254 3300014326 Bacteria 3600
139 Ga0157380_10188714 3300014326 Bacteria 1818
140 Ga0157377_10002652 3300014745 Bacteria 7938
141 Ga0157379_10033582 3300014968 Bacteria 4575
142 Ga0157379_10173556 3300014968 Bacteria 1946
143 Ga0157376_10149238 3300014969 Bacteria 2106
144 Ga0157376_10197115 3300014969 Bacteria 1850
145 Ga0207653_10045877 3300025885 Bacteria 1444
146 Ga0207710_10082471 3300025900 Bacteria 1493
147 Ga0207688_10001034 3300025901 Bacteria 14250
148 Ga0207688_10085761 3300025901 Unclassified 1803
149 Ga0207643_10011829 3300025908 Bacteria 4710
150 Ga0207684_10002339 3300025910 Bacteria 19206
151 Ga0207684_10004472 3300025910 Bacteria 13157
152 Ga0207684_10262527 3300025910 Bacteria 1490
153 Ga0207671_10288929 3300025914 Bacteria 1294
154 Ga0207660_10000001 3300025917 Bacteria 1034169
155 Ga0207662_10004080 3300025918 Bacteria 7628
156 Ga0207662_10007892 3300025918 Bacteria 5797
157 Ga0207657_10047793 3300025919 Bacteria 3739
158 Ga0207649_10008122 3300025920 Bacteria 5711
159 Ga0207652_10362824 3300025921 Bacteria 1307
160 Ga0207646_10003264 3300025922 Bacteria 18480
161 Ga0207646_10021430 3300025922 Bacteria 5970
162 Ga0207646_10030414 3300025922 Bacteria 4895
163 Ga0207646_10095433 3300025922 Bacteria 2664
164 Ga0207646_10148926 3300025922 Bacteria 2110
165 Ga0207646_10351686 3300025922 Unclassified 1332
166 Ga0207681_10201852 3300025923 Bacteria 1527
167 Ga0207659_10272527 3300025926 Bacteria 1381
168 Ga0207687_10049466 3300025927 Bacteria 2923
169 Ga0207687_10093715 3300025927 Bacteria 2196
170 Ga0207690_10006394 3300025932 Bacteria 6984
171 Ga0207706_10025705 3300025933 Bacteria 5274
172 Ga0207706_10127084 3300025933 Unclassified 2242
173 Ga0207709_10013624 3300025935 Bacteria 4485
174 Ga0207709_10212524 3300025935 Bacteria 1389
175 Ga0207670_10086328 3300025936 Bacteria 2208
176 Ga0207669_10015988 3300025937 Bacteria 3800
177 Ga0207669_10037677 3300025937 Bacteria 2777
178 Ga0207704_10109002 3300025938 Bacteria 1866
179 Ga0207704_10208712 3300025938 Bacteria 1435
180 Ga0207711_10194833 3300025941 Bacteria 1848
181 Ga0207689_10042300 3300025942 Bacteria 3769
182 Ga0207712_10055304 3300025961 Bacteria 2791
183 Ga0207712_10130898 3300025961 Bacteria 1912
184 Ga0207712_10159216 3300025961 Bacteria 1753
185 Ga0207668_10058493 3300025972 Bacteria 2695
186 Ga0207640_10118473 3300025981 Bacteria 1892
187 Ga0207658_10049980 3300025986 Bacteria 3075
188 Ga0207658_10383762 3300025986 Bacteria 1231
189 Ga0207677_10151871 3300026023 Bacteria 1788
190 Ga0207703_10031850 3300026035 Bacteria 4171
191 Ga0207703_10146937 3300026035 Bacteria 2051
192 Ga0207639_10046638 3300026041 Bacteria 3271
193 Ga0207639_10305764 3300026041 Bacteria 1407
194 Ga0207708_10012841 3300026075 Bacteria 6247
195 Ga0207708_10056251 3300026075 Bacteria 3001
196 Ga0207708_10273504 3300026075 Bacteria 1367
197 Ga0207641_10097496 3300026088 Bacteria 2584
198 Ga0207648_10004302 3300026089 Bacteria 14670
199 Ga0207648_10238016 3300026089 Bacteria 1620
200 Ga0207676_10112976 3300026095 Bacteria 2277
201 Ga0207676_10134545 3300026095 Bacteria 2107
202 Ga0207676_10244946 3300026095 Bacteria 1610
203 Ga0207674_10003008 3300026116 Bacteria 20897
204 Ga0207683_10095672 3300026121 Bacteria 2648
205 Ga0207698_10064747 3300026142 Bacteria 2867
206 Ga0209995_1010779 3300027471 Bacteria 1484
207 Ga0209983_1003299 3300027665 Bacteria 3464
208 Ga0209966_1009948 3300027695 Bacteria 1706
209 Ga0209998_10001034 3300027717 Bacteria 6989
210 Ga0209998_10001297 3300027717 Bacteria 6110
211 Ga0209974_10000190 3300027876 Bacteria 19527
212 Ga0209974_10019351 3300027876 Bacteria 2257
213 Ga0207428_10050220 3300027907 Bacteria 3338
214 Ga0207428_10109953 3300027907 Bacteria 2122
215 Ga0268264_10426986 3300028381 Unclassified 1279
216 Ga0268264_10534776 3300028381 Bacteria 1147
217 Ga0307408_100019787 3300031548 Bacteria 4535
218 Ga0307405_10006682 3300031731 Bacteria 5696
219 Ga0307405_10289153 3300031731 Bacteria 1238
220 Ga0307416_100010531 3300032002 Bacteria 6113
221 Ga0307416_100056677 3300032002 Bacteria 3164
222 Ga0307416_100517855 3300032002 Bacteria 1260
223 Ga0307415_100040339 3300032126 Bacteria 3092
224 Ga0307415_100166520 3300032126 Bacteria 1714
225 Ga0373943_0144593 3300035170 Unclassified 1284
226 Ga0316574_0084539 3300035398 Bacteria 2019
227 Ga0373925_0187132 3300037068 Unclassified 1642
228 Ga0450923_009536 3300042125 Unclassified 1701
229 Ga0450910_002028 3300042147 Bacteria 2628
230 Ga0450910_003862 3300042147 Unclassified 2007
231 Ga0439434_0066068 3300042435 Bacteria 1135
232 Ga0451577_0097230 3300042876 Bacteria 2629
233 Ga0453683_0048643 3300044673 Bacteria 2660
234 Ga0453684_0196934 3300044712 Bacteria 2352
235 Ga0453684_0274936 3300044712 Bacteria 1923
236 Ga0451576_0032683 3300045051 Bacteria 5535
237 Ga0495586_0122683 3300046535 Bacteria 1452
238 Ga0495634_0175205 3300046642 Bacteria 1346
239 Ga0495600_0201291 3300046809 Bacteria 1279
240 Ga0496100_0134397 3300048903 Bacteria 1746
241 Ga0496101_0036148 3300048904 Bacteria 3498
242 Ga0496102_0155221 3300048905 Bacteria 2152
243 Ga0496102_0164034 3300048905 Bacteria 2090
244 Ga0496102_0194704 3300048905 Bacteria 1910
245 Ga0496103_0011402 3300048906 Bacteria 5266
246 Ga0496104_0024936 3300048907 Bacteria 5508
247 Ga0496104_0056687 3300048907 Bacteria 3706
248 Ga0496105_0012812 3300048908 Bacteria 6647
249 Ga0496105_0015032 3300048908 Bacteria 6158
250 Ga0496106_0043049 3300048909 Bacteria 3387
251 Ga0496107_0023249 3300048910 Bacteria 4382
252 Ga0496108_0078826 3300048911 Bacteria 2788
253 Ga0496108_0117239 3300048911 Bacteria 2281
254 Ga0496109_0069015 3300048912 Bacteria 3240
255 Ga0496109_0408693 3300048912 Bacteria 1283
256 Ga0496110_0104255 3300048913 Bacteria 2544
257 Ga0496110_0196109 3300048913 Bacteria 1834
258 Ga0496110_0585434 3300048913 Unclassified 1013
259 Ga0496111_0017121 3300048914 Bacteria 5005
260 Ga0496111_0113315 3300048914 Bacteria 1998
261 Ga0496112_0000005 3300048915 Bacteria 525541
262 Ga0496112_0025152 3300048915 Bacteria 5714
263 Ga0496112_0208486 3300048915 Bacteria 1912
264 Ga0496112_0229910 3300048915 Bacteria 1809
265 Ga0496112_0329720 3300048915 Archaea 1470
266 Ga0496112_0390180 3300048915 Bacteria 1333
267 Ga0496113_0091883 3300048916 Bacteria 2340
268 Ga0496113_0172993 3300048916 Bacteria 1711
269 Ga0496114_0175438 3300048917 Bacteria 1870
270 Ga0496114_0192505 3300048917 Unclassified 1785
271 Ga0501031_0020099 3300049568 Bacteria 4352
272 Ga0501031_0020580 3300049568 Bacteria 4302
273 Ga0501031_0080571 3300049568 Bacteria 2122
274 Ga0501032_0021402 3300049569 Bacteria 4495
275 Ga0501033_0090251 3300049570 Bacteria 2242
276 Ga0501033_0165890 3300049570 Bacteria 1588
277 Ga0501033_0238948 3300049570 Bacteria 1289
278 Ga0501036_0052437 3300049572 Bacteria 3454
279 Ga0501036_0099989 3300049572 Bacteria 2453
280 Ga0501036_0110457 3300049572 Bacteria 2323
281 Ga0501037_0295986 3300049573 Bacteria 1125
282 Ga0501038_0028745 3300049574 Bacteria 4937
283 Ga0501038_0037051 3300049574 Bacteria 4279
284 Ga0501039_0030855 3300049575 Bacteria 4133
285 Ga0501039_0237209 3300049575 Bacteria 1434
286 Ga0501040_0013922 3300049576 Bacteria 5296
287 Ga0501040_0027841 3300049576 Bacteria 3807
288 Ga0501040_0042218 3300049576 Bacteria 3106
289 Ga0501040_0082380 3300049576 Bacteria 2230
290 Ga0501040_0085207 3300049576 Bacteria 2193
291 Ga0501040_0272744 3300049576 Unclassified 1208
292 Ga0501041_0008749 3300049577 Bacteria 5958
293 Ga0501041_0026669 3300049577 Bacteria 3476
294 Ga0501041_0034337 3300049577 Bacteria 3070
295 Ga0501041_0037651 3300049577 Bacteria 2932
296 Ga0501041_0039035 3300049577 Bacteria 2880
297 Ga0501042_0023561 3300049578 Bacteria 4309
298 Ga0501042_0045086 3300049578 Bacteria 3142
299 Ga0501042_0063835 3300049578 Bacteria 2632
300 Ga0501042_0094070 3300049578 Bacteria 2152
301 Ga0501043_0248594 3300049579 Bacteria 1370
302 Ga0501046_0142896 3300049580 Bacteria 1810
303 Ga0501046_0217424 3300049580 Bacteria 1416
304 Ga0501048_0003450 3300049582 Bacteria 12018
305 Ga0501048_0066687 3300049582 Bacteria 2544
306 Ga0501048_0067418 3300049582 Bacteria 2529
307 Ga0501048_0115940 3300049582 Bacteria 1892
308 Ga0501048_0169514 3300049582 Bacteria 1546
309 Ga0501067_0002347 3300049583 Bacteria 10470
310 Ga0501067_0057002 3300049583 Bacteria 2164
311 Ga0501067_0058714 3300049583 Bacteria 2130
312 Ga0501067_0064663 3300049583 Bacteria 2025
313 Ga0501067_0090693 3300049583 Bacteria 1697
314 Ga0501069_0039220 3300049585 Bacteria 2616
315 Ga0501069_0053426 3300049585 Bacteria 2250
316 Ga0501069_0087871 3300049585 Bacteria 1756
317 Ga0501070_0072225 3300049586 Bacteria 2857
318 Ga0501070_0224771 3300049586 Bacteria 1539
319 Ga0501071_0001070 3300049587 Bacteria 15179
320 Ga0501071_0010923 3300049587 Bacteria 6095
321 Ga0501071_0030608 3300049587 Bacteria 3808
322 Ga0501071_0079931 3300049587 Bacteria 2390
323 Ga0501071_0098856 3300049587 Bacteria 2150
324 Ga0501071_0133755 3300049587 Bacteria 1844
325 Ga0501071_0210517 3300049587 Bacteria 1462
326 Ga0501072_0004000 3300049588 Bacteria 11158
327 Ga0501072_0007355 3300049588 Bacteria 8353
328 Ga0501072_0012986 3300049588 Bacteria 6374
329 Ga0501072_0047184 3300049588 Bacteria 3392
330 Ga0501072_0236373 3300049588 Bacteria 1455
331 Ga0501072_0288393 3300049588 Unclassified 1305
332 Ga0501073_0046796 3300049589 Bacteria 3041
333 Ga0501073_0101314 3300049589 Bacteria 2000
334 Ga0501073_0101398 3300049589 Bacteria 1999
335 Ga0501073_0404297 3300049589 Bacteria 943
336 Ga0501074_0063878 3300049590 Bacteria 2651
337 Ga0501074_0209467 3300049590 Bacteria 1389
338 Ga0501075_0027144 3300049591 Bacteria 4218
339 Ga0501075_0037418 3300049591 Bacteria 3625
340 Ga0501075_0040319 3300049591 Bacteria 3497
341 Ga0501075_0043006 3300049591 Bacteria 3388
342 Ga0501075_0114467 3300049591 Bacteria 2051
343 Ga0501075_0139645 3300049591 Bacteria 1846
344 Ga0501076_0002695 3300049592 Bacteria 12273
345 Ga0501076_0006542 3300049592 Bacteria 8454
346 Ga0501076_0007530 3300049592 Bacteria 7922
347 Ga0501076_0030541 3300049592 Bacteria 4197
348 Ga0501076_0041463 3300049592 Bacteria 3622
349 Ga0501076_0047719 3300049592 Bacteria 3386
350 Ga0501076_0057630 3300049592 Bacteria 3085
351 Ga0501076_0113228 3300049592 Bacteria 2194
352 Ga0501077_0032452 3300049593 Bacteria 3324
353 Ga0501077_0036142 3300049593 Bacteria 3146
354 Ga0501077_0049113 3300049593 Bacteria 2681
355 Ga0501077_0061132 3300049593 Bacteria 2391
356 Ga0501077_0079140 3300049593 Bacteria 2082
357 Ga0501077_0100266 3300049593 Bacteria 1835
358 Ga0501079_0018543 3300049741 Bacteria 5316
359 Ga0501079_0026944 3300049741 Unclassified 4408
360 Ga0501079_0043264 3300049741 Bacteria 3476
361 Ga0501079_0046630 3300049741 Bacteria 3344
362 Ga0501079_0061902 3300049741 Bacteria 2886
363 Ga0501079_0106240 3300049741 Bacteria 2178
364 Ga0501079_0161983 3300049741 Bacteria 1744
365 Ga0501080_0058601 3300049742 Bacteria 3584
366 Ga0501080_0143806 3300049742 Unclassified 2205
367 Ga0501080_0409348 3300049742 Unclassified 1219
368 Ga0501081_0006275 3300049743 Bacteria 7708
369 Ga0501081_0022944 3300049743 Bacteria 4179
370 Ga0501081_0028049 3300049743 Bacteria 3797
371 Ga0501081_0075569 3300049743 Bacteria 2352
372 Ga0501081_0109050 3300049743 Bacteria 1964
373 Ga0501081_0143535 3300049743 Bacteria 1712
374 Ga0501035_0339979 3300049822 Bacteria 1258
375 Ga0501035_0395443 3300049822 Bacteria 1150
376 Ga0501044_0286793 3300049823 Bacteria 1579
377 Ga0501045_0011995 3300049824 Bacteria 6093
378 Ga0501045_0068359 3300049824 Bacteria 2610
379 Ga0501045_0098124 3300049824 Bacteria 2167
380 Ga0501045_0149294 3300049824 Bacteria 1739
381 Ga0501045_0353112 3300049824 Bacteria 1094
382 nmdc:mga05p37_2790_c1 3300050507 Bacteria 20308
383 nmdc:mga05p37_72205_c2 3300050507 Bacteria 3188
384 nmdc:mga09592_174013_c1 3300050508 Bacteria 1862
385 nmdc:mga09592_66916_c1 3300050508 Bacteria 3046
386 nmdc:mga08y16_21953_c1 3300050511 Bacteria 6738
387 nmdc:mga08y16_276583_c1 3300050511 Bacteria 1732
388 nmdc:mga08y16_330827_c1 3300050511 Bacteria 1567
389 nmdc:mga08y16_352952_c1 3300050511 Bacteria 1510
390 nmdc:mga0n895_248383_c1 3300050512 Bacteria 1806
391 nmdc:mga0n895_426542_c1 3300050512 Bacteria 1340
392 nmdc:mga0rr50_420381_c1 3300050513 Bacteria 1131
393 nmdc:mga0a205_255490_c1 3300050515 Bacteria 1631
394 nmdc:mga0a205_41302_c1 3300050515 Bacteria 4441
395 Ga0500616_0000608 3300053153 Bacteria 43359
396 Ga0501084_0008761 3300054114 Bacteria 8367
397 Ga0501084_0015372 3300054114 Bacteria 6345
398 Ga0501084_0037401 3300054114 Bacteria 4055
399 Ga0501084_0045205 3300054114 Bacteria 3687
400 Ga0501084_0047124 3300054114 Bacteria 3610
401 Ga0501084_0071287 3300054114 Bacteria 2909
402 Ga0501084_0076719 3300054114 Bacteria 2801
403 Ga0590071_001901 3300059421 Bacteria 5352
404 Ga0590075_001855 3300059424 Bacteria 5136
405 Ga0590077_001257 3300059426 Bacteria 6072
406 Ga0501082_0011987 3300060353 Bacteria 7454
407 Ga0501082_0033581 3300060353 Bacteria 4427
408 Ga0501082_0042726 3300060353 Bacteria 3907
409 Ga0501082_0042825 3300060353 Bacteria 3903
410 Ga0530510_0000065 3300061734 Bacteria 52458
411 Ga0530510_0030563 3300061734 Bacteria 3869
412 Ga0530510_0073197 3300061734 Bacteria 2487
413 Ga0207709_10154676
414 Ga0070683_100388399
415 Ga0070690_100011561
416 Ga0070670_100015783
417 Ga0070677_10092039
418 Ga0068869_100195725
419 Ga0070680_100000001
420 Ga0070682_100143400
421 Ga0070682_100176004
422 Ga0070689_100043155
423 Ga0070687_100016077
424 Ga0070687_100020942
425 Ga0070661_100065372
426 Ga0070668_100079082
427 Ga0070669_100039621
428 Ga0070675_100045727
429 Ga0070674_100014674
430 Ga0070674_100041054
431 Ga0070688_100012574
432 Ga0070659_100139015
433 Ga0070667_100230868
434 Ga0070667_100480081
435 Ga0070703_10053591
436 Ga0070701_10011010
437 Ga0070705_100004902
438 Ga0070705_100033982
439 Ga0070705_100086189
440 Ga0070700_100040560
441 Ga0070694_100051038
442 Ga0070694_100285971
443 Ga0070694_100311159
444 Ga0070694_100401140
445 Ga0070708_100002051
446 Ga0070708_100098276
447 Ga0070663_100273041
448 Ga0070678_100284395
449 Ga0070662_100012593
450 Ga0070681_10073671
451 Ga0070681_10075439
452 Ga0068867_100038658
453 Ga0070706_100000469
454 Ga0070706_100011189
455 Ga0070706_100028463
456 Ga0070707_100000163
457 Ga0070707_100054863
458 Ga0070707_100079430
459 Ga0070707_100099275
460 Ga0070707_100557164
461 Ga0070698_100031527
462 Ga0070698_100037670
463 Ga0070698_100055503
464 Ga0070698_100075145
465 Ga0070698_100125735
466 Ga0070698_100152529
467 Ga0070699_100000999
468 Ga0070699_100014334
469 Ga0070699_100021185
470 Ga0070699_100131948
471 Ga0070699_100175230
472 Ga0070699_100247912
473 Ga0070679_100213619
474 Ga0070684_100049547
475 Ga0070684_100063070
476 Ga0070697_100019155
477 Ga0070697_100034922
478 Ga0068853_100066079
479 Ga0070686_100034581
480 Ga0070695_100091407
481 Ga0070695_100157848
482 Ga0070696_100008766
483 Ga0070696_100008899
484 Ga0070696_100223162
485 Ga0070696_100269414
486 Ga0070693_100067489
487 Ga0070704_100169067
488 Ga0070704_100269291
489 Ga0068855_100299189
490 Ga0070664_100116164
491 Ga0070664_100207544
492 Ga0068854_100068730
493 Ga0068864_100040109
494 Ga0068864_100260035
495 Ga0068863_100270558
496 Ga0068858_100025090
497 Ga0068858_100043955
498 Ga0068860_100023016
499 Ga0081539_10021496
500 Ga0081539_10043966
501 Ga0081539_10087125
502 Ga0097621_100074975
503 Ga0075428_100000704
504 Ga0075428_100006327
505 Ga0075433_10076051
506 Ga0075433_10172459
507 Ga0075434_100008539
508 Ga0075434_100022520
509 Ga0075434_100118560
510 Ga0075429_100174555
511 Ga0075429_100396766
512 Ga0075436_100134994
513 Ga0075435_100056435
514 Ga0105250_10078408
515 Ga0111539_10006974
516 Ga0111539_10267137
517 Ga0111539_10291951
518 Ga0111539_10358624
519 Ga0105245_10009519
520 Ga0105245_10095345
521 Ga0105245_10279548
522 Ga0105245_10348788
523 Ga0105245_10373818
524 Ga0105247_10202369
525 Ga0114129_10114381
526 Ga0114129_10221423
527 Ga0105243_10203853
528 Ga0105242_10297437
529 Ga0105248_10180659
530 Ga0105248_10237263
531 Ga0105248_10254951
532 Ga0105248_10269146
533 Ga0105237_10410489
534 Ga0105249_10041006
535 Ga0105249_10172095
536 Ga0105246_10057482
537 Ga0105246_10189874
538 Ga0157378_10012334
539 Ga0157378_10233613
540 Ga0157378_10511220
541 Ga0157375_10001409
542 Ga0157375_10856128
543 Ga0163163_10011650
544 Ga0163163_10023311
545 Ga0163163_10046899
546 Ga0163163_10113918
547 Ga0163163_10191586
548 Ga0163163_10191902
549 Ga0163163_10383019
550 Ga0157380_10041254
551 Ga0157380_10188714
552 Ga0157377_10002652
553 Ga0157379_10033582
554 Ga0157379_10173556
555 Ga0157376_10149238
556 Ga0157376_10197115
557 Ga0207653_10045877
558 Ga0207710_10082471
559 Ga0207688_10001034
560 Ga0207688_10085761
561 Ga0207643_10011829
562 Ga0207684_10002339
563 Ga0207684_10004472
564 Ga0207684_10262527
565 Ga0207671_10288929
566 Ga0207660_10000001
567 Ga0207662_10004080
568 Ga0207662_10007892
569 Ga0207657_10047793
570 Ga0207649_10008122
571 Ga0207652_10362824
572 Ga0207646_10003264
573 Ga0207646_10021430
574 Ga0207646_10030414
575 Ga0207646_10095433
576 Ga0207646_10148926
577 Ga0207646_10351686
578 Ga0207681_10201852
579 Ga0207659_10272527
580 Ga0207687_10049466
581 Ga0207687_10093715
582 Ga0207690_10006394
583 Ga0207706_10025705
584 Ga0207706_10127084
585 Ga0207709_10013624
586 Ga0207709_10212524
587 Ga0207670_10086328
588 Ga0207669_10015988
589 Ga0207669_10037677
590 Ga0207704_10109002
591 Ga0207704_10208712
592 Ga0207711_10194833
593 Ga0207689_10042300
594 Ga0207712_10055304
595 Ga0207712_10130898
596 Ga0207712_10159216
597 Ga0207668_10058493
598 Ga0207640_10118473
599 Ga0207658_10049980
600 Ga0207658_10383762
601 Ga0207677_10151871
602 Ga0207703_10031850
603 Ga0207703_10146937
604 Ga0207639_10046638
605 Ga0207639_10305764
606 Ga0207708_10012841
607 Ga0207708_10056251
608 Ga0207708_10273504
609 Ga0207641_10097496
610 Ga0207648_10004302
611 Ga0207648_10238016
612 Ga0207676_10112976
613 Ga0207676_10134545
614 Ga0207676_10244946
615 Ga0207674_10003008
616 Ga0207683_10095672
617 Ga0207698_10064747
618 Ga0209995_1010779
619 Ga0209983_1003299
620 Ga0209966_1009948
621 Ga0209998_10001034
622 Ga0209998_10001297
623 Ga0209974_10000190
624 Ga0209974_10019351
625 Ga0207428_10050220
626 Ga0207428_10109953
627 Ga0268264_10426986
628 Ga0268264_10534776
629 Ga0307408_100019787
630 Ga0307405_10006682
631 Ga0307405_10289153
632 Ga0307416_100010531
633 Ga0307416_100056677
634 Ga0307416_100517855
635 Ga0307415_100040339
636 Ga0307415_100166520
637 Ga0373943_0144593
638 Ga0316574_0084539
639 Ga0373925_0187132
640 Ga0450923_009536
641 Ga0450910_002028
642 Ga0450910_003862
643 Ga0439434_0066068
644 Ga0451577_0097230
645 Ga0453683_0048643
646 Ga0453684_0196934
647 Ga0453684_0274936
648 Ga0451576_0032683
649 Ga0495586_0122683
650 Ga0495634_0175205
651 Ga0495600_0201291
652 Ga0496100_0134397
653 Ga0496101_0036148
654 Ga0496102_0155221
655 Ga0496102_0164034
656 Ga0496102_0194704
657 Ga0496103_0011402
658 Ga0496104_0024936
659 Ga0496104_0056687
660 Ga0496105_0012812
661 Ga0496105_0015032
662 Ga0496106_0043049
663 Ga0496107_0023249
664 Ga0496108_0078826
665 Ga0496108_0117239
666 Ga0496109_0069015
667 Ga0496109_0408693
668 Ga0496110_0104255
669 Ga0496110_0196109
670 Ga0496110_0585434
671 Ga0496111_0017121
672 Ga0496111_0113315
673 Ga0496112_0000005
674 Ga0496112_0025152
675 Ga0496112_0208486
676 Ga0496112_0229910
677 Ga0496112_0329720
678 Ga0496112_0390180
679 Ga0496113_0091883
680 Ga0496113_0172993
681 Ga0496114_0175438
682 Ga0496114_0192505
683 Ga0501031_0020099
684 Ga0501031_0020580
685 Ga0501031_0080571
686 Ga0501032_0021402
687 Ga0501033_0090251
688 Ga0501033_0165890
689 Ga0501033_0238948
690 Ga0501036_0052437
691 Ga0501036_0099989
692 Ga0501036_0110457
693 Ga0501037_0295986
694 Ga0501038_0028745
695 Ga0501038_0037051
696 Ga0501039_0030855
697 Ga0501039_0237209
698 Ga0501040_0013922
699 Ga0501040_0027841
700 Ga0501040_0042218
701 Ga0501040_0082380
702 Ga0501040_0085207
703 Ga0501040_0272744
704 Ga0501041_0008749
705 Ga0501041_0026669
706 Ga0501041_0034337
707 Ga0501041_0037651
708 Ga0501041_0039035
709 Ga0501042_0023561
710 Ga0501042_0045086
711 Ga0501042_0063835
712 Ga0501042_0094070
713 Ga0501043_0248594
714 Ga0501046_0142896
715 Ga0501046_0217424
716 Ga0501048_0003450
717 Ga0501048_0066687
718 Ga0501048_0067418
719 Ga0501048_0115940
720 Ga0501048_0169514
721 Ga0501067_0002347
722 Ga0501067_0057002
723 Ga0501067_0058714
724 Ga0501067_0064663
725 Ga0501067_0090693
726 Ga0501069_0039220
727 Ga0501069_0053426
728 Ga0501069_0087871
729 Ga0501070_0072225
730 Ga0501070_0224771
731 Ga0501071_0001070
732 Ga0501071_0010923
733 Ga0501071_0030608
734 Ga0501071_0079931
735 Ga0501071_0098856
736 Ga0501071_0133755
737 Ga0501071_0210517
738 Ga0501072_0004000
739 Ga0501072_0007355
740 Ga0501072_0012986
741 Ga0501072_0047184
742 Ga0501072_0236373
743 Ga0501072_0288393
744 Ga0501073_0046796
745 Ga0501073_0101314
746 Ga0501073_0101398
747 Ga0501073_0404297
748 Ga0501074_0063878
749 Ga0501074_0209467
750 Ga0501075_0027144
751 Ga0501075_0037418
752 Ga0501075_0040319
753 Ga0501075_0043006
754 Ga0501075_0114467
755 Ga0501075_0139645
756 Ga0501076_0002695
757 Ga0501076_0006542
758 Ga0501076_0007530
759 Ga0501076_0030541
760 Ga0501076_0041463
761 Ga0501076_0047719
762 Ga0501076_0057630
763 Ga0501076_0113228
764 Ga0501077_0032452
765 Ga0501077_0036142
766 Ga0501077_0049113
767 Ga0501077_0061132
768 Ga0501077_0079140
769 Ga0501077_0100266
770 Ga0501079_0018543
771 Ga0501079_0026944
772 Ga0501079_0043264
773 Ga0501079_0046630
774 Ga0501079_0061902
775 Ga0501079_0106240
776 Ga0501079_0161983
777 Ga0501080_0058601
778 Ga0501080_0143806
779 Ga0501080_0409348
780 Ga0501081_0006275
781 Ga0501081_0022944
782 Ga0501081_0028049
783 Ga0501081_0075569
784 Ga0501081_0109050
785 Ga0501081_0143535
786 Ga0501035_0339979
787 Ga0501035_0395443
788 Ga0501044_0286793
789 Ga0501045_0011995
790 Ga0501045_0068359
791 Ga0501045_0098124
792 Ga0501045_0149294
793 Ga0501045_0353112
794 nmdc:mga05p37_2790_c1
795 nmdc:mga05p37_72205_c2
796 nmdc:mga09592_174013_c1
797 nmdc:mga09592_66916_c1
798 nmdc:mga08y16_21953_c1
799 nmdc:mga08y16_276583_c1
800 nmdc:mga08y16_330827_c1
801 nmdc:mga08y16_352952_c1
802 nmdc:mga0n895_248383_c1
803 nmdc:mga0n895_426542_c1
804 nmdc:mga0rr50_420381_c1
805 nmdc:mga0a205_255490_c1
806 nmdc:mga0a205_41302_c1
807 Ga0500616_0000608
808 Ga0501084_0008761
809 Ga0501084_0015372
810 Ga0501084_0037401
811 Ga0501084_0045205
812 Ga0501084_0047124
813 Ga0501084_0071287
814 Ga0501084_0076719
815 Ga0590071_001901
816 Ga0590075_001855
817 Ga0590077_001257
818 Ga0501082_0011987
819 Ga0501082_0033581
820 Ga0501082_0042726
821 Ga0501082_0042825
822 Ga0530510_0000065
823 Ga0530510_0030563
824 Ga0530510_0073197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01882

DUF58

Protein of unknown function DUF58

85

168

0.91

PF13519

VWA_2

von Willebrand factor type A domain

127

232

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fz4-assembly2.cif.gz_B the von willebrand factor a domain of anthrax toxin receptor 2 0.78 109 238
1sht-assembly1.cif.gz_X crystal structure of the von willebrand factor a domain of human capillary morphogenesis protein 2: an anthrax toxin receptor 0.7673 109 238
6pyx-assembly2.cif.gz_B calcium activated chloride channel regulator 1 (clca1) vwa domain 0.7424 106 236
8bhv-assembly1.cif.gz_j dna-pk xlf mediated dimer bound to paxx 0.7218 109 239
8ft8-assembly1.cif.gz_A the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, thr-val linker variant, sumo tag-free preparation 0.7189 94 238
ID Description Score Start End Superfamily
af_P9WLX5_142_317_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7954 154 317 3.40.50.410
af_P9WLX5_142_317_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7443 154 317 3.40.50.410
af_G5EGU7_798_980_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7296 109 237 3.40.50.410
af_Q18048_158_337_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7277 109 235 3.40.50.410
af_A0A0P0XV48_261_417_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7245 110 216 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A1F8S0W3-F1-model_v4 VWFA domain-containing protein 0.9413 102 320
AF-A0A1F8S0W3-F1-model_v4 VWFA domain-containing protein 0.933 102 320
AF-A0A348PBW9-F1-model_v4 DUF58 domain-containing protein 0.8998 106 320
AF-A0A537JKH1-F1-model_v4 DUF58 domain-containing protein 0.877 193 320
AF-A0A348PBW9-F1-model_v4 DUF58 domain-containing protein 0.8765 106 320

Map