F437822

General Info

Members Datasets Scaffolds Average Seq Length
412 212 411 218

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10108834|Ga0207646_101088342
Length 237
Sequence MKRPAPESPAAAGSWSAAGRYRICPSILSADFERLAEEIARVEAAGADFIHVDVMDGRFVPNLTIGPPVIESIKKRTRLPLDVHLMIEEPERSIDTYIRAGADLVTVHLEACLHLQRTLTQIREAGARSGVALNPSTLPGLVEYVLDDLDLILVMSVNPGFGGQSFIPTTYAKLRHLRGLVGGRGIQLSVDGGVGPGNAAALAQAGAGVLVAGSAIFGAPDPGEAVRTLRSASEVAK

Samples

Sample ID Description Type Environment
1 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
141 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
158 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.24
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.46
Rhizosphere 97.82
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26145J50221_1006010 3300003371 Bacteria 1010
2 Ga0065715_10150506 3300005293 Bacteria 1735
3 Ga0070676_10000078 3300005328 Bacteria 33251
4 Ga0070683_100128400 3300005329 Bacteria 2398
5 Ga0070690_100342120 3300005330 Bacteria 1083
6 Ga0070670_100012956 3300005331 Bacteria 7139
7 Ga0068869_100000679 3300005334 Bacteria 19236
8 Ga0068869_100175008 3300005334 Bacteria 1679
9 Ga0070680_100002566 3300005336 Bacteria 13435
10 Ga0070682_100001048 3300005337 Bacteria 15991
11 Ga0068868_100005961 3300005338 Bacteria 8596
12 Ga0070660_100000369 3300005339 Bacteria 30058
13 Ga0070689_100010613 3300005340 Bacteria 6567
14 Ga0070689_100043221 3300005340 Bacteria 3462
15 Ga0070691_10007828 3300005341 Bacteria 4888
16 Ga0070691_10029569 3300005341 Bacteria 2564
17 Ga0070661_100000449 3300005344 Bacteria 31415
18 Ga0070692_10016516 3300005345 Bacteria 3511
19 Ga0070669_100038888 3300005353 Bacteria 3455
20 Ga0070671_100385615 3300005355 Bacteria 1198
21 Ga0070673_100003517 3300005364 Bacteria 9763
22 Ga0070688_100061399 3300005365 Bacteria 2376
23 Ga0070659_100000719 3300005366 Bacteria 24012
24 Ga0070703_10004737 3300005406 Bacteria 3804
25 Ga0070701_10043214 3300005438 Bacteria 2304
26 Ga0070701_10107564 3300005438 Bacteria 1554
27 Ga0070711_100105776 3300005439 Bacteria 2056
28 Ga0070711_100240284 3300005439 Bacteria 1416
29 Ga0070705_100000292 3300005440 Bacteria 29837
30 Ga0070705_100086584 3300005440 Bacteria 1940
31 Ga0070705_100160384 3300005440 Bacteria 1503
32 Ga0070694_100001227 3300005444 Bacteria 14816
33 Ga0070694_100012985 3300005444 Bacteria 5195
34 Ga0070694_100026394 3300005444 Bacteria 3763
35 Ga0070708_100007672 3300005445 Bacteria 8645
36 Ga0070708_100033261 3300005445 Bacteria 4480
37 Ga0070708_100052720 3300005445 Bacteria 3608
38 Ga0070708_100164233 3300005445 Bacteria 2070
39 Ga0070708_100540968 3300005445 Bacteria 1099
40 Ga0070663_100001312 3300005455 Bacteria 13609
41 Ga0070663_100067646 3300005455 Bacteria 2592
42 Ga0070663_100227198 3300005455 Bacteria 1468
43 Ga0070678_100312610 3300005456 Bacteria 1339
44 Ga0070662_100001136 3300005457 Bacteria 16279
45 Ga0070681_10004905 3300005458 Bacteria 12843
46 Ga0068867_100002791 3300005459 Bacteria 12281
47 Ga0070706_100006201 3300005467 Bacteria 11310
48 Ga0070706_100006328 3300005467 Bacteria 11189
49 Ga0070706_100063624 3300005467 Bacteria 3409
50 Ga0070706_100148358 3300005467 Bacteria 2189
51 Ga0070706_100523211 3300005467 Bacteria 1103
52 Ga0070706_101046548 3300005467 Bacteria 752
53 Ga0070707_100031588 3300005468 Bacteria 5045
54 Ga0070707_100043363 3300005468 Bacteria 4306
55 Ga0070707_100070941 3300005468 Bacteria 3356
56 Ga0070707_100189508 3300005468 Bacteria 2005
57 Ga0070707_100196795 3300005468 Bacteria 1965
58 Ga0070707_100230080 3300005468 Bacteria 1805
59 Ga0070707_100462460 3300005468 Bacteria 1230
60 Ga0070698_100002478 3300005471 Bacteria 20348
61 Ga0070698_100002788 3300005471 Bacteria 19240
62 Ga0070698_100012924 3300005471 Bacteria 8839
63 Ga0070698_100635497 3300005471 Bacteria 1008
64 Ga0070699_100003472 3300005518 Bacteria 13934
65 Ga0070699_100008333 3300005518 Bacteria 8985
66 Ga0070699_100014989 3300005518 Bacteria 6662
67 Ga0070699_100055458 3300005518 Bacteria 3431
68 Ga0070699_100152780 3300005518 Bacteria 2042
69 Ga0070699_100306936 3300005518 Bacteria 1424
70 Ga0070699_101020457 3300005518 Bacteria 759
71 Ga0070679_100001205 3300005530 Bacteria 22763
72 Ga0070684_100004922 3300005535 Bacteria 10196
73 Ga0070684_100141663 3300005535 Bacteria 2174
74 Ga0070697_100000909 3300005536 Bacteria 22265
75 Ga0070697_100003084 3300005536 Bacteria 12786
76 Ga0070697_100005486 3300005536 Bacteria 9779
77 Ga0070697_100017353 3300005536 Bacteria 5662
78 Ga0070697_100021043 3300005536 Bacteria 5165
79 Ga0070697_100027373 3300005536 Bacteria 4560
80 Ga0070697_100044101 3300005536 Bacteria 3612
81 Ga0070697_100132415 3300005536 Bacteria 2092
82 Ga0070697_100163120 3300005536 Bacteria 1883
83 Ga0070697_100328839 3300005536 Bacteria 1317
84 Ga0068853_100015685 3300005539 Bacteria 6223
85 Ga0068853_100478935 3300005539 Bacteria 1173
86 Ga0070672_100014478 3300005543 Bacteria 5592
87 Ga0070686_100074377 3300005544 Unclassified 2233
88 Ga0070686_100402792 3300005544 Bacteria 1041
89 Ga0070695_100001737 3300005545 Bacteria 12264
90 Ga0070695_100002286 3300005545 Bacteria 10975
91 Ga0070695_100004003 3300005545 Bacteria 8614
92 Ga0070696_100000277 3300005546 Bacteria 30739
93 Ga0070696_100182836 3300005546 Bacteria 1556
94 Ga0070693_100000692 3300005547 Bacteria 14930
95 Ga0070704_100000361 3300005549 Bacteria 20630
96 Ga0070704_100030293 3300005549 Bacteria 3624
97 Ga0068855_100000056 3300005563 Bacteria 135739
98 Ga0068855_100000559 3300005563 Bacteria 45612
99 Ga0068855_100003320 3300005563 Bacteria 19679
100 Ga0070664_100002942 3300005564 Bacteria 13771
101 Ga0068857_100005102 3300005577 Bacteria 11164
102 Ga0068854_100000006 3300005578 Bacteria 186299
103 Ga0068854_100000497 3300005578 Bacteria 23919
104 Ga0068856_100000940 3300005614 Bacteria 31221
105 Ga0068856_100001064 3300005614 Bacteria 29056
106 Ga0070702_100068376 3300005615 Bacteria 2090
107 Ga0068859_100003247 3300005617 Bacteria 16553
108 Ga0068859_100055430 3300005617 Bacteria 3989
109 Ga0068861_100006592 3300005719 Bacteria 7925
110 Ga0068870_10000438 3300005840 Bacteria 15777
111 Ga0068863_100010303 3300005841 Bacteria 9082
112 Ga0068860_100116761 3300005843 Bacteria 2553
113 Ga0068860_100183770 3300005843 Bacteria 2021
114 Ga0068862_100003503 3300005844 Bacteria 13478
115 Ga0068862_100024892 3300005844 Bacteria 5023
116 Ga0068862_100410757 3300005844 Bacteria 1268
117 Ga0081455_10000788 3300005937 Bacteria 40708
118 Ga0070715_10148494 3300006163 Bacteria 1146
119 Ga0070712_100011684 3300006175 Bacteria 5576
120 Ga0075431_100000240 3300006847 Bacteria 41263
121 Ga0075431_100060818 3300006847 Bacteria 3898
122 Ga0075433_10007607 3300006852 Bacteria 8599
123 Ga0075433_10049034 3300006852 Bacteria 3673
124 Ga0075433_10138375 3300006852 Bacteria 2164
125 Ga0075433_10183550 3300006852 Bacteria 1861
126 Ga0075433_10261977 3300006852 Bacteria 1532
127 Ga0075433_10534105 3300006852 Bacteria 1031
128 Ga0075434_100009493 3300006871 Bacteria 9075
129 Ga0075434_100022726 3300006871 Bacteria 6107
130 Ga0075434_100488044 3300006871 Bacteria 1253
131 Ga0075429_100006459 3300006880 Bacteria 10152
132 Ga0075436_100027835 3300006914 Bacteria 3891
133 Ga0075436_100477965 3300006914 Bacteria 910
134 Ga0097620_100003247 3300006931 Bacteria 16553
135 Ga0097620_100055429 3300006931 Bacteria 3989
136 Ga0075435_100024930 3300007076 Bacteria 4650
137 Ga0075435_100038983 3300007076 Bacteria 3791
138 Ga0075435_100055644 3300007076 Bacteria 3196
139 Ga0075435_100146005 3300007076 Bacteria 1987
140 Ga0099794_10069892 3300007265 Bacteria 1718
141 Ga0105240_10178224 3300009093 Bacteria 2511
142 Ga0105240_10343532 3300009093 Bacteria 1695
143 Ga0105240_10919712 3300009093 Bacteria 940
144 Ga0111539_10005457 3300009094 Bacteria 16453
145 Ga0111539_10036525 3300009094 Bacteria 5938
146 Ga0111539_10051844 3300009094 Bacteria 4885
147 Ga0114129_10046598 3300009147 Bacteria 6091
148 Ga0114129_10155046 3300009147 Bacteria 3133
149 Ga0114129_10236513 3300009147 Bacteria 2457
150 Ga0114129_10308594 3300009147 Bacteria 2107
151 Ga0114129_10603239 3300009147 Bacteria 1422
152 Ga0105241_10000966 3300009174 Bacteria 21742
153 Ga0105249_10087557 3300009553 Bacteria 2906
154 Ga0105249_10168743 3300009553 Bacteria 2121
155 Ga0157373_10000304 3300013100 Bacteria 39700
156 Ga0157369_10021229 3300013105 Bacteria 7261
157 Ga0157369_10127855 3300013105 Bacteria 2693
158 Ga0157369_10714072 3300013105 Bacteria 1032
159 Ga0157374_10074857 3300013296 Bacteria 3199
160 Ga0157378_10324378 3300013297 Bacteria 1497
161 Ga0157372_10005525 3300013307 Bacteria 13442
162 Ga0157372_11307228 3300013307 Bacteria 837
163 Ga0157375_10123938 3300013308 Bacteria 2697
164 Ga0163163_10020657 3300014325 Bacteria 6206
165 Ga0157376_10385443 3300014969 Bacteria 1351
166 Ga0206356_11215523 3300020070 Bacteria 1085
167 Ga0213873_10036703 3300021358 Bacteria 1245
168 Ga0213872_10002242 3300021361 Bacteria 11556
169 Ga0213876_10320402 3300021384 Bacteria 824
170 Ga0207653_10021480 3300025885 Bacteria 2047
171 Ga0207688_10042675 3300025901 Bacteria 2525
172 Ga0207645_10000076 3300025907 Bacteria 70294
173 Ga0207643_10000227 3300025908 Bacteria 39423
174 Ga0207684_10000874 3300025910 Bacteria 34386
175 Ga0207684_10006007 3300025910 Bacteria 11113
176 Ga0207684_10068740 3300025910 Bacteria 3010
177 Ga0207684_10124598 3300025910 Bacteria 2210
178 Ga0207684_10195639 3300025910 Bacteria 1744
179 Ga0207684_10212337 3300025910 Bacteria 1669
180 Ga0207684_10423786 3300025910 Bacteria 1143
181 Ga0207684_10868546 3300025910 Bacteria 760
182 Ga0207654_10005189 3300025911 Bacteria 6573
183 Ga0207707_10000357 3300025912 Bacteria 48036
184 Ga0207695_10130777 3300025913 Bacteria 2468
185 Ga0207693_10029318 3300025915 Bacteria 4348
186 Ga0207663_10168335 3300025916 Bacteria 1554
187 Ga0207660_10003495 3300025917 Bacteria 10237
188 Ga0207660_10066420 3300025917 Bacteria 2609
189 Ga0207662_10015349 3300025918 Bacteria 4310
190 Ga0207657_10000417 3300025919 Bacteria 45146
191 Ga0207649_10001653 3300025920 Bacteria 12915
192 Ga0207652_10004761 3300025921 Bacteria 11001
193 Ga0207646_10001150 3300025922 Bacteria 33745
194 Ga0207646_10029995 3300025922 Bacteria 4937
195 Ga0207646_10035755 3300025922 Bacteria 4485
196 Ga0207646_10037655 3300025922 Bacteria 4360
197 Ga0207646_10041613 3300025922 Bacteria 4130
198 Ga0207646_10067107 3300025922 Bacteria 3202
199 Ga0207646_10085384 3300025922 Bacteria 2824
200 Ga0207646_10108834 3300025922 Bacteria 2487
201 Ga0207646_10121187 3300025922 Bacteria 2350
202 Ga0207646_10123223 3300025922 Bacteria 2330
203 Ga0207646_10408871 3300025922 Bacteria 1225
204 Ga0207681_10068986 3300025923 Bacteria 2458
205 Ga0207681_10097679 3300025923 Bacteria 2111
206 Ga0207650_10165203 3300025925 Bacteria 1756
207 Ga0207690_10001242 3300025932 Bacteria 16111
208 Ga0207706_10026077 3300025933 Bacteria 5232
209 Ga0207670_10010132 3300025936 Bacteria 5412
210 Ga0207670_10123455 3300025936 Bacteria 1886
211 Ga0207691_10012395 3300025940 Bacteria 8172
212 Ga0207689_10000281 3300025942 Bacteria 46204
213 Ga0207661_10013989 3300025944 Bacteria 5869
214 Ga0207679_10000280 3300025945 Bacteria 38589
215 Ga0207667_10000083 3300025949 Bacteria 154785
216 Ga0207667_10000381 3300025949 Bacteria 59990
217 Ga0207667_10000516 3300025949 Bacteria 50888
218 Ga0207651_10059949 3300025960 Bacteria 2639
219 Ga0207712_10044781 3300025961 Bacteria 3061
220 Ga0207712_10475362 3300025961 Bacteria 1064
221 Ga0207640_10000005 3300025981 Bacteria 408618
222 Ga0207640_10008298 3300025981 Bacteria 5765
223 Ga0207640_10661138 3300025981 Bacteria 891
224 Ga0207677_10021682 3300026023 Bacteria 3931
225 Ga0207639_10002695 3300026041 Bacteria 11917
226 Ga0207639_10169267 3300026041 Bacteria 1849
227 Ga0207678_10003223 3300026067 Bacteria 14745
228 Ga0207678_10085781 3300026067 Bacteria 2691
229 Ga0207678_10095148 3300026067 Bacteria 2545
230 Ga0207702_10002724 3300026078 Bacteria 16557
231 Ga0207702_10013471 3300026078 Bacteria 6794
232 Ga0207641_10548223 3300026088 Bacteria 1127
233 Ga0207648_10002334 3300026089 Bacteria 20483
234 Ga0207648_10646994 3300026089 Bacteria 977
235 Ga0207676_10254216 3300026095 Bacteria 1583
236 Ga0207674_10001350 3300026116 Bacteria 31756
237 Ga0207674_10149668 3300026116 Bacteria 2291
238 Ga0207675_100019472 3300026118 Bacteria 6333
239 Ga0207698_10191832 3300026142 Bacteria 1821
240 Ga0209970_1000210 3300027614 Bacteria 9318
241 Ga0209983_1000138 3300027665 Bacteria 13286
242 Ga0209971_1000054 3300027682 Bacteria 37135
243 Ga0209966_1000059 3300027695 Bacteria 48677
244 Ga0209998_10000066 3300027717 Bacteria 41640
245 Ga0209974_10002514 3300027876 Bacteria 6647
246 Ga0207428_10000177 3300027907 Bacteria 89397
247 Ga0207428_10014023 3300027907 Bacteria 6980
248 Ga0268265_10008608 3300028380 Bacteria 6895
249 Ga0268265_10035575 3300028380 Bacteria 3640
250 Ga0268265_10385721 3300028380 Bacteria 1290
251 Ga0268264_10128573 3300028381 Bacteria 2242
252 Ga0268264_10542803 3300028381 Bacteria 1139
253 Ga0265323_10007131 3300028653 Bacteria 4665
254 Ga0265316_10012884 3300031344 Bacteria 7464
255 Ga0307508_10080861 3300031616 Bacteria 2831
256 Ga0265342_10025003 3300031712 Bacteria 3761
257 Ga0307416_100866170 3300032002 Bacteria 1002
258 Ga0373930_0019057 3300034816 Bacteria 1325
259 Ga0373959_0002471 3300034820 Bacteria 2937
260 Ga0373940_0004549 3300035088 Bacteria 2939
261 Ga0373940_0043762 3300035088 Bacteria 1238
262 Ga0373949_0017644 3300035090 Bacteria 1611
263 Ga0373951_0017978 3300035091 Bacteria 1603
264 Ga0373932_0022689 3300035112 Bacteria 1670
265 Ga0373932_0035474 3300035112 Bacteria 1410
266 Ga0373932_0170957 3300035112 Bacteria 757
267 Ga0373939_0039037 3300035114 Bacteria 1419
268 Ga0373960_0124430 3300035121 Bacteria 859
269 Ga0373960_0130294 3300035121 Bacteria 843
270 Ga0373961_0001031 3300035241 Bacteria 9058
271 Ga0373931_0014518 3300035691 Bacteria 3852
272 Ga0373935_0000477 3300035692 Bacteria 20791
273 Ga0373937_0057307 3300036401 Bacteria 3579
274 Ga0436365_1284501 3300039437 Bacteria 1526
275 Ga0436360_0424273 3300039438 Bacteria 1824
276 Ga0436360_0454519 3300039438 Bacteria 942
277 Ga0436360_0587732 3300039438 Bacteria 1164
278 Ga0436360_0773912 3300039438 Bacteria 2247
279 Ga0436360_0887768 3300039438 Bacteria 1378
280 Ga0436361_0022640 3300039447 Bacteria 18180
281 Ga0436361_0606426 3300039447 Bacteria 2413
282 Ga0436361_0938269 3300039447 Bacteria 1866
283 Ga0436362_0398943 3300039453 Bacteria 4083
284 Ga0436362_0586326 3300039453 Bacteria 753
285 Ga0436362_0879053 3300039453 Bacteria 4525
286 Ga0439448_0000200 3300042005 Bacteria 12434
287 Ga0439448_0018013 3300042005 Bacteria 2160
288 Ga0439455_0004221 3300042012 Bacteria 2830
289 Ga0439459_0001279 3300042438 Bacteria 3670
290 Ga0439464_0001825 3300042439 Bacteria 5139
291 Ga0439460_0003894 3300042461 Bacteria 3624
292 Ga0451577_0005484 3300042876 Bacteria 12988
293 Ga0451577_0034959 3300042876 Bacteria 4528
294 Ga0451577_0213338 3300042876 Bacteria 1744
295 Ga0453683_0009942 3300044673 Bacteria 6328
296 Ga0453683_0070312 3300044673 Bacteria 2189
297 Ga0453684_0042299 3300044712 Bacteria 6144
298 Ga0453684_0063382 3300044712 Bacteria 4729
299 Ga0453684_0180755 3300044712 Bacteria 2476
300 Ga0453684_0798131 3300044712 Bacteria 1018
301 Ga0451576_0005108 3300045051 Bacteria 16632
302 Ga0451576_0026564 3300045051 Bacteria 6226
303 Ga0451576_0048827 3300045051 Bacteria 4443
304 Ga0451576_0093435 3300045051 Bacteria 3128
305 Ga0451576_0221085 3300045051 Bacteria 1977
306 Ga0451576_0653207 3300045051 Bacteria 1105
307 Ga0451576_0829714 3300045051 Bacteria 970
308 Ga0466967_0269051 3300045976 Bacteria 1633
309 Ga0495580_0008888 3300046472 Bacteria 7947
310 Ga0495580_0113933 3300046472 Unclassified 1878
311 Ga0495657_0071639 3300046675 Bacteria 2262
312 Ga0495593_0413662 3300047673 Bacteria 674
313 Ga0495602_0088503 3300048088 Bacteria 2578
314 Ga0496102_0146108 3300048905 Bacteria 2220
315 Ga0496103_0285217 3300048906 Bacteria 1062
316 Ga0496106_0068642 3300048909 Bacteria 2704
317 Ga0496109_0285714 3300048912 Bacteria 1555
318 Ga0496112_0276364 3300048915 Bacteria 1627
319 Ga0496114_0000055 3300048917 Bacteria 96533
320 Ga0501032_0209851 3300049569 Bacteria 1270
321 Ga0501036_0585026 3300049572 Bacteria 927
322 Ga0501036_0594333 3300049572 Bacteria 918
323 Ga0501037_0146817 3300049573 Bacteria 1687
324 Ga0501038_0181909 3300049574 Bacteria 1696
325 Ga0501039_0012732 3300049575 Bacteria 6429
326 Ga0501040_0002748 3300049576 Bacteria 11335
327 Ga0501040_0068152 3300049576 Bacteria 2454
328 Ga0501040_0089656 3300049576 Bacteria 2137
329 Ga0501040_0103293 3300049576 Bacteria 1989
330 Ga0501040_0397156 3300049576 Bacteria 990
331 Ga0501041_0015206 3300049577 Bacteria 4569
332 Ga0501041_0066501 3300049577 Bacteria 2209
333 Ga0501042_0019042 3300049578 Bacteria 4763
334 Ga0501042_0207257 3300049578 Bacteria 1414
335 Ga0501043_0038985 3300049579 Bacteria 3735
336 Ga0501046_0000202 3300049580 Bacteria 61588
337 Ga0501047_0137341 3300049581 Bacteria 2324
338 Ga0501047_0412950 3300049581 Bacteria 1182
339 Ga0501048_0131294 3300049582 Bacteria 1770
340 Ga0501048_0233943 3300049582 Bacteria 1304
341 Ga0501068_0108570 3300049584 Bacteria 1724
342 Ga0501068_0168864 3300049584 Bacteria 1380
343 Ga0501071_0016581 3300049587 Bacteria 5068
344 Ga0501071_0147968 3300049587 Bacteria 1751
345 Ga0501071_0582161 3300049587 Bacteria 860
346 Ga0501072_0135332 3300049588 Bacteria 1964
347 Ga0501074_0006004 3300049590 Bacteria 8762
348 Ga0501074_0331491 3300049590 Bacteria 1080
349 Ga0501075_0022125 3300049591 Bacteria 4642
350 Ga0501075_0057451 3300049591 Bacteria 2930
351 Ga0501075_0097785 3300049591 Bacteria 2228
352 Ga0501075_0490980 3300049591 Bacteria 937
353 Ga0501075_0731941 3300049591 Bacteria 753
354 Ga0501076_0010704 3300049592 Bacteria 6818
355 Ga0501076_0149813 3300049592 Bacteria 1898
356 Ga0501076_0155811 3300049592 Bacteria 1859
357 Ga0501076_0895658 3300049592 Bacteria 731
358 Ga0501077_0022867 3300049593 Bacteria 3962
359 Ga0501077_0043640 3300049593 Bacteria 2849
360 Ga0501079_0000982 3300049741 Bacteria 19647
361 Ga0501079_0130984 3300049741 Bacteria 1952
362 Ga0501079_0390018 3300049741 Bacteria 1092
363 Ga0501080_0303023 3300049742 Bacteria 1449
364 Ga0501080_0546015 3300049742 Bacteria 1032
365 Ga0501080_0642635 3300049742 Bacteria 939
366 Ga0501081_0002701 3300049743 Bacteria 11222
367 Ga0501081_0046144 3300049743 Bacteria 2994
368 Ga0501081_0082733 3300049743 Bacteria 2249
369 Ga0501081_0189004 3300049743 Bacteria 1491
370 Ga0501081_0200839 3300049743 Bacteria 1446
371 Ga0501081_0723926 3300049743 Bacteria 747
372 Ga0501083_0009564 3300049744 Bacteria 6849
373 Ga0501035_0085114 3300049822 Bacteria 2788
374 Ga0501035_0165024 3300049822 Bacteria 1916
375 Ga0501045_0001661 3300049824 Bacteria 14965
376 Ga0501045_0206468 3300049824 Bacteria 1463
377 Ga0501045_0756822 3300049824 Bacteria 716
378 nmdc:mga05p37_2168_c1 3300050507 Bacteria 22889
379 nmdc:mga05p37_244567_c1 3300050507 Bacteria 2155
380 nmdc:mga05p37_521451_c1 3300050507 Bacteria 1359
381 nmdc:mga05p37_778051_c1 3300050507 Bacteria 1051
382 nmdc:mga05p37_97338_c1 3300050507 Bacteria 3625
383 nmdc:mga09592_30635_c1 3300050508 Bacteria 4477
384 nmdc:mga09592_35507_c1 3300050508 Bacteria 4173
385 nmdc:mga0qj67_8937_c1 3300050509 Bacteria 7432
386 nmdc:mga06r32_32300_c1 3300050510 Bacteria 4924
387 nmdc:mga06r32_650095_c1 3300050510 Bacteria 1023
388 nmdc:mga08y16_10075_c1 3300050511 Bacteria 9922
389 nmdc:mga08y16_365187_c1 3300050511 Bacteria 1481
390 nmdc:mga08y16_676_c1 3300050511 Bacteria 32217
391 nmdc:mga0n895_245842_c1 3300050512 Bacteria 1816
392 nmdc:mga0n895_402009_c1 3300050512 Bacteria 1385
393 nmdc:mga0n895_583994_c1 3300050512 Bacteria 1121
394 nmdc:mga0n895_615163_c1 3300050512 Bacteria 1088
395 nmdc:mga0rr50_138649_c1 3300050513 Bacteria 1955
396 nmdc:mga0rr50_171514_c1 3300050513 Bacteria 1768
397 nmdc:mga0rr50_242062_c1 3300050513 Bacteria 1496
398 nmdc:mga0rr50_798_c1 3300050513 Bacteria 17004
399 nmdc:mga08x19_71350_c1 3300050514 Bacteria 2265
400 nmdc:mga08x19_83609_c1 3300050514 Bacteria 2099
401 nmdc:mga0a205_14647_c1 3300050515 Bacteria 7318
402 nmdc:mga0a205_272584_c1 3300050515 Bacteria 1569
403 nmdc:mga0a205_413444_c1 3300050515 Bacteria 1212
404 nmdc:mga0a205_59267_c1 3300050515 Bacteria 3698
405 Ga0501084_0002444 3300054114 Bacteria 14939
406 Ga0501082_0001816 3300060353 Bacteria 18794
407 Ga0501082_0094749 3300060353 Bacteria 2580
408 Ga0530510_0002290 3300061734 Bacteria 13127
409 Ga0530510_0002551 3300061734 Bacteria 12516
410 Ga0530510_0017873 3300061734 Bacteria 5027
411 Ga0530510_0348578 3300061734 Bacteria 1112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0586326 Ga0436362_0586326_173_724 181
2 3300005544 Ga0070686_100074377 Ga0070686_1000743772 188
3 3300005843 Ga0068860_100183770 Ga0068860_1001837702 188
4 3300006852 Ga0075433_10138375 Ga0075433_101383753 188
5 3300009094 Ga0111539_10036525 Ga0111539_100365254 188
6 3300027907 Ga0207428_10014023 Ga0207428_100140235 188
7 3300050511 nmdc:mga08y16_10075_c1 nmdc:mga08y16_10075_c1_5330_5992 188
8 3300013105 Ga0157369_10714072 Ga0157369_107140722 198
9 3300047673 Ga0495593_0413662 Ga0495593_0413662_58_663 199
10 3300035112 Ga0373932_0170957 Ga0373932_0170957_28_687 208
11 iso_pu_bacteria 2524023129 2524186430 211
12 3300005341 Ga0070691_10007828 Ga0070691_100078283 212
13 3300005455 Ga0070663_100067646 Ga0070663_1000676463 212
14 3300005455 Ga0070663_100227198 Ga0070663_1002271981 212
15 3300005535 Ga0070684_100141663 Ga0070684_1001416632 212
16 3300005563 Ga0068855_100000056 Ga0068855_10000005625 212
17 3300005563 Ga0068855_100003320 Ga0068855_1000033206 212
18 3300005578 Ga0068854_100000006 Ga0068854_10000000636 212
19 3300005614 Ga0068856_100001064 Ga0068856_10000106417 212
20 3300009093 Ga0105240_10178224 Ga0105240_101782242 212
21 3300009093 Ga0105240_10343532 Ga0105240_103435322 212
22 3300013105 Ga0157369_10127855 Ga0157369_101278552 212
23 3300013296 Ga0157374_10074857 Ga0157374_100748574 212
24 3300014969 Ga0157376_10385443 Ga0157376_103854432 212
25 3300025913 Ga0207695_10130777 Ga0207695_101307772 212
26 3300025949 Ga0207667_10000083 Ga0207667_1000008324 212
27 3300025949 Ga0207667_10000516 Ga0207667_1000051620 212
28 3300025981 Ga0207640_10000005 Ga0207640_10000005154 212
29 3300026041 Ga0207639_10169267 Ga0207639_101692672 212
30 3300026067 Ga0207678_10085781 Ga0207678_100857812 212
31 3300026067 Ga0207678_10095148 Ga0207678_100951482 212
32 3300026078 Ga0207702_10013471 Ga0207702_100134714 212
33 3300026142 Ga0207698_10191832 Ga0207698_101918322 212
34 3300021358 Ga0213873_10036703 Ga0213873_100367032 213
35 3300039447 Ga0436361_0606426 Ga0436361_0606426_1311_1961 213
36 3300039453 Ga0436362_0398943 Ga0436362_0398943_1438_2088 213
37 3300061734 Ga0530510_0348578 Ga0530510_0348578_450_1094 213
38 3300005539 Ga0068853_100478935 Ga0068853_1004789351 214
39 3300021361 Ga0213872_10002242 Ga0213872_100022424 214
40 3300032002 Ga0307416_100866170 Ga0307416_1008661702 214
41 3300039438 Ga0436360_0454519 Ga0436360_0454519_260_913 214
42 3300039438 Ga0436360_0587732 Ga0436360_0587732_363_1016 214
43 3300039438 Ga0436360_0773912 Ga0436360_0773912_398_1054 214
44 3300039447 Ga0436361_0022640 Ga0436361_0022640_14905_15564 214
45 3300039453 Ga0436362_0879053 Ga0436362_0879053_1066_1722 214
46 3300005440 Ga0070705_100086584 Ga0070705_1000865842 215
47 3300005518 Ga0070699_100152780 Ga0070699_1001527802 215
48 3300005518 Ga0070699_100306936 Ga0070699_1003069362 215
49 3300005544 Ga0070686_100402792 Ga0070686_1004027922 215
50 3300005546 Ga0070696_100182836 Ga0070696_1001828362 215
51 3300005844 Ga0068862_100410757 Ga0068862_1004107572 215
52 3300006852 Ga0075433_10007607 Ga0075433_1000760711 215
53 3300006852 Ga0075433_10183550 Ga0075433_101835502 215
54 3300006852 Ga0075433_10261977 Ga0075433_102619772 215
55 3300006871 Ga0075434_100009493 Ga0075434_10000949311 215
56 3300006914 Ga0075436_100477965 Ga0075436_1004779651 215
57 3300007076 Ga0075435_100146005 Ga0075435_1001460052 215
58 3300009094 Ga0111539_10005457 Ga0111539_100054574 215
59 3300009147 Ga0114129_10046598 Ga0114129_100465981 215
60 3300013297 Ga0157378_10324378 Ga0157378_103243782 215
61 3300025923 Ga0207681_10068986 Ga0207681_100689864 215
62 3300026089 Ga0207648_10646994 Ga0207648_106469942 215
63 3300027907 Ga0207428_10000177 Ga0207428_1000017744 215
64 3300028380 Ga0268265_10385721 Ga0268265_103857212 215
65 3300028381 Ga0268264_10128573 Ga0268264_101285733 215
66 3300035088 Ga0373940_0004549 Ga0373940_0004549_538_1188 215
67 3300035088 Ga0373940_0043762 Ga0373940_0043762_530_1180 215
68 3300035091 Ga0373951_0017978 Ga0373951_0017978_19_669 215
69 3300035112 Ga0373932_0022689 Ga0373932_0022689_545_1195 215
70 3300035112 Ga0373932_0035474 Ga0373932_0035474_562_1212 215
71 3300035114 Ga0373939_0039037 Ga0373939_0039037_412_1062 215
72 3300035121 Ga0373960_0124430 Ga0373960_0124430_194_844 215
73 3300039438 Ga0436360_0887768 Ga0436360_0887768_151_810 215
74 3300042876 Ga0451577_0213338 Ga0451577_0213338_227_877 215
75 3300044673 Ga0453683_0070312 Ga0453683_0070312_251_898 215
76 3300044712 Ga0453684_0180755 Ga0453684_0180755_1577_2233 215
77 3300044712 Ga0453684_0798131 Ga0453684_0798131_140_796 215
78 3300045051 Ga0451576_0221085 Ga0451576_0221085_977_1627 215
79 3300045051 Ga0451576_0653207 Ga0451576_0653207_359_1015 215
80 3300045051 Ga0451576_0829714 Ga0451576_0829714_40_690 215
81 3300049581 Ga0501047_0412950 Ga0501047_0412950_412_1080 215
82 3300050507 nmdc:mga05p37_2168_c1 nmdc:mga05p37_2168_c1_4671_5321 215
83 3300050508 nmdc:mga09592_30635_c1 nmdc:mga09592_30635_c1_1236_1886 215
84 3300050509 nmdc:mga0qj67_8937_c1 nmdc:mga0qj67_8937_c1_3816_4466 215
85 3300050510 nmdc:mga06r32_650095_c1 nmdc:mga06r32_650095_c1_263_913 215
86 3300050511 nmdc:mga08y16_676_c1 nmdc:mga08y16_676_c1_13771_14421 215
87 3300050512 nmdc:mga0n895_245842_c1 nmdc:mga0n895_245842_c1_500_1150 215
88 3300050512 nmdc:mga0n895_402009_c1 nmdc:mga0n895_402009_c1_251_934 215
89 3300050513 nmdc:mga0rr50_138649_c1 nmdc:mga0rr50_138649_c1_601_1251 215
90 3300050515 nmdc:mga0a205_14647_c1 nmdc:mga0a205_14647_c1_1551_2201 215
91 3300050515 nmdc:mga0a205_272584_c1 nmdc:mga0a205_272584_c1_244_894 215
92 3300050515 nmdc:mga0a205_59267_c1 nmdc:mga0a205_59267_c1_2167_2817 215
93 3300005468 Ga0070707_100031588 Ga0070707_1000315884 216
94 3300005518 Ga0070699_100008333 Ga0070699_1000083338 216
95 3300005536 Ga0070697_100027373 Ga0070697_1000273736 216
96 3300005536 Ga0070697_100044101 Ga0070697_1000441014 216
97 3300006847 Ga0075431_100060818 Ga0075431_1000608183 216
98 3300006852 Ga0075433_10049034 Ga0075433_100490344 216
99 3300006871 Ga0075434_100022726 Ga0075434_1000227263 216
100 3300006914 Ga0075436_100027835 Ga0075436_1000278353 216
101 3300007076 Ga0075435_100024930 Ga0075435_1000249304 216
102 3300007076 Ga0075435_100038983 Ga0075435_1000389833 216
103 3300009147 Ga0114129_10155046 Ga0114129_101550463 216
104 3300025910 Ga0207684_10124598 Ga0207684_101245982 216
105 3300025922 Ga0207646_10041613 Ga0207646_100416134 216
106 3300025922 Ga0207646_10123223 Ga0207646_101232232 216
107 3300031344 Ga0265316_10012884 Ga0265316_100128844 216
108 3300039447 Ga0436361_0938269 Ga0436361_0938269_410_1075 216
109 3300042876 Ga0451577_0034959 Ga0451577_0034959_949_1668 216
110 3300045051 Ga0451576_0048827 Ga0451576_0048827_3037_3756 216
111 3300049572 Ga0501036_0585026 Ga0501036_0585026_228_878 216
112 3300049572 Ga0501036_0594333 Ga0501036_0594333_77_727 216
113 3300049573 Ga0501037_0146817 Ga0501037_0146817_429_1079 216
114 3300049574 Ga0501038_0181909 Ga0501038_0181909_899_1549 216
115 3300049576 Ga0501040_0068152 Ga0501040_0068152_1545_2195 216
116 3300049576 Ga0501040_0089656 Ga0501040_0089656_748_1398 216
117 3300049576 Ga0501040_0103293 Ga0501040_0103293_1021_1671 216
118 3300049578 Ga0501042_0207257 Ga0501042_0207257_76_726 216
119 3300049582 Ga0501048_0233943 Ga0501048_0233943_376_1026 216
120 3300049584 Ga0501068_0168864 Ga0501068_0168864_544_1194 216
121 3300049587 Ga0501071_0582161 Ga0501071_0582161_144_794 216
122 3300049590 Ga0501074_0331491 Ga0501074_0331491_356_1006 216
123 3300049591 Ga0501075_0057451 Ga0501075_0057451_75_725 216
124 3300049591 Ga0501075_0490980 Ga0501075_0490980_63_713 216
125 3300049591 Ga0501075_0731941 Ga0501075_0731941_55_705 216
126 3300049592 Ga0501076_0155811 Ga0501076_0155811_469_1119 216
127 3300049592 Ga0501076_0895658 Ga0501076_0895658_64_714 216
128 3300049593 Ga0501077_0043640 Ga0501077_0043640_1724_2374 216
129 3300049741 Ga0501079_0390018 Ga0501079_0390018_105_755 216
130 3300049742 Ga0501080_0303023 Ga0501080_0303023_433_1083 216
131 3300049742 Ga0501080_0642635 Ga0501080_0642635_44_694 216
132 3300049743 Ga0501081_0189004 Ga0501081_0189004_228_881 216
133 3300049743 Ga0501081_0200839 Ga0501081_0200839_633_1283 216
134 3300049743 Ga0501081_0723926 Ga0501081_0723926_16_666 216
135 3300049822 Ga0501035_0165024 Ga0501035_0165024_1211_1861 216
136 3300050507 nmdc:mga05p37_97338_c1 nmdc:mga05p37_97338_c1_1485_2138 216
137 3300050513 nmdc:mga0rr50_171514_c1 nmdc:mga0rr50_171514_c1_494_1147 216
138 3300050514 nmdc:mga08x19_83609_c1 nmdc:mga08x19_83609_c1_1309_1962 216
139 3300050515 nmdc:mga0a205_413444_c1 nmdc:mga0a205_413444_c1_455_1108 216
140 3300060353 Ga0501082_0094749 Ga0501082_0094749_1520_2170 216
141 3300061734 Ga0530510_0002290 Ga0530510_0002290_12429_13079 216
142 3300061734 Ga0530510_0002551 Ga0530510_0002551_3368_4018 216
143 3300061734 Ga0530510_0017873 Ga0530510_0017873_1697_2347 216
144 3300005330 Ga0070690_100342120 Ga0070690_1003421202 217
145 3300005438 Ga0070701_10107564 Ga0070701_101075641 217
146 3300005439 Ga0070711_100105776 Ga0070711_1001057762 217
147 3300005444 Ga0070694_100026394 Ga0070694_1000263942 217
148 3300005445 Ga0070708_100164233 Ga0070708_1001642331 217
149 3300005467 Ga0070706_100006328 Ga0070706_10000632811 217
150 3300005467 Ga0070706_100523211 Ga0070706_1005232112 217
151 3300005467 Ga0070706_101046548 Ga0070706_1010465481 217
152 3300005468 Ga0070707_100070941 Ga0070707_1000709413 217
153 3300005468 Ga0070707_100230080 Ga0070707_1002300801 217
154 3300005471 Ga0070698_100635497 Ga0070698_1006354971 217
155 3300005518 Ga0070699_100003472 Ga0070699_1000034727 217
156 3300005536 Ga0070697_100005486 Ga0070697_1000054868 217
157 3300005536 Ga0070697_100328839 Ga0070697_1003288392 217
158 3300005549 Ga0070704_100030293 Ga0070704_1000302932 217
159 3300005617 Ga0068859_100055430 Ga0068859_1000554302 217
160 3300005843 Ga0068860_100116761 Ga0068860_1001167612 217
161 3300005844 Ga0068862_100024892 Ga0068862_1000248924 217
162 3300006163 Ga0070715_10148494 Ga0070715_101484942 217
163 3300006175 Ga0070712_100011684 Ga0070712_1000116848 217
164 3300006871 Ga0075434_100488044 Ga0075434_1004880441 217
165 3300006931 Ga0097620_100055429 Ga0097620_1000554292 217
166 3300007265 Ga0099794_10069892 Ga0099794_100698922 217
167 3300009147 Ga0114129_10603239 Ga0114129_106032392 217
168 3300009553 Ga0105249_10087557 Ga0105249_100875572 217
169 3300009553 Ga0105249_10168743 Ga0105249_101687432 217
170 3300025885 Ga0207653_10021480 Ga0207653_100214802 217
171 3300025910 Ga0207684_10195639 Ga0207684_101956392 217
172 3300025910 Ga0207684_10423786 Ga0207684_104237862 217
173 3300025910 Ga0207684_10868546 Ga0207684_108685461 217
174 3300025915 Ga0207693_10029318 Ga0207693_100293182 217
175 3300025916 Ga0207663_10168335 Ga0207663_101683352 217
176 3300025917 Ga0207660_10066420 Ga0207660_100664202 217
177 3300025922 Ga0207646_10037655 Ga0207646_100376552 217
178 3300025922 Ga0207646_10067107 Ga0207646_100671074 217
179 3300025922 Ga0207646_10108834 Ga0207646_101088342 217
180 3300025922 Ga0207646_10408871 Ga0207646_104088712 217
181 3300025961 Ga0207712_10044781 Ga0207712_100447812 217
182 3300025961 Ga0207712_10475362 Ga0207712_104753622 217
183 3300025981 Ga0207640_10661138 Ga0207640_106611381 217
184 3300026095 Ga0207676_10254216 Ga0207676_102542162 217
185 3300026116 Ga0207674_10149668 Ga0207674_101496682 217
186 3300028380 Ga0268265_10035575 Ga0268265_100355753 217
187 3300028381 Ga0268264_10542803 Ga0268264_105428032 217
188 3300049577 Ga0501041_0066501 Ga0501041_0066501_1277_1942 217
189 3300049587 Ga0501071_0147968 Ga0501071_0147968_466_1131 217
190 3300049743 Ga0501081_0046144 Ga0501081_0046144_2271_2924 217
191 3300049743 Ga0501081_0082733 Ga0501081_0082733_322_987 217
192 3300050507 nmdc:mga05p37_521451_c1 nmdc:mga05p37_521451_c1_100_756 217
193 3300005334 Ga0068869_100175008 Ga0068869_1001750082 218
194 3300005340 Ga0070689_100043221 Ga0070689_1000432214 218
195 3300005355 Ga0070671_100385615 Ga0070671_1003856151 218
196 3300005365 Ga0070688_100061399 Ga0070688_1000613992 218
197 3300005456 Ga0070678_100312610 Ga0070678_1003126101 218
198 3300005467 Ga0070706_100006201 Ga0070706_10000620111 218
199 3300005471 Ga0070698_100002788 Ga0070698_10000278810 218
200 3300005518 Ga0070699_101020457 Ga0070699_1010204571 218
201 3300005536 Ga0070697_100000909 Ga0070697_10000090910 218
202 3300006847 Ga0075431_100000240 Ga0075431_10000024018 218
203 3300006880 Ga0075429_100006459 Ga0075429_1000064592 218
204 3300009093 Ga0105240_10919712 Ga0105240_109197122 218
205 3300009094 Ga0111539_10051844 Ga0111539_100518444 218
206 3300021384 Ga0213876_10320402 Ga0213876_103204021 218
207 3300025910 Ga0207684_10006007 Ga0207684_1000600712 218
208 3300025936 Ga0207670_10123455 Ga0207670_101234552 218
209 3300025960 Ga0207651_10059949 Ga0207651_100599493 218
210 3300028653 Ga0265323_10007131 Ga0265323_100071312 218
211 3300031616 Ga0307508_10080861 Ga0307508_100808612 218
212 3300031712 Ga0265342_10025003 Ga0265342_100250032 218
213 3300035241 Ga0373961_0001031 Ga0373961_0001031_646_1308 218
214 3300035692 Ga0373935_0000477 Ga0373935_0000477_7415_8077 218
215 3300039437 Ga0436365_1284501 Ga0436365_1284501_739_1401 218
216 3300039438 Ga0436360_0424273 Ga0436360_0424273_917_1594 218
217 3300045976 Ga0466967_0269051 Ga0466967_0269051_138_848 218
218 3300048917 Ga0496114_0000055 Ga0496114_0000055_85708_86370 218
219 3300049741 Ga0501079_0130984 Ga0501079_0130984_166_828 218
220 3300050508 nmdc:mga09592_35507_c1 nmdc:mga09592_35507_c1_2340_3002 218
221 3300050510 nmdc:mga06r32_32300_c1 nmdc:mga06r32_32300_c1_407_1069 218
222 3300050511 nmdc:mga08y16_365187_c1 nmdc:mga08y16_365187_c1_472_1134 218
223 3300003371 JGI26145J50221_1006010 JGI26145J50221_10060102 219
224 3300005293 Ga0065715_10150506 Ga0065715_101505061 219
225 3300005328 Ga0070676_10000078 Ga0070676_1000007811 219
226 3300005329 Ga0070683_100128400 Ga0070683_1001284002 219
227 3300005331 Ga0070670_100012956 Ga0070670_1000129565 219
228 3300005334 Ga0068869_100000679 Ga0068869_1000006797 219
229 3300005336 Ga0070680_100002566 Ga0070680_1000025665 219
230 3300005337 Ga0070682_100001048 Ga0070682_1000010488 219
231 3300005338 Ga0068868_100005961 Ga0068868_1000059612 219
232 3300005339 Ga0070660_100000369 Ga0070660_10000036925 219
233 3300005340 Ga0070689_100010613 Ga0070689_1000106135 219
234 3300005341 Ga0070691_10029569 Ga0070691_100295691 219
235 3300005344 Ga0070661_100000449 Ga0070661_10000044919 219
236 3300005345 Ga0070692_10016516 Ga0070692_100165162 219
237 3300005353 Ga0070669_100038888 Ga0070669_1000388882 219
238 3300005364 Ga0070673_100003517 Ga0070673_10000351711 219
239 3300005366 Ga0070659_100000719 Ga0070659_1000007192 219
240 3300005406 Ga0070703_10004737 Ga0070703_100047374 219
241 3300005438 Ga0070701_10043214 Ga0070701_100432142 219
242 3300005439 Ga0070711_100240284 Ga0070711_1002402842 219
243 3300005440 Ga0070705_100000292 Ga0070705_10000029218 219
244 3300005440 Ga0070705_100160384 Ga0070705_1001603842 219
245 3300005444 Ga0070694_100001227 Ga0070694_1000012276 219
246 3300005444 Ga0070694_100012985 Ga0070694_1000129854 219
247 3300005445 Ga0070708_100007672 Ga0070708_1000076726 219
248 3300005445 Ga0070708_100033261 Ga0070708_1000332612 219
249 3300005445 Ga0070708_100052720 Ga0070708_1000527202 219
250 3300005445 Ga0070708_100540968 Ga0070708_1005409682 219
251 3300005455 Ga0070663_100001312 Ga0070663_1000013124 219
252 3300005457 Ga0070662_100001136 Ga0070662_10000113611 219
253 3300005458 Ga0070681_10004905 Ga0070681_100049057 219
254 3300005459 Ga0068867_100002791 Ga0068867_1000027915 219
255 3300005467 Ga0070706_100063624 Ga0070706_1000636242 219
256 3300005467 Ga0070706_100148358 Ga0070706_1001483582 219
257 3300005468 Ga0070707_100043363 Ga0070707_1000433633 219
258 3300005468 Ga0070707_100189508 Ga0070707_1001895082 219
259 3300005468 Ga0070707_100196795 Ga0070707_1001967952 219
260 3300005468 Ga0070707_100462460 Ga0070707_1004624602 219
261 3300005471 Ga0070698_100002478 Ga0070698_1000024782 219
262 3300005471 Ga0070698_100012924 Ga0070698_10001292412 219
263 3300005518 Ga0070699_100014989 Ga0070699_1000149897 219
264 3300005518 Ga0070699_100055458 Ga0070699_1000554582 219
265 3300005530 Ga0070679_100001205 Ga0070679_10000120512 219
266 3300005535 Ga0070684_100004922 Ga0070684_1000049228 219
267 3300005536 Ga0070697_100003084 Ga0070697_10000308413 219
268 3300005536 Ga0070697_100017353 Ga0070697_1000173533 219
269 3300005536 Ga0070697_100021043 Ga0070697_1000210432 219
270 3300005536 Ga0070697_100132415 Ga0070697_1001324152 219
271 3300005536 Ga0070697_100163120 Ga0070697_1001631202 219
272 3300005539 Ga0068853_100015685 Ga0068853_1000156853 219
273 3300005543 Ga0070672_100014478 Ga0070672_1000144785 219
274 3300005545 Ga0070695_100001737 Ga0070695_10000173712 219
275 3300005545 Ga0070695_100002286 Ga0070695_10000228611 219
276 3300005545 Ga0070695_100004003 Ga0070695_1000040037 219
277 3300005546 Ga0070696_100000277 Ga0070696_10000027712 219
278 3300005547 Ga0070693_100000692 Ga0070693_1000006927 219
279 3300005549 Ga0070704_100000361 Ga0070704_1000003616 219
280 3300005563 Ga0068855_100000559 Ga0068855_10000055912 219
281 3300005564 Ga0070664_100002942 Ga0070664_1000029425 219
282 3300005577 Ga0068857_100005102 Ga0068857_10000510211 219
283 3300005578 Ga0068854_100000497 Ga0068854_10000049726 219
284 3300005614 Ga0068856_100000940 Ga0068856_1000009409 219
285 3300005615 Ga0070702_100068376 Ga0070702_1000683762 219
286 3300005617 Ga0068859_100003247 Ga0068859_10000324715 219
287 3300005719 Ga0068861_100006592 Ga0068861_1000065928 219
288 3300005840 Ga0068870_10000438 Ga0068870_1000043810 219
289 3300005841 Ga0068863_100010303 Ga0068863_10001030312 219
290 3300005844 Ga0068862_100003503 Ga0068862_1000035035 219
291 3300005937 Ga0081455_10000788 Ga0081455_1000078840 219
292 3300006852 Ga0075433_10534105 Ga0075433_105341051 219
293 3300006931 Ga0097620_100003247 Ga0097620_10000324715 219
294 3300007076 Ga0075435_100055644 Ga0075435_1000556443 219
295 3300009147 Ga0114129_10236513 Ga0114129_102365132 219
296 3300009147 Ga0114129_10308594 Ga0114129_103085942 219
297 3300009174 Ga0105241_10000966 Ga0105241_1000096610 219
298 3300013100 Ga0157373_10000304 Ga0157373_1000030418 219
299 3300013105 Ga0157369_10021229 Ga0157369_100212292 219
300 3300013307 Ga0157372_10005525 Ga0157372_1000552512 219
301 3300013307 Ga0157372_11307228 Ga0157372_113072281 219
302 3300013308 Ga0157375_10123938 Ga0157375_101239383 219
303 3300014325 Ga0163163_10020657 Ga0163163_100206572 219
304 3300020070 Ga0206356_11215523 Ga0206356_112155232 219
305 3300025901 Ga0207688_10042675 Ga0207688_100426753 219
306 3300025907 Ga0207645_10000076 Ga0207645_1000007652 219
307 3300025908 Ga0207643_10000227 Ga0207643_1000022715 219
308 3300025910 Ga0207684_10000874 Ga0207684_1000087428 219
309 3300025910 Ga0207684_10068740 Ga0207684_100687403 219
310 3300025910 Ga0207684_10212337 Ga0207684_102123372 219
311 3300025911 Ga0207654_10005189 Ga0207654_100051895 219
312 3300025912 Ga0207707_10000357 Ga0207707_1000035719 219
313 3300025917 Ga0207660_10003495 Ga0207660_1000349512 219
314 3300025918 Ga0207662_10015349 Ga0207662_100153495 219
315 3300025919 Ga0207657_10000417 Ga0207657_1000041713 219
316 3300025920 Ga0207649_10001653 Ga0207649_1000165313 219
317 3300025921 Ga0207652_10004761 Ga0207652_1000476110 219
318 3300025922 Ga0207646_10001150 Ga0207646_1000115017 219
319 3300025922 Ga0207646_10029995 Ga0207646_100299954 219
320 3300025922 Ga0207646_10035755 Ga0207646_100357557 219
321 3300025922 Ga0207646_10085384 Ga0207646_100853843 219
322 3300025922 Ga0207646_10121187 Ga0207646_101211872 219
323 3300025923 Ga0207681_10097679 Ga0207681_100976792 219
324 3300025925 Ga0207650_10165203 Ga0207650_101652032 219
325 3300025932 Ga0207690_10001242 Ga0207690_1000124213 219
326 3300025933 Ga0207706_10026077 Ga0207706_100260776 219
327 3300025936 Ga0207670_10010132 Ga0207670_100101323 219
328 3300025940 Ga0207691_10012395 Ga0207691_100123955 219
329 3300025942 Ga0207689_10000281 Ga0207689_1000028124 219
330 3300025944 Ga0207661_10013989 Ga0207661_100139893 219
331 3300025945 Ga0207679_10000280 Ga0207679_1000028031 219
332 3300025949 Ga0207667_10000381 Ga0207667_1000038139 219
333 3300025981 Ga0207640_10008298 Ga0207640_100082982 219
334 3300026023 Ga0207677_10021682 Ga0207677_100216822 219
335 3300026041 Ga0207639_10002695 Ga0207639_100026956 219
336 3300026067 Ga0207678_10003223 Ga0207678_100032233 219
337 3300026078 Ga0207702_10002724 Ga0207702_1000272412 219
338 3300026088 Ga0207641_10548223 Ga0207641_105482232 219
339 3300026089 Ga0207648_10002334 Ga0207648_1000233413 219
340 3300026116 Ga0207674_10001350 Ga0207674_1000135010 219
341 3300026118 Ga0207675_100019472 Ga0207675_1000194725 219
342 3300027614 Ga0209970_1000210 Ga0209970_10002109 219
343 3300027665 Ga0209983_1000138 Ga0209983_10001384 219
344 3300027682 Ga0209971_1000054 Ga0209971_100005441 219
345 3300027695 Ga0209966_1000059 Ga0209966_100005940 219
346 3300027717 Ga0209998_10000066 Ga0209998_1000006638 219
347 3300027876 Ga0209974_10002514 Ga0209974_100025145 219
348 3300028380 Ga0268265_10008608 Ga0268265_100086085 219
349 3300034816 Ga0373930_0019057 Ga0373930_0019057_237_896 219
350 3300034820 Ga0373959_0002471 Ga0373959_0002471_1366_2025 219
351 3300035090 Ga0373949_0017644 Ga0373949_0017644_770_1429 219
352 3300035121 Ga0373960_0130294 Ga0373960_0130294_142_801 219
353 3300035691 Ga0373931_0014518 Ga0373931_0014518_1127_1786 219
354 3300036401 Ga0373937_0057307 Ga0373937_0057307_1751_2422 219
355 3300042005 Ga0439448_0000200 Ga0439448_0000200_10071_10730 219
356 3300042005 Ga0439448_0018013 Ga0439448_0018013_915_1574 219
357 3300042012 Ga0439455_0004221 Ga0439455_0004221_230_889 219
358 3300042438 Ga0439459_0001279 Ga0439459_0001279_242_901 219
359 3300042439 Ga0439464_0001825 Ga0439464_0001825_1310_1969 219
360 3300042461 Ga0439460_0003894 Ga0439460_0003894_2860_3519 219
361 3300042876 Ga0451577_0005484 Ga0451577_0005484_7681_8340 219
362 3300044673 Ga0453683_0009942 Ga0453683_0009942_645_1304 219
363 3300044712 Ga0453684_0042299 Ga0453684_0042299_3528_4187 219
364 3300044712 Ga0453684_0063382 Ga0453684_0063382_2404_3063 219
365 3300045051 Ga0451576_0005108 Ga0451576_0005108_1874_2533 219
366 3300045051 Ga0451576_0026564 Ga0451576_0026564_1399_2058 219
367 3300045051 Ga0451576_0093435 Ga0451576_0093435_2395_3054 219
368 3300046472 Ga0495580_0008888 Ga0495580_0008888_6773_7459 219
369 3300046472 Ga0495580_0113933 Ga0495580_0113933_967_1638 219
370 3300046675 Ga0495657_0071639 Ga0495657_0071639_786_1457 219
371 3300048088 Ga0495602_0088503 Ga0495602_0088503_861_1532 219
372 3300048905 Ga0496102_0146108 Ga0496102_0146108_448_1107 219
373 3300048906 Ga0496103_0285217 Ga0496103_0285217_381_1040 219
374 3300048909 Ga0496106_0068642 Ga0496106_0068642_1574_2233 219
375 3300048912 Ga0496109_0285714 Ga0496109_0285714_317_976 219
376 3300048915 Ga0496112_0276364 Ga0496112_0276364_293_952 219
377 3300049569 Ga0501032_0209851 Ga0501032_0209851_432_1091 219
378 3300049575 Ga0501039_0012732 Ga0501039_0012732_5376_6035 219
379 3300049576 Ga0501040_0002748 Ga0501040_0002748_5009_5668 219
380 3300049576 Ga0501040_0397156 Ga0501040_0397156_253_912 219
381 3300049577 Ga0501041_0015206 Ga0501041_0015206_2008_2667 219
382 3300049578 Ga0501042_0019042 Ga0501042_0019042_3142_3801 219
383 3300049579 Ga0501043_0038985 Ga0501043_0038985_86_745 219
384 3300049580 Ga0501046_0000202 Ga0501046_0000202_3656_4315 219
385 3300049581 Ga0501047_0137341 Ga0501047_0137341_1581_2240 219
386 3300049582 Ga0501048_0131294 Ga0501048_0131294_753_1412 219
387 3300049584 Ga0501068_0108570 Ga0501068_0108570_977_1636 219
388 3300049587 Ga0501071_0016581 Ga0501071_0016581_3644_4303 219
389 3300049588 Ga0501072_0135332 Ga0501072_0135332_713_1372 219
390 3300049590 Ga0501074_0006004 Ga0501074_0006004_5998_6657 219
391 3300049591 Ga0501075_0022125 Ga0501075_0022125_3080_3739 219
392 3300049591 Ga0501075_0097785 Ga0501075_0097785_492_1151 219
393 3300049592 Ga0501076_0010704 Ga0501076_0010704_1140_1799 219
394 3300049592 Ga0501076_0149813 Ga0501076_0149813_767_1426 219
395 3300049593 Ga0501077_0022867 Ga0501077_0022867_1556_2215 219
396 3300049741 Ga0501079_0000982 Ga0501079_0000982_4026_4685 219
397 3300049742 Ga0501080_0546015 Ga0501080_0546015_37_696 219
398 3300049743 Ga0501081_0002701 Ga0501081_0002701_7479_8138 219
399 3300049744 Ga0501083_0009564 Ga0501083_0009564_4827_5486 219
400 3300049822 Ga0501035_0085114 Ga0501035_0085114_62_721 219
401 3300049824 Ga0501045_0001661 Ga0501045_0001661_6544_7203 219
402 3300049824 Ga0501045_0206468 Ga0501045_0206468_668_1327 219
403 3300049824 Ga0501045_0756822 Ga0501045_0756822_19_696 219
404 3300050507 nmdc:mga05p37_244567_c1 nmdc:mga05p37_244567_c1_481_1146 219
405 3300050507 nmdc:mga05p37_778051_c1 nmdc:mga05p37_778051_c1_350_1009 219
406 3300050512 nmdc:mga0n895_583994_c1 nmdc:mga0n895_583994_c1_165_830 219
407 3300050512 nmdc:mga0n895_615163_c1 nmdc:mga0n895_615163_c1_153_812 219
408 3300050513 nmdc:mga0rr50_242062_c1 nmdc:mga0rr50_242062_c1_706_1365 219
409 3300050513 nmdc:mga0rr50_798_c1 nmdc:mga0rr50_798_c1_72_731 219
410 3300050514 nmdc:mga08x19_71350_c1 nmdc:mga08x19_71350_c1_227_886 219
411 3300054114 Ga0501084_0002444 Ga0501084_0002444_5395_6054 219
412 3300060353 Ga0501082_0001816 Ga0501082_0001816_13354_14013 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

22

217

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9731 2 216
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9693 1 216
7u5y-assembly1.cif.gz_E crystal structure of ribulose-phosphate 3-epimerase from pseudomonas aeruginosa 0.9578 2 216
3inp-assembly1.cif.gz_A 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. 0.9577 1 215
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9575 1 212
ID Description Score Start End Superfamily
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9756 2 212 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9651 1 215 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9582 1 212 3.20.20.70
af_A0A1D6PJ99_41_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9577 1 205 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9525 1 212 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V6ZAQ5-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9907 34 213 GO:0004750
GO:0005975
GO:0006098
GO:0046872
AF-A0A1F7MZ59-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9894 1 174 GO:0004750
GO:0005975
GO:0006098
AF-A0A3D4QF45-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9886 47 213 GO:0005975
GO:0016857
AF-A0A382V2T8-F1-model_v4 ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9869 2 194 GO:0004750
GO:0005975
GO:0006098
AF-A0A3D1LYU3-F1-model_v4 deleted 0.9852 2 187

Feature Viewer

pLDDT pTM Quality
94.71 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map