F437814

General Info

Members Datasets Scaffolds Average Seq Length
412 193 410 337

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10416439|Ga0157376_104164391
Length 380
Sequence MQLTVGTSRKKRSNGSARALGFAVVGCGRAGERHAAQIGKFGRLLAACDVVPAAARSLSEAYNVDGFHCYEEMLKAVKGNVDVIAVCTPNGLHCEHSIKAFEAGFHVICEKPMALTIHDCGDMIKAAERANRRLFVVKQNRYNPPVAHLKKLIDTGILGRIFTVHLNCYWNRNEEYYRRSWKGTRDMDGGTLYTQFSHFIDLLYWLVGDVKEVMAFTDNYCHKSSIEFEDAGVAILRFYTGAIGSVNFTINSYQKNMEGSLTLFCENGTIKIGGQYLNEIEYQHVKGIEQTKLEVGRPANEYGYYQGSMSNHEDVYNNVHKVLTADGAIVTIAYEGLKTVEIIDKIYAAARLTRANESRQHPRLTPNCYASTGRPQSLGR

Samples

Sample ID Description Type Environment
1 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
2 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
3 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
4 2914759650 Rhizosphaericola mali Isolate Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
122 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
123 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
127 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
128 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
180 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0
Rhizoplane 0
Rhizosphere 89.56
Stem 0
Stem Tuber 0
Unclassified 6.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000025 3300003320 Bacteria 71863
2 rootH2_10054339 3300003320 Bacteria 10059
3 rootH2_10076991 3300003320 Bacteria 8654
4 rootL2_10045720 3300003322 Bacteria 1578
5 rootL2_10254590 3300003322 Bacteria 2619
6 rootL2_10257508 3300003322 Unclassified 2941
7 rootL2_10273633 3300003322 Bacteria 2831
8 rootH1_10000940 3300003323 Bacteria 88997
9 rootH1_10007743 3300003316 Bacteria 6031
10 rootH1_10007743 3300003323 Bacteria 19767
11 rootH1_10012052 3300003316 Bacteria 7951
12 rootH1_10012052 3300003323 Bacteria 55556
13 rootH1_10228255 3300003323 Bacteria 2611
14 rootH1_10339790 3300003323 Bacteria 1607
15 Ga0065704_10086458 3300005289 Bacteria 3118
16 Ga0065704_10098741 3300005289 Bacteria 2341
17 Ga0065712_10078704 3300005290 Bacteria 3310
18 Ga0070676_10014631 3300005328 Bacteria 4316
19 Ga0070683_100003295 3300005329 Bacteria 13049
20 Ga0070683_100393582 3300005329 Bacteria 1321
21 Ga0070690_100024736 3300005330 Bacteria 3694
22 Ga0070670_100038016 3300005331 Bacteria 4139
23 Ga0070670_100065657 3300005331 Bacteria 3113
24 Ga0070670_100125137 3300005331 Bacteria 2219
25 Ga0070677_10032157 3300005333 Bacteria 2010
26 Ga0068869_100052098 3300005334 Bacteria 2971
27 Ga0070666_10000050 3300005335 Bacteria 100280
28 Ga0070666_10014478 3300005335 Bacteria 5024
29 Ga0070666_10015101 3300005335 Bacteria 4923
30 Ga0070666_10015863 3300005335 Unclassified 4813
31 Ga0070680_100008773 3300005336 Bacteria 7754
32 Ga0070680_100022805 3300005336 Unclassified 4987
33 Ga0070682_100000530 3300005337 Bacteria 23808
34 Ga0070682_100027419 3300005337 Unclassified 3418
35 Ga0068868_100004333 3300005338 Bacteria 9947
36 Ga0068868_100058558 3300005338 Bacteria 3045
37 Ga0068868_100063229 3300005338 Bacteria 2936
38 Ga0068868_100117513 3300005338 Bacteria 2166
39 Ga0070689_100038627 3300005340 Bacteria 3653
40 Ga0070687_100008693 3300005343 Unclassified 4312
41 Ga0070668_100000609 3300005347 Bacteria 23968
42 Ga0070668_100008373 3300005347 Bacteria 7681
43 Ga0070675_100035447 3300005354 Bacteria 4054
44 Ga0070671_100007972 3300005355 Bacteria 8472
45 Ga0070671_100225572 3300005355 Unclassified 1590
46 Ga0070674_100043217 3300005356 Unclassified 3064
47 Ga0070674_100405899 3300005356 Bacteria 1114
48 Ga0070673_100180376 3300005364 Bacteria 1807
49 Ga0070673_100244039 3300005364 Unclassified 1563
50 Ga0070667_100005272 3300005367 Bacteria 10814
51 Ga0070667_100008313 3300005367 Bacteria 8602
52 Ga0070711_100412006 3300005439 Bacteria 1099
53 Ga0070700_100115900 3300005441 Bacteria 1788
54 Ga0070678_100051103 3300005456 Bacteria 2994
55 Ga0070681_10003377 3300005458 Bacteria 14929
56 Ga0070681_10200033 3300005458 Bacteria 1916
57 Ga0068867_100067365 3300005459 Bacteria 2669
58 Ga0070698_100000434 3300005471 Bacteria 44513
59 Ga0070698_100005248 3300005471 Bacteria 14175
60 Ga0070679_100001311 3300005530 Bacteria 21935
61 Ga0070679_100004697 3300005530 Bacteria 12599
62 Ga0070684_100008889 3300005535 Bacteria 7881
63 Ga0068853_100159712 3300005539 Unclassified 2033
64 Ga0068853_100231599 3300005539 Bacteria 1690
65 Ga0068853_100267183 3300005539 Bacteria 1574
66 Ga0068853_100268579 3300005539 Bacteria 1570
67 Ga0068853_100324902 3300005539 Bacteria 1427
68 Ga0070672_100113101 3300005543 Bacteria 2215
69 Ga0070672_100278595 3300005543 Bacteria 1413
70 Ga0070693_100093298 3300005547 Bacteria 1819
71 Ga0070665_100000014 3300005548 Bacteria 484881
72 Ga0070665_100011201 3300005548 Bacteria 9067
73 Ga0070665_100216058 3300005548 Bacteria 1918
74 Ga0068855_100001688 3300005563 Bacteria 27642
75 Ga0068855_100003459 3300005563 Bacteria 19321
76 Ga0068855_100008672 3300005563 Bacteria 12288
77 Ga0068855_100021302 3300005563 Bacteria 7772
78 Ga0068855_100060090 3300005563 Unclassified 4446
79 Ga0068855_100237497 3300005563 Bacteria 2038
80 Ga0070664_100191296 3300005564 Bacteria 1823
81 Ga0068857_100037732 3300005577 Bacteria 4281
82 Ga0068857_100057094 3300005577 Bacteria 3465
83 Ga0068854_100077134 3300005578 Bacteria 2451
84 Ga0068854_100140429 3300005578 Bacteria 1853
85 Ga0068854_100151716 3300005578 Bacteria 1788
86 Ga0068856_100152273 3300005614 Bacteria 2322
87 Ga0070702_100006709 3300005615 Bacteria 5470
88 Ga0068852_100010990 3300005616 Bacteria 6790
89 Ga0068852_100021593 3300005616 Bacteria 5145
90 Ga0068852_100095213 3300005616 Bacteria 2673
91 Ga0068852_100574833 3300005616 Bacteria 1129
92 Ga0068859_100000025 3300005617 Bacteria 191679
93 Ga0068859_100104039 3300005617 Unclassified 2898
94 Ga0068859_100235180 3300005617 Bacteria 1921
95 Ga0068864_100003634 3300005618 Bacteria 12753
96 Ga0068864_100022043 3300005618 Bacteria 5339
97 Ga0068864_100068102 3300005618 Unclassified 3092
98 Ga0068861_100031464 3300005719 Unclassified 3899
99 Ga0068851_10008849 3300005834 Bacteria 4668
100 Ga0068851_10014501 3300005834 Bacteria 3743
101 Ga0068863_100004621 3300005841 Bacteria 13561
102 Ga0068863_100073971 3300005841 Bacteria 3223
103 Ga0068863_100122595 3300005841 Bacteria 2479
104 Ga0068863_100223010 3300005841 Bacteria 1817
105 Ga0068858_100002230 3300005842 Bacteria 19589
106 Ga0068858_100031891 3300005842 Bacteria 4897
107 Ga0068860_100005741 3300005843 Bacteria 12516
108 Ga0068860_100009926 3300005843 Bacteria 9437
109 Ga0068860_100020727 3300005843 Bacteria 6368
110 Ga0068860_100065652 3300005843 Bacteria 3446
111 Ga0081540_1007246 3300005983 Bacteria 7948
112 Ga0081539_10033353 3300005985 Bacteria 3137
113 Ga0075366_10052263 3300006195 Unclassified 2428
114 Ga0075366_10127494 3300006195 Bacteria 1535
115 Ga0097621_100006001 3300006237 Bacteria 8588
116 Ga0097621_100035851 3300006237 Bacteria 3965
117 Ga0097621_100075446 3300006237 Unclassified 2795
118 Ga0068871_100022451 3300006358 Bacteria 4864
119 Ga0068871_100197825 3300006358 Bacteria 1734
120 Ga0097620_100000025 3300006931 Bacteria 191679
121 Ga0097620_100104030 3300006931 Unclassified 2898
122 Ga0097620_100235178 3300006931 Bacteria 1921
123 Ga0105240_10000190 3300009093 Bacteria 125290
124 Ga0105240_10000198 3300009093 Bacteria 122388
125 Ga0105240_10000226 3300009093 Bacteria 112655
126 Ga0105240_10008582 3300009093 Bacteria 14603
127 Ga0105240_10009820 3300009093 Bacteria 13509
128 Ga0105240_10021172 3300009093 Bacteria 8656
129 Ga0105240_10030921 3300009093 Bacteria 6953
130 Ga0105240_10035557 3300009093 Bacteria 6418
131 Ga0111539_10121700 3300009094 Bacteria 3057
132 Ga0111539_10137863 3300009094 Unclassified 2857
133 Ga0105247_10009781 3300009101 Bacteria 5811
134 Ga0105241_10000137 3300009174 Bacteria 52153
135 Ga0105241_10005503 3300009174 Bacteria 9367
136 Ga0105241_10032788 3300009174 Unclassified 3897
137 Ga0105242_10000158 3300009176 Bacteria 50486
138 Ga0105242_10004271 3300009176 Bacteria 11141
139 Ga0105237_10000577 3300009545 Bacteria 51264
140 Ga0105237_10000781 3300009545 Bacteria 43601
141 Ga0105237_10001142 3300009545 Bacteria 35679
142 Ga0105237_10001894 3300009545 Bacteria 26706
143 Ga0105237_10003571 3300009545 Bacteria 18415
144 Ga0105237_10010083 3300009545 Bacteria 10077
145 Ga0105237_10048693 3300009545 Bacteria 4259
146 Ga0105237_10215683 3300009545 Bacteria 1919
147 Ga0105237_10388297 3300009545 Bacteria 1401
148 Ga0105238_10002115 3300009551 Bacteria 20057
149 Ga0105238_10049051 3300009551 Bacteria 4254
150 Ga0105238_10126900 3300009551 Bacteria 2529
151 Ga0105238_10269405 3300009551 Bacteria 1683
152 Ga0105238_10351855 3300009551 Unclassified 1462
153 Ga0105249_10024616 3300009553 Bacteria 5411
154 Ga0105249_10036184 3300009553 Bacteria 4479
155 Ga0105239_10000019 3300010375 Bacteria 273836
156 Ga0105239_10000659 3300010375 Bacteria 49123
157 Ga0105239_10002556 3300010375 Bacteria 23076
158 Ga0105239_10004869 3300010375 Bacteria 15891
159 Ga0105239_10006826 3300010375 Bacteria 13167
160 Ga0105239_10122843 3300010375 Bacteria 2885
161 Ga0105246_10000236 3300011119 Bacteria 28442
162 Ga0105246_10375646 3300011119 Bacteria 1173
163 Ga0157373_10000387 3300013100 Bacteria 35264
164 Ga0157371_10000970 3300013102 Bacteria 31856
165 Ga0157371_10103693 3300013102 Bacteria 2018
166 Ga0157370_10002540 3300013104 Bacteria 21935
167 Ga0157370_10005587 3300013104 Bacteria 14084
168 Ga0157370_10014608 3300013104 Bacteria 8024
169 Ga0157370_10051900 3300013104 Unclassified 3916
170 Ga0157370_10096477 3300013104 Unclassified 2774
171 Ga0157370_10136595 3300013104 Bacteria 2285
172 Ga0157370_10226446 3300013104 Bacteria 1731
173 Ga0157369_10039844 3300013105 Bacteria 5133
174 Ga0157369_10153750 3300013105 Bacteria 2431
175 Ga0157374_10000002 3300013296 Bacteria 1054226
176 Ga0157374_10000929 3300013296 Bacteria 25481
177 Ga0157374_10001648 3300013296 Bacteria 18694
178 Ga0157374_10096695 3300013296 Bacteria 2825
179 Ga0157374_10196165 3300013296 Bacteria 1976
180 Ga0157378_10000370 3300013297 Bacteria 44420
181 Ga0157378_10006898 3300013297 Bacteria 9912
182 Ga0157378_10152096 3300013297 Unclassified 2157
183 Ga0157378_10176062 3300013297 Bacteria 2009
184 Ga0163162_10000151 3300013306 Bacteria 64454
185 Ga0163162_10000427 3300013306 Bacteria 38811
186 Ga0163162_10002883 3300013306 Bacteria 16376
187 Ga0163162_10003022 3300013306 Bacteria 16075
188 Ga0163162_10195199 3300013306 Bacteria 2153
189 Ga0163162_10242894 3300013306 Bacteria 1932
190 Ga0157372_10003107 3300013307 Bacteria 17895
191 Ga0157372_10008163 3300013307 Bacteria 11127
192 Ga0157372_10053912 3300013307 Bacteria 4484
193 Ga0157372_10159637 3300013307 Bacteria 2605
194 Ga0157372_10173026 3300013307 Bacteria 2498
195 Ga0157375_10002078 3300013308 Bacteria 17319
196 Ga0157375_10003683 3300013308 Bacteria 13305
197 Ga0157375_10491315 3300013308 Bacteria 1392
198 Ga0163163_10003995 3300014325 Bacteria 12584
199 Ga0157380_10000672 3300014326 Bacteria 21179
200 Ga0157380_10072222 3300014326 Unclassified 2794
201 Ga0157380_10122441 3300014326 Bacteria 2205
202 Ga0157380_10262914 3300014326 Bacteria 1568
203 Ga0157379_10013001 3300014968 Bacteria 7285
204 Ga0157379_10079542 3300014968 Bacteria 2935
205 Ga0157376_10002256 3300014969 Bacteria 13003
206 Ga0157376_10003050 3300014969 Bacteria 11476
207 Ga0157376_10005761 3300014969 Bacteria 8679
208 Ga0157376_10020462 3300014969 Bacteria 5118
209 Ga0157376_10024973 3300014969 Bacteria 4701
210 Ga0157376_10143292 3300014969 Bacteria 2146
211 Ga0157376_10416439 3300014969 Bacteria 1303
212 Ga0209646_1000367 3300025246 Bacteria 29985
213 Ga0207656_10110498 3300025321 Bacteria 1270
214 Ga0207682_10125342 3300025893 Bacteria 1143
215 Ga0207710_10008562 3300025900 Unclassified 4312
216 Ga0207680_10000032 3300025903 Bacteria 77485
217 Ga0207680_10009253 3300025903 Bacteria 4876
218 Ga0207680_10011664 3300025903 Unclassified 4449
219 Ga0207680_10017386 3300025903 Bacteria 3799
220 Ga0207680_10182283 3300025903 Bacteria 1421
221 Ga0207647_10000631 3300025904 Bacteria 27434
222 Ga0207647_10113996 3300025904 Bacteria 1597
223 Ga0207645_10097888 3300025907 Bacteria 1891
224 Ga0207654_10000335 3300025911 Bacteria 28259
225 Ga0207654_10002471 3300025911 Bacteria 9396
226 Ga0207654_10089316 3300025911 Unclassified 1874
227 Ga0207707_10001581 3300025912 Bacteria 20970
228 Ga0207707_10007428 3300025912 Bacteria 9548
229 Ga0207695_10000212 3300025913 Bacteria 156450
230 Ga0207695_10000276 3300025913 Bacteria 128924
231 Ga0207695_10000313 3300025913 Bacteria 117072
232 Ga0207695_10000346 3300025913 Bacteria 107028
233 Ga0207695_10013567 3300025913 Bacteria 9705
234 Ga0207695_10026317 3300025913 Bacteria 6494
235 Ga0207695_10046967 3300025913 Bacteria 4573
236 Ga0207695_10054993 3300025913 Bacteria 4151
237 Ga0207671_10000802 3300025914 Bacteria 39861
238 Ga0207671_10001020 3300025914 Bacteria 34167
239 Ga0207671_10001317 3300025914 Bacteria 29052
240 Ga0207671_10001415 3300025914 Bacteria 27869
241 Ga0207671_10058186 3300025914 Bacteria 2865
242 Ga0207671_10134987 3300025914 Bacteria 1896
243 Ga0207660_10009000 3300025917 Bacteria 6461
244 Ga0207660_10060626 3300025917 Bacteria 2721
245 Ga0207662_10006991 3300025918 Bacteria 6127
246 Ga0207652_10000563 3300025921 Bacteria 37468
247 Ga0207652_10010117 3300025921 Bacteria 7598
248 Ga0207694_10043476 3300025924 Bacteria 3468
249 Ga0207694_10059125 3300025924 Bacteria 2982
250 Ga0207694_10301225 3300025924 Unclassified 1320
251 Ga0207650_10036796 3300025925 Bacteria 3562
252 Ga0207650_10049831 3300025925 Bacteria 3094
253 Ga0207650_10067211 3300025925 Bacteria 2690
254 Ga0207650_10316662 3300025925 Bacteria 1277
255 Ga0207686_10000611 3300025934 Bacteria 22256
256 Ga0207686_10243414 3300025934 Bacteria 1310
257 Ga0207669_10034928 3300025937 Unclassified 2855
258 Ga0207669_10190662 3300025937 Bacteria 1478
259 Ga0207704_10142736 3300025938 Bacteria 1678
260 Ga0207691_10014273 3300025940 Bacteria 7577
261 Ga0207691_10229543 3300025940 Bacteria 1608
262 Ga0207689_10002782 3300025942 Bacteria 16167
263 Ga0207661_10006750 3300025944 Bacteria 8126
264 Ga0207667_10000908 3300025949 Bacteria 37716
265 Ga0207667_10001585 3300025949 Bacteria 28607
266 Ga0207667_10021547 3300025949 Bacteria 7140
267 Ga0207667_10051307 3300025949 Unclassified 4350
268 Ga0207667_10088789 3300025949 Bacteria 3196
269 Ga0207651_10046582 3300025960 Bacteria 2917
270 Ga0207651_10182164 3300025960 Bacteria 1667
271 Ga0207651_10319926 3300025960 Bacteria 1297
272 Ga0207640_10137990 3300025981 Bacteria 1773
273 Ga0207658_10006644 3300025986 Bacteria 7879
274 Ga0207658_10006692 3300025986 Bacteria 7856
275 Ga0207677_10041685 3300026023 Bacteria 3038
276 Ga0207677_10172082 3300026023 Bacteria 1694
277 Ga0207639_10026229 3300026041 Bacteria 4234
278 Ga0207639_10199520 3300026041 Bacteria 1715
279 Ga0207639_10225270 3300026041 Bacteria 1622
280 Ga0207708_10103487 3300026075 Bacteria 2206
281 Ga0207702_10319772 3300026078 Bacteria 1478
282 Ga0207641_10009452 3300026088 Bacteria 8033
283 Ga0207641_10017328 3300026088 Bacteria 5895
284 Ga0207676_10012807 3300026095 Bacteria 6019
285 Ga0207676_10022940 3300026095 Bacteria 4596
286 Ga0207676_10421533 3300026095 Unclassified 1252
287 Ga0207674_10116292 3300026116 Bacteria 2646
288 Ga0207674_10202984 3300026116 Bacteria 1932
289 Ga0207675_100006353 3300026118 Bacteria 11203
290 Ga0207683_10041344 3300026121 Bacteria 4025
291 Ga0207698_10084827 3300026142 Bacteria 2569
292 Ga0207698_10086022 3300026142 Unclassified 2555
293 Ga0207698_10101924 3300026142 Bacteria 2382
294 Ga0207698_10102657 3300026142 Bacteria 2374
295 Ga0207698_10194468 3300026142 Bacteria 1810
296 Ga0268266_10000068 3300028379 Bacteria 241100
297 Ga0268266_10307881 3300028379 Bacteria 1479
298 Ga0268264_10006998 3300028381 Bacteria 9465
299 Ga0268264_10018924 3300028381 Bacteria 5630
300 Ga0268264_10027102 3300028381 Bacteria 4681
301 Ga0268264_10036863 3300028381 Bacteria 4029
302 Ga0268264_10049724 3300028381 Bacteria 3489
303 Ga0265337_1003096 3300028556 Bacteria 7333
304 Ga0265326_10002482 3300028558 Bacteria 6214
305 Ga0265319_1000252 3300028563 Bacteria 40367
306 Ga0265319_1000930 3300028563 Bacteria 18326
307 Ga0265334_10000517 3300028573 Bacteria 19766
308 Ga0265334_10046155 3300028573 Unclassified 1685
309 Ga0265318_10003486 3300028577 Bacteria 7888
310 Ga0265323_10000192 3300028653 Bacteria 36786
311 Ga0265322_10002280 3300028654 Bacteria 5942
312 Ga0265336_10000411 3300028666 Bacteria 26555
313 Ga0307515_10000162 3300028794 Bacteria 163720
314 Ga0307515_10001093 3300028794 Bacteria 62142
315 Ga0307515_10153342 3300028794 Bacteria 2395
316 Ga0265338_10000260 3300028800 Bacteria 96243
317 Ga0265338_10000922 3300028800 Bacteria 49568
318 Ga0265324_10002269 3300029957 Bacteria 10021
319 Ga0265324_10003500 3300029957 Bacteria 7426
320 Ga0265324_10026661 3300029957 Bacteria 2045
321 Ga0265330_10000665 3300031235 Bacteria 22036
322 Ga0265332_10063681 3300031238 Bacteria 1575
323 Ga0265320_10000505 3300031240 Bacteria 30391
324 Ga0265320_10053111 3300031240 Unclassified 1959
325 Ga0265325_10010865 3300031241 Bacteria 5248
326 Ga0265329_10002178 3300031242 Bacteria 9065
327 Ga0265340_10019617 3300031247 Bacteria 3481
328 Ga0265340_10075389 3300031247 Bacteria 1594
329 Ga0265339_10001647 3300031249 Bacteria 16468
330 Ga0265331_10019305 3300031250 Unclassified 3521
331 Ga0265327_10000199 3300031251 Bacteria 125838
332 Ga0265327_10000837 3300031251 Bacteria 45956
333 Ga0265327_10017287 3300031251 Unclassified 4535
334 Ga0265316_10006453 3300031344 Bacteria 11206
335 Ga0265316_10073800 3300031344 Unclassified 2627
336 Ga0307509_10056165 3300031507 Unclassified 4180
337 Ga0307509_10109617 3300031507 Bacteria 2769
338 Ga0265313_10002625 3300031595 Bacteria 15290
339 Ga0265313_10041664 3300031595 Bacteria 2260
340 Ga0307508_10002524 3300031616 Bacteria 19290
341 Ga0265314_10000775 3300031711 Bacteria 37934
342 Ga0265314_10151765 3300031711 Unclassified 1420
343 Ga0265342_10000939 3300031712 Bacteria 28992
344 Ga0265342_10008673 3300031712 Bacteria 7258
345 Ga0307414_10091605 3300032004 Bacteria 2260
346 Ga0307507_10140382 3300033179 Bacteria 1854
347 Ga0307510_10000152 3300033180 Bacteria 57328
348 Ga0373960_0009589 3300035121 Bacteria 2349
349 Ga0373947_0098165 3300035725 Bacteria 1837
350 Ga0395899_0002461 3300037312 Bacteria 15037
351 Ga0395899_0010393 3300037312 Bacteria 7132
352 Ga0395900_0005475 3300037418 Bacteria 13292
353 Ga0395900_0010294 3300037418 Bacteria 9568
354 Ga0395898_0004370 3300037466 Bacteria 15465
355 Ga0395905_0001963 3300037471 Bacteria 23525
356 Ga0395901_0003584 3300038443 Bacteria 15660
357 Ga0395901_0010497 3300038443 Bacteria 9382
358 Ga0400483_189893 3300039062 Bacteria 1568
359 Ga0451577_0024290 3300042876 Bacteria 5515
360 Ga0466969_0000398 3300044656 Bacteria 23847
361 Ga0466972_0000047 3300044658 Bacteria 122901
362 Ga0466972_0003993 3300044658 Bacteria 7349
363 Ga0453683_0000115 3300044673 Bacteria 118577
364 Ga0466966_0000047 3300044684 Bacteria 91962
365 Ga0466966_0084139 3300044684 Bacteria 1979
366 Ga0453684_0119049 3300044712 Bacteria 3192
367 Ga0453684_0232790 3300044712 Bacteria 2126
368 Ga0466968_0006102 3300044735 Bacteria 4526
369 Ga0466968_0037752 3300044735 Unclassified 2028
370 Ga0466970_0162800 3300044765 Unclassified 1234
371 Ga0466957_0018760 3300044842 Bacteria 4064
372 Ga0466959_0000065 3300045049 Bacteria 73931
373 Ga0466959_0050600 3300045049 Bacteria 3050
374 Ga0451576_0000308 3300045051 Bacteria 118556
375 Ga0451576_0001155 3300045051 Bacteria 47648
376 Ga0451576_0008532 3300045051 Bacteria 12015
377 Ga0495664_0108805 3300046477 Bacteria 1672
378 Ga0495606_0006426 3300046507 Bacteria 10844
379 Ga0495668_0001368 3300046616 Bacteria 23908
380 Ga0495668_0009204 3300046616 Bacteria 6077
381 Ga0495611_0000026 3300046648 Bacteria 118428
382 Ga0495649_0028845 3300046694 Bacteria 3076
383 Ga0495687_004762 3300047443 Bacteria 8965
384 Ga0495686_0000005 3300047472 Bacteria 827143
385 Ga0501290_004786 3300049513 Bacteria 1690
386 Ga0501047_0013098 3300049581 Bacteria 7854
387 Ga0501047_0305241 3300049581 Bacteria 1433
388 Ga0501077_0074983 3300049593 Unclassified 2142
389 Ga0501257_010609 3300049686 Bacteria 2095
390 Ga0501219_000861 3300049703 Bacteria 3825
391 Ga0501044_0003509 3300049823 Bacteria 17650
392 Ga0501284_00023 3300050005 Bacteria 78607
393 nmdc:mga0k408_118486_c1 3300050493 Bacteria 1567
394 nmdc:mga0k408_49682_c1 3300050493 Unclassified 2428
395 nmdc:mga08y16_118761_c1 3300050511 Bacteria 2752
396 Ga0500578_0000060 3300053086 Bacteria 118274
397 Ga0500578_0023317 3300053086 Bacteria 3974
398 Ga0500646_0000534 3300053090 Bacteria 11120
399 Ga0500646_0001087 3300053090 Bacteria 7392
400 Ga0500583_0000003 3300053092 Bacteria 229587
401 Ga0500583_0009804 3300053092 Bacteria 3522
402 Ga0500592_002599 3300053116 Bacteria 2899
403 Ga0500568_0005601 3300053139 Bacteria 6466
404 Ga0500588_0001898 3300053146 Unclassified 4102
405 Ga0500604_0004831 3300053151 Unclassified 3572
406 Ga0500622_0000113 3300053156 Bacteria 83196
407 Ga0500622_0000133 3300053156 Bacteria 78532
408 Ga0500622_0002797 3300053156 Bacteria 12259
409 Ga0500622_0094240 3300053156 Bacteria 1482
410 Ga0501082_0084620 3300060353 Unclassified 2735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0162800 Ga0466970_0162800_382_1224 280
2 3300005834 Ga0068851_10008849 Ga0068851_100088493 307
3 3300026142 Ga0207698_10194468 Ga0207698_101944682 307
4 3300053090 Ga0500646_0001087 Ga0500646_0001087_5836_6912 309
5 3300049581 Ga0501047_0305241 Ga0501047_0305241_488_1420 310
6 3300005335 Ga0070666_10015863 Ga0070666_100158634 315
7 3300005539 Ga0068853_100159712 Ga0068853_1001597122 315
8 3300025903 Ga0207680_10011664 Ga0207680_100116642 315
9 3300044656 Ga0466969_0000398 Ga0466969_0000398_5942_6952 316
10 3300044684 Ga0466966_0000047 Ga0466966_0000047_17334_18344 316
11 3300045049 Ga0466959_0000065 Ga0466959_0000065_8408_9418 316
12 3300053092 Ga0500583_0009804 Ga0500583_0009804_589_1587 317
13 3300053156 Ga0500622_0002797 Ga0500622_0002797_4817_5815 317
14 3300025960 Ga0207651_10182164 Ga0207651_101821642 318
15 3300049513 Ga0501290_004786 Ga0501290_004786_33_1007 321
16 iso_pu_bacteria 2914759650 2914763275 325
17 3300009093 Ga0105240_10000190 Ga0105240_1000019036 326
18 3300025913 Ga0207695_10000276 Ga0207695_1000027667 326
19 3300046507 Ga0495606_0006426 Ga0495606_0006426_838_1920 326
20 3300005337 Ga0070682_100000530 Ga0070682_10000053011 329
21 3300003322 rootL2_10045720 rootL2_100457202 330
22 3300006195 Ga0075366_10127494 Ga0075366_101274941 330
23 3300009545 Ga0105237_10010083 Ga0105237_100100833 330
24 3300010375 Ga0105239_10004869 Ga0105239_1000486916 330
25 3300025904 Ga0207647_10113996 Ga0207647_101139962 330
26 3300050493 nmdc:mga0k408_118486_c1 nmdc:mga0k408_118486_c1_68_1075 330
27 3300005616 Ga0068852_100574833 Ga0068852_1005748331 331
28 3300029957 Ga0265324_10026661 Ga0265324_100266612 331
29 iso_pu_bacteria 2739367866 2740033246 331
30 3300005543 Ga0070672_100278595 Ga0070672_1002785951 332
31 3300005548 Ga0070665_100000014 Ga0070665_100000014355 332
32 3300013308 Ga0157375_10491315 Ga0157375_104913151 332
33 3300025940 Ga0207691_10229543 Ga0207691_102295432 332
34 3300028379 Ga0268266_10000068 Ga0268266_1000006880 332
35 3300031251 Ga0265327_10017287 Ga0265327_100172875 332
36 3300033180 Ga0307510_10000152 Ga0307510_1000015245 332
37 3300044658 Ga0466972_0003993 Ga0466972_0003993_1843_2889 332
38 3300044735 Ga0466968_0006102 Ga0466968_0006102_2010_3056 332
39 3300047443 Ga0495687_004762 Ga0495687_004762_5957_6955 332
40 3300053139 Ga0500568_0005601 Ga0500568_0005601_2077_3075 332
41 3300003322 rootL2_10254590 rootL2_102545903 333
42 3300003323 rootH1_10012052 rootH1_1001205223 333
43 3300005289 Ga0065704_10098741 Ga0065704_100987412 333
44 3300005331 Ga0070670_100038016 Ga0070670_1000380162 333
45 3300005331 Ga0070670_100065657 Ga0070670_1000656573 333
46 3300005331 Ga0070670_100125137 Ga0070670_1001251372 333
47 3300005335 Ga0070666_10000050 Ga0070666_1000005055 333
48 3300005539 Ga0068853_100268579 Ga0068853_1002685791 333
49 3300005563 Ga0068855_100001688 Ga0068855_10000168825 333
50 3300005616 Ga0068852_100095213 Ga0068852_1000952132 333
51 3300005617 Ga0068859_100000025 Ga0068859_100000025116 333
52 3300005618 Ga0068864_100003634 Ga0068864_1000036348 333
53 3300005719 Ga0068861_100031464 Ga0068861_1000314643 333
54 3300005834 Ga0068851_10014501 Ga0068851_100145013 333
55 3300005841 Ga0068863_100122595 Ga0068863_1001225952 333
56 3300005842 Ga0068858_100002230 Ga0068858_10000223018 333
57 3300005843 Ga0068860_100005741 Ga0068860_10000574111 333
58 3300006931 Ga0097620_100000025 Ga0097620_100000025116 333
59 3300009093 Ga0105240_10000226 Ga0105240_1000022639 333
60 3300009101 Ga0105247_10009781 Ga0105247_100097812 333
61 3300009174 Ga0105241_10005503 Ga0105241_100055038 333
62 3300009545 Ga0105237_10048693 Ga0105237_100486935 333
63 3300009551 Ga0105238_10126900 Ga0105238_101269003 333
64 3300009553 Ga0105249_10024616 Ga0105249_100246162 333
65 3300010375 Ga0105239_10000659 Ga0105239_100006595 333
66 3300011119 Ga0105246_10000236 Ga0105246_1000023611 333
67 3300013102 Ga0157371_10000970 Ga0157371_100009709 333
68 3300013104 Ga0157370_10005587 Ga0157370_1000558710 333
69 3300013104 Ga0157370_10096477 Ga0157370_100964772 333
70 3300013105 Ga0157369_10153750 Ga0157369_101537502 333
71 3300013296 Ga0157374_10000002 Ga0157374_10000002856 333
72 3300013306 Ga0163162_10000427 Ga0163162_1000042729 333
73 3300013307 Ga0157372_10173026 Ga0157372_101730262 333
74 3300014326 Ga0157380_10122441 Ga0157380_101224413 333
75 3300014968 Ga0157379_10079542 Ga0157379_100795422 333
76 3300014969 Ga0157376_10024973 Ga0157376_100249732 333
77 3300014969 Ga0157376_10143292 Ga0157376_101432922 333
78 3300025321 Ga0207656_10110498 Ga0207656_101104981 333
79 3300025900 Ga0207710_10008562 Ga0207710_100085625 333
80 3300025903 Ga0207680_10000032 Ga0207680_1000003251 333
81 3300025904 Ga0207647_10000631 Ga0207647_1000063112 333
82 3300025911 Ga0207654_10002471 Ga0207654_100024714 333
83 3300025913 Ga0207695_10000313 Ga0207695_1000031360 333
84 3300025913 Ga0207695_10026317 Ga0207695_100263172 333
85 3300025925 Ga0207650_10036796 Ga0207650_100367963 333
86 3300025942 Ga0207689_10002782 Ga0207689_100027822 333
87 3300025949 Ga0207667_10000908 Ga0207667_1000090812 333
88 3300025960 Ga0207651_10319926 Ga0207651_103199261 333
89 3300026023 Ga0207677_10172082 Ga0207677_101720822 333
90 3300026041 Ga0207639_10026229 Ga0207639_100262292 333
91 3300026041 Ga0207639_10199520 Ga0207639_101995202 333
92 3300026088 Ga0207641_10009452 Ga0207641_100094524 333
93 3300026095 Ga0207676_10012807 Ga0207676_100128076 333
94 3300026118 Ga0207675_100006353 Ga0207675_10000635310 333
95 3300026142 Ga0207698_10102657 Ga0207698_101026571 333
96 3300028381 Ga0268264_10027102 Ga0268264_100271021 333
97 3300028794 Ga0307515_10000162 Ga0307515_1000016277 333
98 3300042876 Ga0451577_0024290 Ga0451577_0024290_4152_5165 333
99 3300046616 Ga0495668_0001368 Ga0495668_0001368_15910_16914 333
100 3300046616 Ga0495668_0009204 Ga0495668_0009204_1872_2885 333
101 3300049703 Ga0501219_000861 Ga0501219_000861_39_1121 333
102 3300050005 Ga0501284_00023 Ga0501284_00023_2925_4007 333
103 3300053090 Ga0500646_0000534 Ga0500646_0000534_4791_5795 333
104 iso_pu_bacteria 2840677318 2840678433 333
105 iso_pu_bacteria 2896085136 2896086250 333
106 3300003320 rootH2_10076991 rootH2_100769914 334
107 3300003322 rootL2_10273633 rootL2_102736332 334
108 3300003323 rootH1_10228255 rootH1_102282552 334
109 3300003323 rootH1_10339790 rootH1_103397902 334
110 3300005289 Ga0065704_10086458 Ga0065704_100864583 334
111 3300005290 Ga0065712_10078704 Ga0065712_100787043 334
112 3300005329 Ga0070683_100393582 Ga0070683_1003935822 334
113 3300005334 Ga0068869_100052098 Ga0068869_1000520982 334
114 3300005340 Ga0070689_100038627 Ga0070689_1000386273 334
115 3300005354 Ga0070675_100035447 Ga0070675_1000354473 334
116 3300005364 Ga0070673_100244039 Ga0070673_1002440391 334
117 3300005471 Ga0070698_100000434 Ga0070698_1000004348 334
118 3300005471 Ga0070698_100005248 Ga0070698_10000524812 334
119 3300005617 Ga0068859_100104039 Ga0068859_1001040393 334
120 3300005617 Ga0068859_100235180 Ga0068859_1002351803 334
121 3300005618 Ga0068864_100022043 Ga0068864_1000220435 334
122 3300005618 Ga0068864_100068102 Ga0068864_1000681024 334
123 3300005841 Ga0068863_100073971 Ga0068863_1000739712 334
124 3300005843 Ga0068860_100065652 Ga0068860_1000656523 334
125 3300005985 Ga0081539_10033353 Ga0081539_100333532 334
126 3300006237 Ga0097621_100006001 Ga0097621_1000060019 334
127 3300006358 Ga0068871_100022451 Ga0068871_1000224515 334
128 3300006931 Ga0097620_100104030 Ga0097620_1001040303 334
129 3300006931 Ga0097620_100235178 Ga0097620_1002351782 334
130 3300009094 Ga0111539_10121700 Ga0111539_101217003 334
131 3300009176 Ga0105242_10000158 Ga0105242_1000015828 334
132 3300009176 Ga0105242_10004271 Ga0105242_1000427110 334
133 3300009545 Ga0105237_10001894 Ga0105237_1000189414 334
134 3300011119 Ga0105246_10375646 Ga0105246_103756461 334
135 3300013306 Ga0163162_10195199 Ga0163162_101951993 334
136 3300014326 Ga0157380_10072222 Ga0157380_100722222 334
137 3300014326 Ga0157380_10262914 Ga0157380_102629142 334
138 3300014969 Ga0157376_10005761 Ga0157376_1000576110 334
139 3300014969 Ga0157376_10416439 Ga0157376_104164391 334
140 3300025914 Ga0207671_10001020 Ga0207671_1000102022 334
141 3300025925 Ga0207650_10067211 Ga0207650_100672112 334
142 3300025934 Ga0207686_10000611 Ga0207686_1000061113 334
143 3300025934 Ga0207686_10243414 Ga0207686_102434142 334
144 3300025960 Ga0207651_10046582 Ga0207651_100465822 334
145 3300026088 Ga0207641_10017328 Ga0207641_100173288 334
146 3300026095 Ga0207676_10022940 Ga0207676_100229408 334
147 3300026116 Ga0207674_10202984 Ga0207674_102029842 334
148 3300028381 Ga0268264_10049724 Ga0268264_100497242 334
149 3300031247 Ga0265340_10075389 Ga0265340_100753892 334
150 3300031595 Ga0265313_10041664 Ga0265313_100416642 334
151 3300035121 Ga0373960_0009589 Ga0373960_0009589_57_1199 334
152 3300035725 Ga0373947_0098165 Ga0373947_0098165_591_1604 334
153 3300045051 Ga0451576_0008532 Ga0451576_0008532_8883_9899 334
154 3300046648 Ga0495611_0000026 Ga0495611_0000026_90523_91527 334
155 3300049593 Ga0501077_0074983 Ga0501077_0074983_903_1952 334
156 3300050511 nmdc:mga08y16_118761_c1 nmdc:mga08y16_118761_c1_1210_2214 334
157 3300053116 Ga0500592_002599 Ga0500592_002599_760_1764 334
158 3300053146 Ga0500588_0001898 Ga0500588_0001898_211_1218 334
159 3300060353 Ga0501082_0084620 Ga0501082_0084620_1047_2096 334
160 3300003323 rootH1_10007743 rootH1_1000774317 335
161 3300005338 Ga0068868_100063229 Ga0068868_1000632293 335
162 3300005439 Ga0070711_100412006 Ga0070711_1004120061 335
163 3300005563 Ga0068855_100003459 Ga0068855_10000345911 335
164 3300005563 Ga0068855_100008672 Ga0068855_10000867210 335
165 3300005577 Ga0068857_100037732 Ga0068857_1000377322 335
166 3300005616 Ga0068852_100010990 Ga0068852_1000109907 335
167 3300005843 Ga0068860_100020727 Ga0068860_1000207276 335
168 3300006237 Ga0097621_100075446 Ga0097621_1000754462 335
169 3300009093 Ga0105240_10008582 Ga0105240_100085824 335
170 3300009545 Ga0105237_10000577 Ga0105237_1000057728 335
171 3300009545 Ga0105237_10001142 Ga0105237_1000114218 335
172 3300009551 Ga0105238_10269405 Ga0105238_102694052 335
173 3300009551 Ga0105238_10351855 Ga0105238_103518552 335
174 3300010375 Ga0105239_10006826 Ga0105239_100068269 335
175 3300013105 Ga0157369_10039844 Ga0157369_100398445 335
176 3300013306 Ga0163162_10242894 Ga0163162_102428942 335
177 3300013307 Ga0157372_10003107 Ga0157372_1000310714 335
178 3300014969 Ga0157376_10020462 Ga0157376_100204621 335
179 3300025246 Ga0209646_1000367 Ga0209646_100036719 335
180 3300025903 Ga0207680_10182283 Ga0207680_101822832 335
181 3300025913 Ga0207695_10013567 Ga0207695_100135675 335
182 3300025914 Ga0207671_10001317 Ga0207671_1000131710 335
183 3300025924 Ga0207694_10301225 Ga0207694_103012252 335
184 3300025949 Ga0207667_10001585 Ga0207667_1000158520 335
185 3300026095 Ga0207676_10421533 Ga0207676_104215332 335
186 3300026116 Ga0207674_10116292 Ga0207674_101162922 335
187 3300026142 Ga0207698_10086022 Ga0207698_100860223 335
188 3300028381 Ga0268264_10018924 Ga0268264_100189246 335
189 3300028794 Ga0307515_10153342 Ga0307515_101533423 335
190 3300031251 Ga0265327_10000837 Ga0265327_1000083720 335
191 3300031616 Ga0307508_10002524 Ga0307508_1000252416 335
192 3300032004 Ga0307414_10091605 Ga0307414_100916052 335
193 3300038443 Ga0395901_0010497 Ga0395901_0010497_1847_2860 335
194 3300044658 Ga0466972_0000047 Ga0466972_0000047_91961_92971 335
195 3300044673 Ga0453683_0000115 Ga0453683_0000115_70227_71237 335
196 3300044684 Ga0466966_0084139 Ga0466966_0084139_140_1150 335
197 3300044712 Ga0453684_0119049 Ga0453684_0119049_2042_3052 335
198 3300045049 Ga0466959_0050600 Ga0466959_0050600_98_1108 335
199 3300045051 Ga0451576_0000308 Ga0451576_0000308_70227_71237 335
200 3300049581 Ga0501047_0013098 Ga0501047_0013098_4265_5272 335
201 3300049686 Ga0501257_010609 Ga0501257_010609_687_1703 335
202 3300049823 Ga0501044_0003509 Ga0501044_0003509_12017_13024 335
203 3300053156 Ga0500622_0000133 Ga0500622_0000133_35691_36731 335
204 3300003320 rootH2_10000025 rootH2_1000002548 336
205 3300003320 rootH2_10054339 rootH2_100543396 336
206 3300003322 rootL2_10257508 rootL2_102575083 336
207 3300003323 rootH1_10000940 rootH1_1000094051 336
208 3300005328 Ga0070676_10014631 Ga0070676_100146312 336
209 3300005329 Ga0070683_100003295 Ga0070683_1000032954 336
210 3300005330 Ga0070690_100024736 Ga0070690_1000247363 336
211 3300005333 Ga0070677_10032157 Ga0070677_100321572 336
212 3300005335 Ga0070666_10014478 Ga0070666_100144786 336
213 3300005335 Ga0070666_10015101 Ga0070666_100151015 336
214 3300005336 Ga0070680_100008773 Ga0070680_1000087734 336
215 3300005336 Ga0070680_100022805 Ga0070680_1000228055 336
216 3300005337 Ga0070682_100027419 Ga0070682_1000274192 336
217 3300005338 Ga0068868_100004333 Ga0068868_1000043339 336
218 3300005338 Ga0068868_100058558 Ga0068868_1000585583 336
219 3300005338 Ga0068868_100117513 Ga0068868_1001175132 336
220 3300005343 Ga0070687_100008693 Ga0070687_1000086932 336
221 3300005347 Ga0070668_100000609 Ga0070668_10000060911 336
222 3300005347 Ga0070668_100008373 Ga0070668_1000083734 336
223 3300005355 Ga0070671_100007972 Ga0070671_1000079726 336
224 3300005355 Ga0070671_100225572 Ga0070671_1002255722 336
225 3300005356 Ga0070674_100043217 Ga0070674_1000432173 336
226 3300005356 Ga0070674_100405899 Ga0070674_1004058991 336
227 3300005364 Ga0070673_100180376 Ga0070673_1001803762 336
228 3300005367 Ga0070667_100005272 Ga0070667_1000052729 336
229 3300005367 Ga0070667_100008313 Ga0070667_1000083134 336
230 3300005441 Ga0070700_100115900 Ga0070700_1001159002 336
231 3300005456 Ga0070678_100051103 Ga0070678_1000511032 336
232 3300005458 Ga0070681_10003377 Ga0070681_1000337713 336
233 3300005458 Ga0070681_10200033 Ga0070681_102000332 336
234 3300005459 Ga0068867_100067365 Ga0068867_1000673652 336
235 3300005530 Ga0070679_100001311 Ga0070679_10000131118 336
236 3300005530 Ga0070679_100004697 Ga0070679_1000046973 336
237 3300005535 Ga0070684_100008889 Ga0070684_1000088892 336
238 3300005539 Ga0068853_100231599 Ga0068853_1002315992 336
239 3300005539 Ga0068853_100267183 Ga0068853_1002671832 336
240 3300005539 Ga0068853_100324902 Ga0068853_1003249022 336
241 3300005543 Ga0070672_100113101 Ga0070672_1001131011 336
242 3300005547 Ga0070693_100093298 Ga0070693_1000932982 336
243 3300005548 Ga0070665_100011201 Ga0070665_1000112019 336
244 3300005548 Ga0070665_100216058 Ga0070665_1002160582 336
245 3300005563 Ga0068855_100021302 Ga0068855_1000213024 336
246 3300005563 Ga0068855_100060090 Ga0068855_1000600903 336
247 3300005563 Ga0068855_100237497 Ga0068855_1002374972 336
248 3300005564 Ga0070664_100191296 Ga0070664_1001912962 336
249 3300005577 Ga0068857_100057094 Ga0068857_1000570941 336
250 3300005578 Ga0068854_100077134 Ga0068854_1000771342 336
251 3300005578 Ga0068854_100140429 Ga0068854_1001404292 336
252 3300005578 Ga0068854_100151716 Ga0068854_1001517162 336
253 3300005614 Ga0068856_100152273 Ga0068856_1001522732 336
254 3300005615 Ga0070702_100006709 Ga0070702_1000067093 336
255 3300005616 Ga0068852_100021593 Ga0068852_1000215935 336
256 3300005841 Ga0068863_100004621 Ga0068863_10000462112 336
257 3300005841 Ga0068863_100223010 Ga0068863_1002230102 336
258 3300005842 Ga0068858_100031891 Ga0068858_1000318914 336
259 3300005843 Ga0068860_100009926 Ga0068860_1000099268 336
260 3300005983 Ga0081540_1007246 Ga0081540_10072464 336
261 3300006195 Ga0075366_10052263 Ga0075366_100522632 336
262 3300006237 Ga0097621_100035851 Ga0097621_1000358514 336
263 3300006358 Ga0068871_100197825 Ga0068871_1001978253 336
264 3300009093 Ga0105240_10000198 Ga0105240_1000019873 336
265 3300009093 Ga0105240_10009820 Ga0105240_100098206 336
266 3300009093 Ga0105240_10021172 Ga0105240_100211728 336
267 3300009093 Ga0105240_10030921 Ga0105240_100309215 336
268 3300009093 Ga0105240_10035557 Ga0105240_100355572 336
269 3300009094 Ga0111539_10137863 Ga0111539_101378633 336
270 3300009174 Ga0105241_10000137 Ga0105241_1000013726 336
271 3300009174 Ga0105241_10032788 Ga0105241_100327884 336
272 3300009545 Ga0105237_10000781 Ga0105237_1000078128 336
273 3300009545 Ga0105237_10003571 Ga0105237_1000357115 336
274 3300009545 Ga0105237_10215683 Ga0105237_102156832 336
275 3300009545 Ga0105237_10388297 Ga0105237_103882972 336
276 3300009551 Ga0105238_10002115 Ga0105238_100021152 336
277 3300009551 Ga0105238_10049051 Ga0105238_100490515 336
278 3300009553 Ga0105249_10036184 Ga0105249_100361843 336
279 3300010375 Ga0105239_10000019 Ga0105239_10000019187 336
280 3300010375 Ga0105239_10002556 Ga0105239_1000255612 336
281 3300010375 Ga0105239_10122843 Ga0105239_101228432 336
282 3300013100 Ga0157373_10000387 Ga0157373_1000038723 336
283 3300013102 Ga0157371_10103693 Ga0157371_101036932 336
284 3300013104 Ga0157370_10002540 Ga0157370_100025405 336
285 3300013104 Ga0157370_10014608 Ga0157370_100146082 336
286 3300013104 Ga0157370_10051900 Ga0157370_100519003 336
287 3300013104 Ga0157370_10136595 Ga0157370_101365952 336
288 3300013104 Ga0157370_10226446 Ga0157370_102264462 336
289 3300013296 Ga0157374_10000929 Ga0157374_100009297 336
290 3300013296 Ga0157374_10001648 Ga0157374_100016489 336
291 3300013296 Ga0157374_10096695 Ga0157374_100966952 336
292 3300013296 Ga0157374_10196165 Ga0157374_101961652 336
293 3300013297 Ga0157378_10000370 Ga0157378_1000037014 336
294 3300013297 Ga0157378_10006898 Ga0157378_100068987 336
295 3300013297 Ga0157378_10152096 Ga0157378_101520962 336
296 3300013297 Ga0157378_10176062 Ga0157378_101760622 336
297 3300013306 Ga0163162_10000151 Ga0163162_1000015131 336
298 3300013306 Ga0163162_10002883 Ga0163162_1000288310 336
299 3300013306 Ga0163162_10003022 Ga0163162_100030223 336
300 3300013307 Ga0157372_10008163 Ga0157372_100081633 336
301 3300013307 Ga0157372_10053912 Ga0157372_100539124 336
302 3300013307 Ga0157372_10159637 Ga0157372_101596373 336
303 3300013308 Ga0157375_10002078 Ga0157375_100020787 336
304 3300013308 Ga0157375_10003683 Ga0157375_100036839 336
305 3300014325 Ga0163163_10003995 Ga0163163_100039959 336
306 3300014326 Ga0157380_10000672 Ga0157380_1000067212 336
307 3300014968 Ga0157379_10013001 Ga0157379_100130013 336
308 3300014969 Ga0157376_10002256 Ga0157376_100022565 336
309 3300014969 Ga0157376_10003050 Ga0157376_100030505 336
310 3300025893 Ga0207682_10125342 Ga0207682_101253422 336
311 3300025903 Ga0207680_10009253 Ga0207680_100092536 336
312 3300025903 Ga0207680_10017386 Ga0207680_100173863 336
313 3300025907 Ga0207645_10097888 Ga0207645_100978882 336
314 3300025911 Ga0207654_10000335 Ga0207654_1000033515 336
315 3300025911 Ga0207654_10089316 Ga0207654_100893162 336
316 3300025912 Ga0207707_10001581 Ga0207707_1000158118 336
317 3300025912 Ga0207707_10007428 Ga0207707_100074284 336
318 3300025913 Ga0207695_10000212 Ga0207695_1000021262 336
319 3300025913 Ga0207695_10000346 Ga0207695_1000034671 336
320 3300025913 Ga0207695_10046967 Ga0207695_100469672 336
321 3300025913 Ga0207695_10054993 Ga0207695_100549935 336
322 3300025914 Ga0207671_10000802 Ga0207671_1000080226 336
323 3300025914 Ga0207671_10001415 Ga0207671_1000141514 336
324 3300025914 Ga0207671_10058186 Ga0207671_100581863 336
325 3300025914 Ga0207671_10134987 Ga0207671_101349872 336
326 3300025917 Ga0207660_10009000 Ga0207660_100090006 336
327 3300025917 Ga0207660_10060626 Ga0207660_100606263 336
328 3300025918 Ga0207662_10006991 Ga0207662_100069912 336
329 3300025921 Ga0207652_10000563 Ga0207652_1000056318 336
330 3300025921 Ga0207652_10010117 Ga0207652_100101178 336
331 3300025924 Ga0207694_10043476 Ga0207694_100434764 336
332 3300025924 Ga0207694_10059125 Ga0207694_100591252 336
333 3300025925 Ga0207650_10049831 Ga0207650_100498312 336
334 3300025925 Ga0207650_10316662 Ga0207650_103166622 336
335 3300025937 Ga0207669_10034928 Ga0207669_100349281 336
336 3300025937 Ga0207669_10190662 Ga0207669_101906622 336
337 3300025938 Ga0207704_10142736 Ga0207704_101427362 336
338 3300025940 Ga0207691_10014273 Ga0207691_100142731 336
339 3300025944 Ga0207661_10006750 Ga0207661_100067508 336
340 3300025949 Ga0207667_10021547 Ga0207667_100215475 336
341 3300025949 Ga0207667_10051307 Ga0207667_100513073 336
342 3300025949 Ga0207667_10088789 Ga0207667_100887892 336
343 3300025981 Ga0207640_10137990 Ga0207640_101379902 336
344 3300025986 Ga0207658_10006644 Ga0207658_100066445 336
345 3300025986 Ga0207658_10006692 Ga0207658_100066924 336
346 3300026023 Ga0207677_10041685 Ga0207677_100416852 336
347 3300026041 Ga0207639_10225270 Ga0207639_102252702 336
348 3300026075 Ga0207708_10103487 Ga0207708_101034871 336
349 3300026078 Ga0207702_10319772 Ga0207702_103197722 336
350 3300026121 Ga0207683_10041344 Ga0207683_100413444 336
351 3300026142 Ga0207698_10084827 Ga0207698_100848272 336
352 3300026142 Ga0207698_10101924 Ga0207698_101019242 336
353 3300028379 Ga0268266_10307881 Ga0268266_103078812 336
354 3300028381 Ga0268264_10006998 Ga0268264_100069984 336
355 3300028381 Ga0268264_10036863 Ga0268264_100368634 336
356 3300028556 Ga0265337_1003096 Ga0265337_10030964 336
357 3300028558 Ga0265326_10002482 Ga0265326_100024824 336
358 3300028563 Ga0265319_1000252 Ga0265319_100025223 336
359 3300028563 Ga0265319_1000930 Ga0265319_100093013 336
360 3300028573 Ga0265334_10000517 Ga0265334_1000051712 336
361 3300028573 Ga0265334_10046155 Ga0265334_100461551 336
362 3300028577 Ga0265318_10003486 Ga0265318_100034863 336
363 3300028653 Ga0265323_10000192 Ga0265323_1000019231 336
364 3300028654 Ga0265322_10002280 Ga0265322_100022802 336
365 3300028666 Ga0265336_10000411 Ga0265336_1000041127 336
366 3300028794 Ga0307515_10001093 Ga0307515_1000109336 336
367 3300028800 Ga0265338_10000260 Ga0265338_1000026056 336
368 3300028800 Ga0265338_10000922 Ga0265338_1000092231 336
369 3300029957 Ga0265324_10002269 Ga0265324_100022693 336
370 3300029957 Ga0265324_10003500 Ga0265324_100035005 336
371 3300031235 Ga0265330_10000665 Ga0265330_1000066519 336
372 3300031238 Ga0265332_10063681 Ga0265332_100636811 336
373 3300031240 Ga0265320_10000505 Ga0265320_1000050518 336
374 3300031240 Ga0265320_10053111 Ga0265320_100531112 336
375 3300031241 Ga0265325_10010865 Ga0265325_100108652 336
376 3300031242 Ga0265329_10002178 Ga0265329_100021786 336
377 3300031247 Ga0265340_10019617 Ga0265340_100196174 336
378 3300031249 Ga0265339_10001647 Ga0265339_100016471 336
379 3300031250 Ga0265331_10019305 Ga0265331_100193052 336
380 3300031251 Ga0265327_10000199 Ga0265327_1000019914 336
381 3300031344 Ga0265316_10006453 Ga0265316_100064536 336
382 3300031344 Ga0265316_10073800 Ga0265316_100738002 336
383 3300031507 Ga0307509_10056165 Ga0307509_100561653 336
384 3300031507 Ga0307509_10109617 Ga0307509_101096173 336
385 3300031595 Ga0265313_10002625 Ga0265313_100026259 336
386 3300031711 Ga0265314_10000775 Ga0265314_1000077512 336
387 3300031711 Ga0265314_10151765 Ga0265314_101517651 336
388 3300031712 Ga0265342_10000939 Ga0265342_100009393 336
389 3300031712 Ga0265342_10008673 Ga0265342_100086734 336
390 3300033179 Ga0307507_10140382 Ga0307507_101403822 336
391 3300037312 Ga0395899_0002461 Ga0395899_0002461_7852_8907 336
392 3300037312 Ga0395899_0010393 Ga0395899_0010393_1608_2624 336
393 3300037418 Ga0395900_0005475 Ga0395900_0005475_1393_2409 336
394 3300037418 Ga0395900_0010294 Ga0395900_0010294_6337_7392 336
395 3300037466 Ga0395898_0004370 Ga0395898_0004370_6458_7513 336
396 3300037471 Ga0395905_0001963 Ga0395905_0001963_17032_18048 336
397 3300038443 Ga0395901_0003584 Ga0395901_0003584_13208_14224 336
398 3300039062 Ga0400483_189893 Ga0400483_189893_362_1393 336
399 3300044712 Ga0453684_0232790 Ga0453684_0232790_686_1705 336
400 3300044735 Ga0466968_0037752 Ga0466968_0037752_53_1063 336
401 3300044842 Ga0466957_0018760 Ga0466957_0018760_1590_2600 336
402 3300045051 Ga0451576_0001155 Ga0451576_0001155_32818_33834 336
403 3300046477 Ga0495664_0108805 Ga0495664_0108805_77_1090 336
404 3300046694 Ga0495649_0028845 Ga0495649_0028845_1420_2430 336
405 3300047472 Ga0495686_0000005 Ga0495686_0000005_400705_401721 336
406 3300050493 nmdc:mga0k408_49682_c1 nmdc:mga0k408_49682_c1_934_1944 336
407 3300053086 Ga0500578_0000060 Ga0500578_0000060_111592_112605 336
408 3300053086 Ga0500578_0023317 Ga0500578_0023317_2156_3169 336
409 3300053092 Ga0500583_0000003 Ga0500583_0000003_115010_116020 336
410 3300053151 Ga0500604_0004831 Ga0500604_0004831_1151_2170 336
411 3300053156 Ga0500622_0000113 Ga0500622_0000113_36319_37362 336
412 3300053156 Ga0500622_0094240 Ga0500622_0094240_439_1452 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

146

271

0.97

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

20

138

0.94

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

150

355

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q2k-assembly2.cif.gz_L crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9613 3 332
3q2k-assembly2.cif.gz_P crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9577 3 332
3q2k-assembly1.cif.gz_E crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9552 3 332
3q2k-assembly1.cif.gz_F crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9401 3 332
3q2k-assembly1.cif.gz_B crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9342 3 332
ID Description Score Start End Superfamily
3q2kD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9692 130 261 3.30.360.10
af_P77503_10_129_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9489 4 120 3.30.360.10
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.944 4 120 3.40.50.720
af_M9PE54_6_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.942 4 117 3.40.50.720
af_Q2G1E6_2_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9419 4 117 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A011QT55-F1-model_v4 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.1.1.312) 0.9593 2 120 GO:0000166
GO:0050606
AF-A0A4Q3RX11-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9525 2 125 GO:0000166
GO:0003824
AF-A0A836SQT7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9506 2 143 GO:0000166
AF-A0A0A2F273-F1-model_v4 Oxidoreductase 0.944 1 332 GO:0000166
GO:0016491
AF-A0A151BEY2-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9401 1 143 GO:0000166

Feature Viewer

pLDDT pTM Quality
93.39 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map