F437709

General Info

Members Datasets Scaffolds Average Seq Length
412 207 824 252

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10145051|Ga0065712_101450512
Length 271
Sequence MSSRSPRENRCRWETNRMGNILALAEKELKSYFASPIAYVIIGFFALVFGWFYVVSIDFFMRASLQMGMPGQGQVNINSMAIRPLLANVSVVALFVLPLITMRTYAEEKRSGTIELLLTSPLTDFQIIMGKFLGAVGLYALMMAVTLIHIAVLFIYGNPEWKPIVSGYLGLLLMGASFISIGLLISSLTKNQIVAGMVTFAVLLLLWTIGWMQDSAGPNMQKVLQALSITDRFDDFSKGVIDLKHVVYYLSFISFGLFLTAKSVDSERWRG

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
140 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
141 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
142 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
143 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
144 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
164 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
165 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
178 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
179 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
180 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
181 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
182 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
183 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
187 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
190 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 0
Rhizoplane 1.21
Rhizosphere 93.69
Stem 0
Stem Tuber 0
Unclassified 20.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10145051 3300005290 Bacteria 1416
2 SwRhRL2b_contig_2975749 2162886007 Bacteria 1101
3 JGI24751J29686_10036342 3300002459 Bacteria 1021
4 Ga0065712_10080908 3300005290 Bacteria 3043
5 Ga0065712_10247627 3300005290 Unclassified 967
6 Ga0065715_10015742 3300005293 Bacteria 2864
7 Ga0065715_10095796 3300005293 Bacteria 4005
8 Ga0065707_10113185 3300005295 Bacteria 2335
9 Ga0065707_10113420 3300005295 Unclassified 2328
10 Ga0065707_10209147 3300005295 Bacteria 1274
11 Ga0070676_10015767 3300005328 Bacteria 4168
12 Ga0070683_100329813 3300005329 Bacteria 1453
13 Ga0070670_100039564 3300005331 Bacteria 4055
14 Ga0070670_100473008 3300005331 Bacteria 1112
15 Ga0070670_100534240 3300005331 Unclassified 1045
16 Ga0070677_10065670 3300005333 Unclassified 1511
17 Ga0070677_10071064 3300005333 Unclassified 1465
18 Ga0070677_10117116 3300005333 Unclassified 1198
19 Ga0070666_10197710 3300005335 Unclassified 1414
20 Ga0070680_100106919 3300005336 Bacteria 2327
21 Ga0070680_100141863 3300005336 Bacteria 2015
22 Ga0070682_100298615 3300005337 Unclassified 1181
23 Ga0070689_100028335 3300005340 Bacteria 4233
24 Ga0070689_100038149 3300005340 Bacteria 3674
25 Ga0070689_100080142 3300005340 Bacteria 2562
26 Ga0070689_100222821 3300005340 Bacteria 1548
27 Ga0070687_100060369 3300005343 Unclassified 2000
28 Ga0070661_100171829 3300005344 Unclassified 1646
29 Ga0070669_100001306 3300005353 Bacteria 17985
30 Ga0070669_100061858 3300005353 Unclassified 2752
31 Ga0070669_100132689 3300005353 Unclassified 1913
32 Ga0070669_100248911 3300005353 Bacteria 1414
33 Ga0070669_100565834 3300005353 Bacteria 949
34 Ga0070675_100000749 3300005354 Bacteria 22592
35 Ga0070675_100091336 3300005354 Bacteria 2551
36 Ga0070675_100329767 3300005354 Bacteria 1350
37 Ga0070674_100037358 3300005356 Bacteria 3266
38 Ga0070674_100062414 3300005356 Bacteria 2604
39 Ga0070674_100231915 3300005356 Bacteria 1441
40 Ga0070674_100247777 3300005356 Bacteria 1398
41 Ga0070673_100001969 3300005364 Bacteria 12386
42 Ga0070673_100006409 3300005364 Bacteria 7651
43 Ga0070673_100071566 3300005364 Bacteria 2787
44 Ga0070673_100808359 3300005364 Bacteria 866
45 Ga0070659_100284509 3300005366 Bacteria 1376
46 Ga0070659_100426623 3300005366 Bacteria 1122
47 Ga0070667_100200936 3300005367 Bacteria 1769
48 Ga0070667_100443219 3300005367 Unclassified 1186
49 Ga0070703_10032698 3300005406 Unclassified 1581
50 Ga0070709_10078839 3300005434 Bacteria 2144
51 Ga0070714_100017981 3300005435 Bacteria 5732
52 Ga0070713_100224929 3300005436 Unclassified 1704
53 Ga0070701_10150874 3300005438 Bacteria 1338
54 Ga0070700_100009434 3300005441 Bacteria 5356
55 Ga0070700_100367498 3300005441 Unclassified 1072
56 Ga0070694_100046653 3300005444 Bacteria 2910
57 Ga0070694_100312630 3300005444 Unclassified 1207
58 Ga0070681_10741283 3300005458 Unclassified 899
59 Ga0070707_100117254 3300005468 Unclassified 2584
60 Ga0070699_100059731 3300005518 Bacteria 3303
61 Ga0070697_100089409 3300005536 Bacteria 2544
62 Ga0070672_100037817 3300005543 Unclassified 3684
63 Ga0070672_100160100 3300005543 Bacteria 1867
64 Ga0070686_100167624 3300005544 Bacteria 1551
65 Ga0070695_100008550 3300005545 Bacteria 6080
66 Ga0070695_100011811 3300005545 Bacteria 5228
67 Ga0070704_100002991 3300005549 Bacteria 9611
68 Ga0070704_100139047 3300005549 Unclassified 1893
69 Ga0070704_100277531 3300005549 Bacteria 1387
70 Ga0070664_100010736 3300005564 Bacteria 7425
71 Ga0070664_100098652 3300005564 Unclassified 2538
72 Ga0070664_100140908 3300005564 Unclassified 2123
73 Ga0068854_100407680 3300005578 Bacteria 1126
74 Ga0068859_100002669 3300005617 Bacteria 18110
75 Ga0068859_100034300 3300005617 Bacteria 5094
76 Ga0068864_100007301 3300005618 Bacteria 9091
77 Ga0068864_100051024 3300005618 Bacteria 3562
78 Ga0068861_100215807 3300005719 Bacteria 1619
79 Ga0068870_10248218 3300005840 Bacteria 1102
80 Ga0068858_100224277 3300005842 Unclassified 1781
81 Ga0068860_100348902 3300005843 Unclassified 1456
82 Ga0068860_100375645 3300005843 Unclassified 1402
83 Ga0068862_100013546 3300005844 Bacteria 6756
84 Ga0068862_100030108 3300005844 Bacteria 4573
85 Ga0068862_100047042 3300005844 Bacteria 3681
86 Ga0068862_100069018 3300005844 Bacteria 3050
87 Ga0068862_100142947 3300005844 Bacteria 2125
88 Ga0068862_100550299 3300005844 Unclassified 1102
89 Ga0081538_10127889 3300005981 Unclassified 1202
90 Ga0075364_10000689 3300006051 Bacteria 17616
91 Ga0075364_10006603 3300006051 Bacteria 6831
92 Ga0075364_10072993 3300006051 Bacteria 2262
93 Ga0075362_10004839 3300006177 Bacteria 4865
94 Ga0075362_10212754 3300006177 Unclassified 943
95 Ga0075367_10002867 3300006178 Bacteria 8021
96 Ga0075369_10166821 3300006186 Unclassified 1010
97 Ga0075366_10001275 3300006195 Bacteria 12539
98 Ga0075366_10058269 3300006195 Bacteria 2294
99 Ga0075366_10129414 3300006195 Unclassified 1523
100 Ga0097621_100011019 3300006237 Bacteria 6644
101 Ga0068871_100086831 3300006358 Bacteria 2600
102 Ga0068871_100252603 3300006358 Unclassified 1536
103 Ga0075428_100000005 3300006844 Bacteria 326130
104 Ga0075428_100006017 3300006844 Bacteria 13474
105 Ga0075428_100010821 3300006844 Bacteria 10139
106 Ga0075428_100093772 3300006844 Bacteria 3273
107 Ga0075430_100003901 3300006846 Bacteria 12570
108 Ga0075431_100003811 3300006847 Bacteria 14658
109 Ga0075431_100030235 3300006847 Bacteria 5579
110 Ga0075431_100036079 3300006847 Bacteria 5093
111 Ga0075431_100078711 3300006847 Bacteria 3403
112 Ga0075431_100096584 3300006847 Unclassified 3050
113 Ga0075433_10010726 3300006852 Bacteria 7369
114 Ga0075433_10049824 3300006852 Bacteria 3644
115 Ga0075433_10052957 3300006852 Bacteria 3537
116 Ga0075433_10119256 3300006852 Bacteria 2342
117 Ga0075433_10149447 3300006852 Bacteria 2078
118 Ga0075433_10189674 3300006852 Bacteria 1829
119 Ga0075433_10489257 3300006852 Bacteria 1083
120 Ga0075433_10778960 3300006852 Unclassified 836
121 Ga0075434_100029500 3300006871 Bacteria 5398
122 Ga0075434_100039573 3300006871 Bacteria 4672
123 Ga0075429_100001976 3300006880 Bacteria 17057
124 Ga0075429_100003787 3300006880 Bacteria 12904
125 Ga0075429_100009995 3300006880 Bacteria 8225
126 Ga0075429_100051029 3300006880 Bacteria 3599
127 Ga0075429_100148815 3300006880 Bacteria 2050
128 Ga0068865_100114595 3300006881 Unclassified 1994
129 Ga0097620_100002669 3300006931 Bacteria 18110
130 Ga0097620_100034298 3300006931 Bacteria 5094
131 Ga0075435_100036612 3300007076 Unclassified 3902
132 Ga0075435_100257344 3300007076 Unclassified 1487
133 Ga0105240_10167295 3300009093 Bacteria 2607
134 Ga0111539_10000008 3300009094 Bacteria 382609
135 Ga0111539_10000201 3300009094 Bacteria 70327
136 Ga0111539_10001892 3300009094 Bacteria 27846
137 Ga0111539_10020596 3300009094 Bacteria 8122
138 Ga0111539_10062846 3300009094 Bacteria 4394
139 Ga0111539_10118339 3300009094 Bacteria 3105
140 Ga0111539_10119625 3300009094 Unclassified 3086
141 Ga0111539_10715064 3300009094 Unclassified 1166
142 Ga0111539_10739559 3300009094 Bacteria 1145
143 Ga0114129_10002861 3300009147 Bacteria 24137
144 Ga0114129_10006845 3300009147 Bacteria 16203
145 Ga0114129_10008348 3300009147 Bacteria 14768
146 Ga0114129_10009590 3300009147 Bacteria 13809
147 Ga0114129_10010894 3300009147 Bacteria 12953
148 Ga0114129_10028353 3300009147 Bacteria 7934
149 Ga0114129_10030118 3300009147 Bacteria 7686
150 Ga0114129_10125435 3300009147 Bacteria 3530
151 Ga0114129_10188139 3300009147 Bacteria 2805
152 Ga0114129_10191967 3300009147 Bacteria 2773
153 Ga0114129_10240422 3300009147 Bacteria 2434
154 Ga0114129_11342183 3300009147 Bacteria 885
155 Ga0105248_10127346 3300009177 Bacteria 2873
156 Ga0105238_10489205 3300009551 Bacteria 1230
157 Ga0105249_10002028 3300009553 Bacteria 17573
158 Ga0105249_10335201 3300009553 Bacteria 1528
159 Ga0105246_10412665 3300011119 Bacteria 1124
160 Ga0157373_10320513 3300013100 Bacteria 1102
161 Ga0157370_10540899 3300013104 Bacteria 1068
162 Ga0157374_10621496 3300013296 Bacteria 1091
163 Ga0157372_10142330 3300013307 Bacteria 2764
164 Ga0157375_10629321 3300013308 Bacteria 1230
165 Ga0157380_10004296 3300014326 Bacteria 9873
166 Ga0157380_10005028 3300014326 Bacteria 9219
167 Ga0157380_10018711 3300014326 Bacteria 5148
168 Ga0157380_10040458 3300014326 Bacteria 3631
169 Ga0157380_10076952 3300014326 Bacteria 2717
170 Ga0157377_10026837 3300014745 Bacteria 3086
171 Ga0157377_10069330 3300014745 Unclassified 2035
172 Ga0157376_10037217 3300014969 Bacteria 3947
173 Ga0207682_10037865 3300025893 Bacteria 1955
174 Ga0207682_10079118 3300025893 Bacteria 1406
175 Ga0207688_10050362 3300025901 Bacteria 2331
176 Ga0207688_10074958 3300025901 Bacteria 1925
177 Ga0207688_10142823 3300025901 Unclassified 1410
178 Ga0207707_10312934 3300025912 Bacteria 1357
179 Ga0207695_10052193 3300025913 Bacteria 4285
180 Ga0207695_10446600 3300025913 Bacteria 1176
181 Ga0207660_10132810 3300025917 Bacteria 1896
182 Ga0207662_10062836 3300025918 Bacteria 2232
183 Ga0207657_10204837 3300025919 Bacteria 1585
184 Ga0207649_10091564 3300025920 Bacteria 1992
185 Ga0207649_10138945 3300025920 Unclassified 1660
186 Ga0207649_10264702 3300025920 Unclassified 1244
187 Ga0207646_10011836 3300025922 Bacteria 8419
188 Ga0207681_10008600 3300025923 Bacteria 6233
189 Ga0207681_10062218 3300025923 Bacteria 2569
190 Ga0207681_10178349 3300025923 Bacteria 1616
191 Ga0207694_10116113 3300025924 Bacteria 2133
192 Ga0207650_10013397 3300025925 Bacteria 5677
193 Ga0207650_10051612 3300025925 Bacteria 3044
194 Ga0207650_10417347 3300025925 Bacteria 1113
195 Ga0207659_10000075 3300025926 Bacteria 63221
196 Ga0207659_10024649 3300025926 Bacteria 4034
197 Ga0207659_10113882 3300025926 Unclassified 2061
198 Ga0207659_10172810 3300025926 Bacteria 1706
199 Ga0207690_10168201 3300025932 Bacteria 1640
200 Ga0207706_10163786 3300025933 Bacteria 1954
201 Ga0207706_10178805 3300025933 Bacteria 1863
202 Ga0207670_10019144 3300025936 Bacteria 4174
203 Ga0207670_10076125 3300025936 Bacteria 2334
204 Ga0207669_10089158 3300025937 Bacteria 2002
205 Ga0207704_10091445 3300025938 Unclassified 2000
206 Ga0207691_10019494 3300025940 Bacteria 6417
207 Ga0207691_10051536 3300025940 Unclassified 3762
208 Ga0207691_10229049 3300025940 Bacteria 1610
209 Ga0207711_10402100 3300025941 Unclassified 1273
210 Ga0207661_10125881 3300025944 Bacteria 2188
211 Ga0207679_10013142 3300025945 Bacteria 5423
212 Ga0207679_10072166 3300025945 Unclassified 2607
213 Ga0207667_10486893 3300025949 Unclassified 1252
214 Ga0207651_10037087 3300025960 Bacteria 3190
215 Ga0207651_10078563 3300025960 Unclassified 2367
216 Ga0207651_10194587 3300025960 Bacteria 1620
217 Ga0207651_10744650 3300025960 Bacteria 866
218 Ga0207712_10034764 3300025961 Bacteria 3418
219 Ga0207712_10259190 3300025961 Bacteria 1409
220 Ga0207668_10236397 3300025972 Unclassified 1476
221 Ga0207640_10158526 3300025981 Bacteria 1671
222 Ga0207640_10328778 3300025981 Bacteria 1220
223 Ga0207658_10338198 3300025986 Bacteria 1308
224 Ga0207703_10049675 3300026035 Bacteria 3392
225 Ga0207708_10008575 3300026075 Bacteria 7564
226 Ga0207708_10032080 3300026075 Bacteria 3989
227 Ga0207702_10447720 3300026078 Unclassified 1252
228 Ga0207641_10077894 3300026088 Bacteria 2870
229 Ga0207648_10094558 3300026089 Bacteria 2614
230 Ga0207648_10261063 3300026089 Bacteria 1545
231 Ga0207648_10479314 3300026089 Bacteria 1136
232 Ga0207648_10602639 3300026089 Unclassified 1012
233 Ga0207676_10023568 3300026095 Bacteria 4544
234 Ga0207676_10056556 3300026095 Bacteria 3085
235 Ga0207674_10028134 3300026116 Bacteria 5937
236 Ga0207674_10413515 3300026116 Unclassified 1303
237 Ga0207675_100048913 3300026118 Bacteria 3947
238 Ga0207675_100861537 3300026118 Unclassified 921
239 Ga0209971_1006238 3300027682 Bacteria 2823
240 Ga0209971_1050489 3300027682 Bacteria 1005
241 Ga0209998_10052506 3300027717 Unclassified 946
242 Ga0207428_10000019 3300027907 Bacteria 276945
243 Ga0207428_10000445 3300027907 Bacteria 50527
244 Ga0207428_10004819 3300027907 Bacteria 12739
245 Ga0207428_10009700 3300027907 Bacteria 8626
246 Ga0207428_10012181 3300027907 Bacteria 7566
247 Ga0207428_10061004 3300027907 Unclassified 2987
248 Ga0268265_10011757 3300028380 Bacteria 5921
249 Ga0268265_10013505 3300028380 Bacteria 5550
250 Ga0268265_10113938 3300028380 Bacteria 2213
251 Ga0268265_10728924 3300028380 Unclassified 960
252 Ga0268264_10174153 3300028381 Bacteria 1949
253 Ga0268264_10323851 3300028381 Bacteria 1458
254 Ga0307408_100009487 3300031548 Bacteria 6419
255 Ga0307408_100063786 3300031548 Bacteria 2696
256 Ga0307408_100195890 3300031548 Bacteria 1631
257 Ga0307408_100202728 3300031548 Unclassified 1607
258 Ga0307408_100319231 3300031548 Bacteria 1308
259 Ga0307408_100535354 3300031548 Bacteria 1031
260 Ga0307405_10001625 3300031731 Bacteria 9563
261 Ga0307413_10023718 3300031824 Bacteria 3329
262 Ga0307413_10150333 3300031824 Bacteria 1621
263 Ga0307410_10043030 3300031852 Bacteria 2989
264 Ga0307410_10149608 3300031852 Unclassified 1737
265 Ga0307406_10011222 3300031901 Bacteria 5078
266 Ga0307407_10000933 3300031903 Bacteria 9905
267 Ga0307407_10004218 3300031903 Bacteria 6062
268 Ga0307407_10365397 3300031903 Unclassified 1026
269 Ga0307412_10042987 3300031911 Bacteria 2940
270 Ga0307412_10056234 3300031911 Bacteria 2621
271 Ga0307412_10257637 3300031911 Bacteria 1358
272 Ga0307409_100005739 3300031995 Bacteria 7194
273 Ga0307409_100012417 3300031995 Bacteria 5428
274 Ga0307409_100016178 3300031995 Bacteria 4927
275 Ga0307409_100113432 3300031995 Bacteria 2278
276 Ga0307416_100025879 3300032002 Bacteria 4312
277 Ga0307416_100097470 3300032002 Bacteria 2546
278 Ga0307416_100108840 3300032002 Bacteria 2436
279 Ga0307416_100125571 3300032002 Bacteria 2298
280 Ga0307414_10008828 3300032004 Bacteria 5750
281 Ga0307414_10082141 3300032004 Bacteria 2362
282 Ga0307411_10007056 3300032005 Bacteria 5683
283 Ga0307411_10050851 3300032005 Bacteria 2701
284 Ga0307415_100007729 3300032126 Bacteria 5905
285 Ga0307415_100758104 3300032126 Bacteria 882
286 Ga0373923_0228069 3300035111 Bacteria 867
287 Ga0373936_0076027 3300035113 Bacteria 1391
288 Ga0373942_0026825 3300035207 Bacteria 1494
289 Ga0373933_0139029 3300035724 Unclassified 1532
290 Ga0373947_0098874 3300035725 Bacteria 1831
291 Ga0373937_0000513 3300036401 Bacteria 35017
292 Ga0373937_0294693 3300036401 Unclassified 1533
293 Ga0373925_0003499 3300037068 Bacteria 12135
294 Ga0373925_0333146 3300037068 Bacteria 1230
295 Ga0439439_0085515 3300041406 Bacteria 857
296 Ga0439453_0026963 3300041408 Bacteria 1067
297 Ga0439461_0009942 3300041410 Bacteria 1736
298 Ga0451802_0765236 3300041460 Unclassified 793
299 Ga0439450_009896 3300042008 Bacteria 1824
300 Ga0439462_0013425 3300042015 Bacteria 2099
301 Ga0450920_017358 3300042122 Unclassified 1376
302 Ga0439446_0013532 3300042156 Bacteria 2240
303 Ga0439446_0039656 3300042156 Bacteria 1384
304 Ga0439435_0004564 3300042436 Bacteria 2996
305 Ga0439435_0009678 3300042436 Bacteria 2267
306 Ga0439464_0011005 3300042439 Bacteria 2392
307 Ga0439460_0010949 3300042461 Bacteria 2332
308 Ga0439460_0075891 3300042461 Bacteria 1048
309 Ga0439460_0091415 3300042461 Bacteria 968
310 Ga0451577_0583296 3300042876 Unclassified 1015
311 Ga0451576_0024000 3300045051 Bacteria 6592
312 Ga0495592_0388292 3300046454 Bacteria 887
313 Ga0495598_0036908 3300046537 Bacteria 1407
314 Ga0495621_0085491 3300046539 Bacteria 1182
315 Ga0495667_0069572 3300046559 Bacteria 2297
316 Ga0495658_0041861 3300046683 Bacteria 2555
317 Ga0495670_0027212 3300046691 Bacteria 2832
318 Ga0495674_0414892 3300047319 Unclassified 1085
319 Ga0495680_0160505 3300047322 Bacteria 1633
320 Ga0495680_0529888 3300047322 Unclassified 796
321 Ga0496102_0285119 3300048905 Bacteria 1557
322 Ga0496110_0329726 3300048913 Unclassified 1390
323 Ga0496111_0237442 3300048914 Unclassified 1354
324 Ga0496114_0093384 3300048917 Unclassified 2558
325 Ga0501291_001865 3300049514 Bacteria 2471
326 Ga0501296_005959 3300049519 Bacteria 1372
327 Ga0501299_000741 3300049522 Bacteria 3950
328 Ga0501034_0043083 3300049571 Bacteria 4568
329 Ga0501036_0111919 3300049572 Bacteria 2307
330 Ga0501041_0167231 3300049577 Bacteria 1376
331 Ga0501042_0032472 3300049578 Bacteria 3697
332 Ga0501047_0620283 3300049581 Bacteria 902
333 Ga0501048_0037161 3300049582 Bacteria 3497
334 Ga0501068_0082587 3300049584 Archaea 1974
335 Ga0501072_0082574 3300049588 Bacteria 2547
336 Ga0501072_0204892 3300049588 Bacteria 1572
337 Ga0501072_0582263 3300049588 Unclassified 883
338 Ga0501074_0085456 3300049590 Bacteria 2261
339 Ga0501075_0070014 3300049591 Bacteria 2651
340 Ga0501076_0044514 3300049592 Bacteria 3501
341 Ga0501202_001972 3300049652 Bacteria 3383
342 Ga0501208_001949 3300049655 Bacteria 2075
343 Ga0501209_096870 3300049656 Unclassified 862
344 Ga0501216_015967 3300049660 Bacteria 1270
345 Ga0501223_035706 3300049663 Unclassified 967
346 Ga0501233_013785 3300049668 Bacteria 1644
347 Ga0501239_011867 3300049672 Unclassified 979
348 Ga0501079_0377929 3300049741 Bacteria 1111
349 Ga0501081_0118022 3300049743 Bacteria 1887
350 Ga0501264_008249 3300049761 Bacteria 981
351 Ga0501283_024284 3300049779 Bacteria 987
352 Ga0501045_0048210 3300049824 Bacteria 3105
353 Ga0501204_006784 3300049850 Bacteria 1278
354 nmdc:mga03683_1366_c1 3300050489 Bacteria 7237
355 nmdc:mga03683_18622_c1 3300050489 Bacteria 2641
356 nmdc:mga00v17_1844_c1 3300050491 Bacteria 10944
357 nmdc:mga00v17_330286_c1 3300050491 Bacteria 991
358 nmdc:mga0yw44_898_c1 3300050492 Bacteria 11236
359 nmdc:mga0k408_10496_c1 3300050493 Bacteria 5010
360 nmdc:mga0k408_136312_c1 3300050493 Unclassified 1458
361 nmdc:mga0k408_7328_c1 3300050493 Bacteria 5892
362 nmdc:mga06z11_128943_c1 3300050494 Unclassified 1418
363 nmdc:mga06z11_53394_c1 3300050494 Bacteria 2078
364 nmdc:mga06z11_6437_c1 3300050494 Bacteria 4779
365 nmdc:mga05p37_11228_c1 3300050507 Bacteria 10650
366 nmdc:mga05p37_128220_c1 3300050507 Bacteria 3114
367 nmdc:mga05p37_1529_c1 3300050507 Bacteria 26922
368 nmdc:mga05p37_221545_c1 3300050507 Unclassified 2283
369 nmdc:mga05p37_37171_c1 3300050507 Bacteria 5971
370 nmdc:mga05p37_4593_c1 3300050507 Bacteria 16146
371 nmdc:mga05p37_489097_c1 3300050507 Bacteria 1415
372 nmdc:mga05p37_86806_c1 3300050507 Bacteria 3857
373 nmdc:mga05p37_87556_c1 3300050507 Bacteria 3838
374 nmdc:mga09592_111425_c1 3300050508 Bacteria 2348
375 nmdc:mga09592_11954_c1 3300050508 Bacteria 7062
376 nmdc:mga09592_44175_c1 3300050508 Bacteria 3750
377 nmdc:mga09592_582682_c1 3300050508 Bacteria 959
378 nmdc:mga0qj67_16130_c1 3300050509 Bacteria 5661
379 nmdc:mga0qj67_21314_c1 3300050509 Bacteria 4970
380 nmdc:mga0qj67_325085_c1 3300050509 Unclassified 1245
381 nmdc:mga0qj67_36438_c1 3300050509 Bacteria 3848
382 nmdc:mga06r32_113497_c1 3300050510 Bacteria 2667
383 nmdc:mga06r32_12754_c1 3300050510 Bacteria 7598
384 nmdc:mga06r32_29674_c1 3300050510 Bacteria 5128
385 nmdc:mga06r32_3403_c1 3300050510 Bacteria 14233
386 nmdc:mga08y16_105861_c1 3300050511 Unclassified 2928
387 nmdc:mga08y16_10915_c1 3300050511 Bacteria 8104
388 nmdc:mga08y16_1203_c1 3300050511 Bacteria 25560
389 nmdc:mga08y16_13274_c1 3300050511 Bacteria 8664
390 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
391 nmdc:mga08y16_25050_c1 3300050511 Bacteria 6294
392 nmdc:mga08y16_47821_c1 3300050511 Bacteria 4477
393 nmdc:mga08y16_623673_c1 3300050511 Bacteria 1085
394 nmdc:mga08y16_62589_c1 3300050511 Unclassified 3886
395 nmdc:mga08y16_812932_c1 3300050511 Unclassified 927
396 nmdc:mga0n895_158822_c1 3300050512 Unclassified 2292
397 nmdc:mga0n895_21585_c1 3300050512 Bacteria 6025
398 nmdc:mga0rr50_343730_c1 3300050513 Bacteria 1254
399 nmdc:mga08x19_152364_c1 3300050514 Archaea 1255
400 nmdc:mga0a205_154063_c1 3300050515 Bacteria 2197
401 nmdc:mga0a205_20017_c1 3300050515 Bacteria 6313
402 nmdc:mga0a205_24381_c1 3300050515 Bacteria 5753
403 nmdc:mga0a205_482248_c1 3300050515 Bacteria 1098
404 nmdc:mga0a205_65062_c1 3300050515 Unclassified 3522
405 Ga0495601_0197708 3300053077 Unclassified 1314
406 Ga0495619_0031454 3300053085 Bacteria 3439
407 Ga0495619_0088133 3300053085 Bacteria 2099
408 Ga0495619_0270640 3300053085 Bacteria 1177
409 Ga0501084_0169889 3300054114 Bacteria 1841
410 Ga0501084_0255766 3300054114 Unclassified 1478
411 Ga0501082_0031284 3300060353 Bacteria 4588
412 Ga0501082_0146098 3300060353 Bacteria 2053
413 Ga0065712_10145051
414 SwRhRL2b_contig_2975749
415 JGI24751J29686_10036342
416 Ga0065712_10080908
417 Ga0065712_10247627
418 Ga0065715_10015742
419 Ga0065715_10095796
420 Ga0065707_10113185
421 Ga0065707_10113420
422 Ga0065707_10209147
423 Ga0070676_10015767
424 Ga0070683_100329813
425 Ga0070670_100039564
426 Ga0070670_100473008
427 Ga0070670_100534240
428 Ga0070677_10065670
429 Ga0070677_10071064
430 Ga0070677_10117116
431 Ga0070666_10197710
432 Ga0070680_100106919
433 Ga0070680_100141863
434 Ga0070682_100298615
435 Ga0070689_100028335
436 Ga0070689_100038149
437 Ga0070689_100080142
438 Ga0070689_100222821
439 Ga0070687_100060369
440 Ga0070661_100171829
441 Ga0070669_100001306
442 Ga0070669_100061858
443 Ga0070669_100132689
444 Ga0070669_100248911
445 Ga0070669_100565834
446 Ga0070675_100000749
447 Ga0070675_100091336
448 Ga0070675_100329767
449 Ga0070674_100037358
450 Ga0070674_100062414
451 Ga0070674_100231915
452 Ga0070674_100247777
453 Ga0070673_100001969
454 Ga0070673_100006409
455 Ga0070673_100071566
456 Ga0070673_100808359
457 Ga0070659_100284509
458 Ga0070659_100426623
459 Ga0070667_100200936
460 Ga0070667_100443219
461 Ga0070703_10032698
462 Ga0070709_10078839
463 Ga0070714_100017981
464 Ga0070713_100224929
465 Ga0070701_10150874
466 Ga0070700_100009434
467 Ga0070700_100367498
468 Ga0070694_100046653
469 Ga0070694_100312630
470 Ga0070681_10741283
471 Ga0070707_100117254
472 Ga0070699_100059731
473 Ga0070697_100089409
474 Ga0070672_100037817
475 Ga0070672_100160100
476 Ga0070686_100167624
477 Ga0070695_100008550
478 Ga0070695_100011811
479 Ga0070704_100002991
480 Ga0070704_100139047
481 Ga0070704_100277531
482 Ga0070664_100010736
483 Ga0070664_100098652
484 Ga0070664_100140908
485 Ga0068854_100407680
486 Ga0068859_100002669
487 Ga0068859_100034300
488 Ga0068864_100007301
489 Ga0068864_100051024
490 Ga0068861_100215807
491 Ga0068870_10248218
492 Ga0068858_100224277
493 Ga0068860_100348902
494 Ga0068860_100375645
495 Ga0068862_100013546
496 Ga0068862_100030108
497 Ga0068862_100047042
498 Ga0068862_100069018
499 Ga0068862_100142947
500 Ga0068862_100550299
501 Ga0081538_10127889
502 Ga0075364_10000689
503 Ga0075364_10006603
504 Ga0075364_10072993
505 Ga0075362_10004839
506 Ga0075362_10212754
507 Ga0075367_10002867
508 Ga0075369_10166821
509 Ga0075366_10001275
510 Ga0075366_10058269
511 Ga0075366_10129414
512 Ga0097621_100011019
513 Ga0068871_100086831
514 Ga0068871_100252603
515 Ga0075428_100000005
516 Ga0075428_100006017
517 Ga0075428_100010821
518 Ga0075428_100093772
519 Ga0075430_100003901
520 Ga0075431_100003811
521 Ga0075431_100030235
522 Ga0075431_100036079
523 Ga0075431_100078711
524 Ga0075431_100096584
525 Ga0075433_10010726
526 Ga0075433_10049824
527 Ga0075433_10052957
528 Ga0075433_10119256
529 Ga0075433_10149447
530 Ga0075433_10189674
531 Ga0075433_10489257
532 Ga0075433_10778960
533 Ga0075434_100029500
534 Ga0075434_100039573
535 Ga0075429_100001976
536 Ga0075429_100003787
537 Ga0075429_100009995
538 Ga0075429_100051029
539 Ga0075429_100148815
540 Ga0068865_100114595
541 Ga0097620_100002669
542 Ga0097620_100034298
543 Ga0075435_100036612
544 Ga0075435_100257344
545 Ga0105240_10167295
546 Ga0111539_10000008
547 Ga0111539_10000201
548 Ga0111539_10001892
549 Ga0111539_10020596
550 Ga0111539_10062846
551 Ga0111539_10118339
552 Ga0111539_10119625
553 Ga0111539_10715064
554 Ga0111539_10739559
555 Ga0114129_10002861
556 Ga0114129_10006845
557 Ga0114129_10008348
558 Ga0114129_10009590
559 Ga0114129_10010894
560 Ga0114129_10028353
561 Ga0114129_10030118
562 Ga0114129_10125435
563 Ga0114129_10188139
564 Ga0114129_10191967
565 Ga0114129_10240422
566 Ga0114129_11342183
567 Ga0105248_10127346
568 Ga0105238_10489205
569 Ga0105249_10002028
570 Ga0105249_10335201
571 Ga0105246_10412665
572 Ga0157373_10320513
573 Ga0157370_10540899
574 Ga0157374_10621496
575 Ga0157372_10142330
576 Ga0157375_10629321
577 Ga0157380_10004296
578 Ga0157380_10005028
579 Ga0157380_10018711
580 Ga0157380_10040458
581 Ga0157380_10076952
582 Ga0157377_10026837
583 Ga0157377_10069330
584 Ga0157376_10037217
585 Ga0207682_10037865
586 Ga0207682_10079118
587 Ga0207688_10050362
588 Ga0207688_10074958
589 Ga0207688_10142823
590 Ga0207707_10312934
591 Ga0207695_10052193
592 Ga0207695_10446600
593 Ga0207660_10132810
594 Ga0207662_10062836
595 Ga0207657_10204837
596 Ga0207649_10091564
597 Ga0207649_10138945
598 Ga0207649_10264702
599 Ga0207646_10011836
600 Ga0207681_10008600
601 Ga0207681_10062218
602 Ga0207681_10178349
603 Ga0207694_10116113
604 Ga0207650_10013397
605 Ga0207650_10051612
606 Ga0207650_10417347
607 Ga0207659_10000075
608 Ga0207659_10024649
609 Ga0207659_10113882
610 Ga0207659_10172810
611 Ga0207690_10168201
612 Ga0207706_10163786
613 Ga0207706_10178805
614 Ga0207670_10019144
615 Ga0207670_10076125
616 Ga0207669_10089158
617 Ga0207704_10091445
618 Ga0207691_10019494
619 Ga0207691_10051536
620 Ga0207691_10229049
621 Ga0207711_10402100
622 Ga0207661_10125881
623 Ga0207679_10013142
624 Ga0207679_10072166
625 Ga0207667_10486893
626 Ga0207651_10037087
627 Ga0207651_10078563
628 Ga0207651_10194587
629 Ga0207651_10744650
630 Ga0207712_10034764
631 Ga0207712_10259190
632 Ga0207668_10236397
633 Ga0207640_10158526
634 Ga0207640_10328778
635 Ga0207658_10338198
636 Ga0207703_10049675
637 Ga0207708_10008575
638 Ga0207708_10032080
639 Ga0207702_10447720
640 Ga0207641_10077894
641 Ga0207648_10094558
642 Ga0207648_10261063
643 Ga0207648_10479314
644 Ga0207648_10602639
645 Ga0207676_10023568
646 Ga0207676_10056556
647 Ga0207674_10028134
648 Ga0207674_10413515
649 Ga0207675_100048913
650 Ga0207675_100861537
651 Ga0209971_1006238
652 Ga0209971_1050489
653 Ga0209998_10052506
654 Ga0207428_10000019
655 Ga0207428_10000445
656 Ga0207428_10004819
657 Ga0207428_10009700
658 Ga0207428_10012181
659 Ga0207428_10061004
660 Ga0268265_10011757
661 Ga0268265_10013505
662 Ga0268265_10113938
663 Ga0268265_10728924
664 Ga0268264_10174153
665 Ga0268264_10323851
666 Ga0307408_100009487
667 Ga0307408_100063786
668 Ga0307408_100195890
669 Ga0307408_100202728
670 Ga0307408_100319231
671 Ga0307408_100535354
672 Ga0307405_10001625
673 Ga0307413_10023718
674 Ga0307413_10150333
675 Ga0307410_10043030
676 Ga0307410_10149608
677 Ga0307406_10011222
678 Ga0307407_10000933
679 Ga0307407_10004218
680 Ga0307407_10365397
681 Ga0307412_10042987
682 Ga0307412_10056234
683 Ga0307412_10257637
684 Ga0307409_100005739
685 Ga0307409_100012417
686 Ga0307409_100016178
687 Ga0307409_100113432
688 Ga0307416_100025879
689 Ga0307416_100097470
690 Ga0307416_100108840
691 Ga0307416_100125571
692 Ga0307414_10008828
693 Ga0307414_10082141
694 Ga0307411_10007056
695 Ga0307411_10050851
696 Ga0307415_100007729
697 Ga0307415_100758104
698 Ga0373923_0228069
699 Ga0373936_0076027
700 Ga0373942_0026825
701 Ga0373933_0139029
702 Ga0373947_0098874
703 Ga0373937_0000513
704 Ga0373937_0294693
705 Ga0373925_0003499
706 Ga0373925_0333146
707 Ga0439439_0085515
708 Ga0439453_0026963
709 Ga0439461_0009942
710 Ga0451802_0765236
711 Ga0439450_009896
712 Ga0439462_0013425
713 Ga0450920_017358
714 Ga0439446_0013532
715 Ga0439446_0039656
716 Ga0439435_0004564
717 Ga0439435_0009678
718 Ga0439464_0011005
719 Ga0439460_0010949
720 Ga0439460_0075891
721 Ga0439460_0091415
722 Ga0451577_0583296
723 Ga0451576_0024000
724 Ga0495592_0388292
725 Ga0495598_0036908
726 Ga0495621_0085491
727 Ga0495667_0069572
728 Ga0495658_0041861
729 Ga0495670_0027212
730 Ga0495674_0414892
731 Ga0495680_0160505
732 Ga0495680_0529888
733 Ga0496102_0285119
734 Ga0496110_0329726
735 Ga0496111_0237442
736 Ga0496114_0093384
737 Ga0501291_001865
738 Ga0501296_005959
739 Ga0501299_000741
740 Ga0501034_0043083
741 Ga0501036_0111919
742 Ga0501041_0167231
743 Ga0501042_0032472
744 Ga0501047_0620283
745 Ga0501048_0037161
746 Ga0501068_0082587
747 Ga0501072_0082574
748 Ga0501072_0204892
749 Ga0501072_0582263
750 Ga0501074_0085456
751 Ga0501075_0070014
752 Ga0501076_0044514
753 Ga0501202_001972
754 Ga0501208_001949
755 Ga0501209_096870
756 Ga0501216_015967
757 Ga0501223_035706
758 Ga0501233_013785
759 Ga0501239_011867
760 Ga0501079_0377929
761 Ga0501081_0118022
762 Ga0501264_008249
763 Ga0501283_024284
764 Ga0501045_0048210
765 Ga0501204_006784
766 nmdc:mga03683_1366_c1
767 nmdc:mga03683_18622_c1
768 nmdc:mga00v17_1844_c1
769 nmdc:mga00v17_330286_c1
770 nmdc:mga0yw44_898_c1
771 nmdc:mga0k408_10496_c1
772 nmdc:mga0k408_136312_c1
773 nmdc:mga0k408_7328_c1
774 nmdc:mga06z11_128943_c1
775 nmdc:mga06z11_53394_c1
776 nmdc:mga06z11_6437_c1
777 nmdc:mga05p37_11228_c1
778 nmdc:mga05p37_128220_c1
779 nmdc:mga05p37_1529_c1
780 nmdc:mga05p37_221545_c1
781 nmdc:mga05p37_37171_c1
782 nmdc:mga05p37_4593_c1
783 nmdc:mga05p37_489097_c1
784 nmdc:mga05p37_86806_c1
785 nmdc:mga05p37_87556_c1
786 nmdc:mga09592_111425_c1
787 nmdc:mga09592_11954_c1
788 nmdc:mga09592_44175_c1
789 nmdc:mga09592_582682_c1
790 nmdc:mga0qj67_16130_c1
791 nmdc:mga0qj67_21314_c1
792 nmdc:mga0qj67_325085_c1
793 nmdc:mga0qj67_36438_c1
794 nmdc:mga06r32_113497_c1
795 nmdc:mga06r32_12754_c1
796 nmdc:mga06r32_29674_c1
797 nmdc:mga06r32_3403_c1
798 nmdc:mga08y16_105861_c1
799 nmdc:mga08y16_10915_c1
800 nmdc:mga08y16_1203_c1
801 nmdc:mga08y16_13274_c1
802 nmdc:mga08y16_17_c1
803 nmdc:mga08y16_25050_c1
804 nmdc:mga08y16_47821_c1
805 nmdc:mga08y16_623673_c1
806 nmdc:mga08y16_62589_c1
807 nmdc:mga08y16_812932_c1
808 nmdc:mga0n895_158822_c1
809 nmdc:mga0n895_21585_c1
810 nmdc:mga0rr50_343730_c1
811 nmdc:mga08x19_152364_c1
812 nmdc:mga0a205_154063_c1
813 nmdc:mga0a205_20017_c1
814 nmdc:mga0a205_24381_c1
815 nmdc:mga0a205_482248_c1
816 nmdc:mga0a205_65062_c1
817 Ga0495601_0197708
818 Ga0495619_0031454
819 Ga0495619_0088133
820 Ga0495619_0270640
821 Ga0501084_0169889
822 Ga0501084_0255766
823 Ga0501082_0031284
824 Ga0501082_0146098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

64

230

0.82

PF12679

ABC2_membrane_2

ABC-2 family transporter protein

15

259

0.77

PF01061

ABC2_membrane

ABC-2 type transporter

19

214

0.73

PF13346

ABC2_membrane_5

ABC-2 family transporter protein

76

264

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7osf-assembly1.cif.gz_E abc transporter complex nosdfyl, r-domain 1 0.8028 4 233
8bht-assembly1.cif.gz_A abcg2 turnover-1 state with tariquidar bound 0.7868 3 232
6ffc-assembly1.cif.gz_A structure of an inhibitor-bound abc transporter 0.7814 3 232
7oj8-assembly1.cif.gz_A abcg2 e1s turnover-2 state 0.7775 3 232
7qba-assembly1.cif.gz_E cryoem structure of the abc transporter nosdfy complexed with nitrous oxide reductase nosz 0.7767 4 232
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7888 54 228 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7564 51 231 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7198 51 231 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5967 54 228 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5926 51 231 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A381U6P1-F1-model_v4 ABC-2 type transporter domain-containing protein 0.9879 54 237 GO:0005886
GO:0140359
AF-A0A1F7RU03-F1-model_v4 ABC transporter permease 0.9842 53 237 GO:0005886
GO:0140359
AF-A0A3B1BZC5-F1-model_v4 Gliding motility-associated ABC transporter permease protein GldF 0.9827 54 239 GO:0005886
GO:0140359
AF-A0A496TZP3-F1-model_v4 ABC transporter 0.9824 2 239 GO:0005886
GO:0140359
AF-A0A2H6EZX2-F1-model_v4 Inner membrane transport permease YbhR 0.9815 71 239 GO:0005886
GO:0140359

Map