F437706

General Info

Members Datasets Scaffolds Average Seq Length
412 199 824 51

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10124715|Ga0065704_101247152
Length 57
Sequence MPAKRTTHRSKSGTKLYAKRDAKGRFKDIQTFKRAHGQDIKRRSKAEGARKRAKKAR

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 2.43
Rhizosphere 96.6
Stem 0
Stem Tuber 0
Unclassified 19.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10124715 3300005289 Bacteria 1706
2 SwRhRL3b_contig_3456523 2162886006 Bacteria 1883
3 JGI25405J52794_10137129 3300003911 Unclassified 555
4 Ga0065715_10398038 3300005293 Bacteria 873
5 Ga0065715_10545963 3300005293 Bacteria 741
6 Ga0065707_10090428 3300005295 Bacteria 4140
7 Ga0070676_10081440 3300005328 Bacteria 1964
8 Ga0070666_10000422 3300005335 Bacteria 26218
9 Ga0070680_100419010 3300005336 Viruses 1142
10 Ga0070680_100847056 3300005336 Unclassified 788
11 Ga0070660_101707542 3300005339 Bacteria 536
12 Ga0070692_10196811 3300005345 Unclassified 1178
13 Ga0070668_100075295 3300005347 Bacteria 2635
14 Ga0070668_100088014 3300005347 Bacteria 2444
15 Ga0070669_100091320 3300005353 Bacteria 2283
16 Ga0070675_100940541 3300005354 Unclassified 793
17 Ga0070674_100232909 3300005356 Bacteria 1438
18 Ga0070673_100079370 3300005364 Bacteria 2657
19 Ga0070688_100381359 3300005365 Bacteria 1039
20 Ga0070659_100343899 3300005366 Bacteria 1250
21 Ga0070667_100005287 3300005367 Bacteria 10791
22 Ga0070703_10034026 3300005406 Bacteria 1553
23 Ga0070701_10150290 3300005438 Bacteria 1340
24 Ga0070705_100045018 3300005440 Bacteria 2537
25 Ga0070705_100594198 3300005440 Bacteria 855
26 Ga0070700_100387190 3300005441 Unclassified 1047
27 Ga0070694_100068850 3300005444 Bacteria 2433
28 Ga0070694_100372544 3300005444 Bacteria 1112
29 Ga0070694_100640353 3300005444 Unclassified 859
30 Ga0070694_100880140 3300005444 Unclassified 738
31 Ga0070708_100048488 3300005445 Bacteria 3754
32 Ga0070708_100215989 3300005445 Unclassified 1797
33 Ga0070708_101127097 3300005445 Bacteria 734
34 Ga0070708_101986767 3300005445 Bacteria 539
35 Ga0070663_100017778 3300005455 Bacteria 4649
36 Ga0070678_100127723 3300005456 Bacteria 2015
37 Ga0070662_100028302 3300005457 Bacteria 3898
38 Ga0070662_100860715 3300005457 Unclassified 772
39 Ga0070681_10035032 3300005458 Bacteria 5042
40 Ga0068867_100022645 3300005459 Bacteria 4493
41 Ga0068867_101100754 3300005459 Unclassified 725
42 Ga0070706_100078524 3300005467 Bacteria 3056
43 Ga0070706_100101202 3300005467 Bacteria 2678
44 Ga0070706_100406553 3300005467 Unclassified 1267
45 Ga0070707_100154798 3300005468 Unclassified 2233
46 Ga0070707_100337006 3300005468 Bacteria 1465
47 Ga0070707_100406639 3300005468 Bacteria 1321
48 Ga0070707_100455853 3300005468 Unclassified 1239
49 Ga0070698_100211577 3300005471 Unclassified 1873
50 Ga0070698_100717080 3300005471 Bacteria 943
51 Ga0070699_100262904 3300005518 Unclassified 1543
52 Ga0070699_100358444 3300005518 Bacteria 1314
53 Ga0070699_100994060 3300005518 Bacteria 769
54 Ga0070679_101536173 3300005530 Unclassified 613
55 Ga0070697_100027505 3300005536 Bacteria 4550
56 Ga0070697_100080094 3300005536 Bacteria 2690
57 Ga0070697_100164928 3300005536 Unclassified 1873
58 Ga0070697_100920036 3300005536 Bacteria 776
59 Ga0070697_101090480 3300005536 Bacteria 711
60 Ga0070672_100009282 3300005543 Bacteria 6776
61 Ga0070672_101844902 3300005543 Bacteria 544
62 Ga0070695_100216224 3300005545 Unclassified 1378
63 Ga0070695_100528308 3300005545 Bacteria 916
64 Ga0070696_100001928 3300005546 Bacteria 13672
65 Ga0070696_100564625 3300005546 Unclassified 913
66 Ga0070693_100078856 3300005547 Bacteria 1958
67 Ga0070665_100009691 3300005548 Bacteria 9733
68 Ga0070665_102509755 3300005548 Bacteria 517
69 Ga0070704_100016414 3300005549 Bacteria 4678
70 Ga0070704_100036858 3300005549 Bacteria 3335
71 Ga0070704_100104712 3300005549 Bacteria 2140
72 Ga0070704_101813762 3300005549 Bacteria 565
73 Ga0070704_102077462 3300005549 Bacteria 528
74 Ga0070704_102085711 3300005549 Bacteria 527
75 Ga0070664_100033959 3300005564 Bacteria 4277
76 Ga0068857_100216440 3300005577 Bacteria 1749
77 Ga0068854_100281679 3300005578 Unclassified 1339
78 Ga0068856_100007192 3300005614 Bacteria 10857
79 Ga0070702_100028173 3300005615 Bacteria 3042
80 Ga0070702_100210721 3300005615 Bacteria 1293
81 Ga0068852_100999460 3300005616 Bacteria 855
82 Ga0068859_100008604 3300005617 Bacteria 10318
83 Ga0068859_102674272 3300005617 Bacteria 548
84 Ga0068864_101635874 3300005618 Bacteria 648
85 Ga0068866_10597815 3300005718 Bacteria 744
86 Ga0068861_100008721 3300005719 Bacteria 6977
87 Ga0068870_10088916 3300005840 Bacteria 1723
88 Ga0068858_100001316 3300005842 Bacteria 25646
89 Ga0068860_100002581 3300005843 Bacteria 18960
90 Ga0068860_100700948 3300005843 Bacteria 1022
91 Ga0068862_100020732 3300005844 Bacteria 5490
92 Ga0081455_10217999 3300005937 Bacteria 1416
93 Ga0081538_10012506 3300005981 Bacteria 6800
94 Ga0081540_1046358 3300005983 Bacteria 2195
95 Ga0075365_10195053 3300006038 Bacteria 1418
96 Ga0075364_10635968 3300006051 Bacteria 729
97 Ga0070716_101300338 3300006173 Bacteria 588
98 Ga0075367_10952450 3300006178 Bacteria 548
99 Ga0097621_100030463 3300006237 Bacteria 4271
100 Ga0097621_100900151 3300006237 Unclassified 824
101 Ga0097621_101862744 3300006237 Unclassified 574
102 Ga0068871_100207541 3300006358 Bacteria 1693
103 Ga0068871_100611629 3300006358 Bacteria 992
104 Ga0068871_100785659 3300006358 Bacteria 877
105 Ga0075428_100036920 3300006844 Bacteria 5381
106 Ga0075428_100750107 3300006844 Viruses 1039
107 Ga0075428_101464009 3300006844 Bacteria 716
108 Ga0075431_100240754 3300006847 Bacteria 1841
109 Ga0075433_10095502 3300006852 Bacteria 2631
110 Ga0075433_11265435 3300006852 Bacteria 640
111 Ga0075433_11525720 3300006852 Unclassified 577
112 Ga0075434_100005533 3300006871 Bacteria 11504
113 Ga0075429_100130272 3300006880 Bacteria 2200
114 Ga0068865_100329169 3300006881 Bacteria 1231
115 Ga0097620_100008604 3300006931 Bacteria 10318
116 Ga0097620_102674331 3300006931 Bacteria 548
117 Ga0111539_10020879 3300009094 Bacteria 8065
118 Ga0111539_11969749 3300009094 Bacteria 677
119 Ga0105245_11808295 3300009098 Bacteria 664
120 Ga0105247_10065029 3300009101 Bacteria 2268
121 Ga0114129_10009524 3300009147 Bacteria 13855
122 Ga0114129_10051075 3300009147 Bacteria 5806
123 Ga0114129_10067853 3300009147 Bacteria 4973
124 Ga0114129_10110770 3300009147 Bacteria 3789
125 Ga0114129_10124380 3300009147 Bacteria 3547
126 Ga0114129_10316011 3300009147 Bacteria 2077
127 Ga0114129_10608709 3300009147 Bacteria 1415
128 Ga0114129_11855522 3300009147 Unclassified 732
129 Ga0114129_13006647 3300009147 Unclassified 554
130 Ga0105243_10373331 3300009148 Bacteria 1317
131 Ga0105241_10119201 3300009174 Bacteria 2123
132 Ga0105241_10835579 3300009174 Bacteria 851
133 Ga0105241_11766341 3300009174 Bacteria 603
134 Ga0105242_10736599 3300009176 Bacteria 969
135 Ga0105248_10003736 3300009177 Bacteria 16889
136 Ga0105248_11163309 3300009177 Bacteria 872
137 Ga0105248_11441430 3300009177 Bacteria 779
138 Ga0105249_10025787 3300009553 Bacteria 5294
139 Ga0105249_10165955 3300009553 Bacteria 2137
140 Ga0105249_10998122 3300009553 Bacteria 906
141 Ga0105249_13131461 3300009553 Unclassified 531
142 Ga0105030_100199 3300009987 Bacteria 5109
143 Ga0105246_10352312 3300011119 Bacteria 1207
144 Ga0157373_10402801 3300013100 Unclassified 981
145 Ga0157374_11772298 3300013296 Bacteria 642
146 Ga0157378_10034526 3300013297 Bacteria 4473
147 Ga0157378_11562268 3300013297 Unclassified 705
148 Ga0157375_10014265 3300013308 Bacteria 7083
149 Ga0157375_13532019 3300013308 Bacteria 520
150 Ga0163163_10720286 3300014325 Bacteria 1061
151 Ga0157380_10054717 3300014326 Bacteria 3167
152 Ga0157380_10225881 3300014326 Unclassified 1678
153 Ga0157380_12315635 3300014326 Bacteria 602
154 Ga0157379_10000926 3300014968 Bacteria 23706
155 Ga0157376_10207887 3300014969 Bacteria 1805
156 Ga0157376_11135151 3300014969 Unclassified 808
157 Ga0163161_10970404 3300017792 Bacteria 724
158 Ga0207653_10002637 3300025885 Bacteria 5694
159 Ga0207710_10652542 3300025900 Bacteria 551
160 Ga0207680_10000632 3300025903 Bacteria 16599
161 Ga0207645_10039226 3300025907 Bacteria 3035
162 Ga0207643_10557555 3300025908 Bacteria 735
163 Ga0207684_10002138 3300025910 Bacteria 20242
164 Ga0207684_10048599 3300025910 Bacteria 3598
165 Ga0207654_10269441 3300025911 Bacteria 1148
166 Ga0207707_11426960 3300025912 Unclassified 551
167 Ga0207660_10603149 3300025917 Unclassified 894
168 Ga0207657_10907122 3300025919 Bacteria 679
169 Ga0207649_10491744 3300025920 Bacteria 932
170 Ga0207652_11500604 3300025921 Unclassified 578
171 Ga0207646_10019038 3300025922 Bacteria 6391
172 Ga0207646_10128122 3300025922 Unclassified 2283
173 Ga0207646_10501151 3300025922 Bacteria 1094
174 Ga0207646_10949987 3300025922 Bacteria 761
175 Ga0207681_10204712 3300025923 Unclassified 1517
176 Ga0207650_10675996 3300025925 Unclassified 871
177 Ga0207659_10944089 3300025926 Unclassified 742
178 Ga0207687_11709900 3300025927 Unclassified 539
179 Ga0207690_10996617 3300025932 Unclassified 697
180 Ga0207706_10018455 3300025933 Bacteria 6276
181 Ga0207706_10910241 3300025933 Unclassified 742
182 Ga0207709_10210903 3300025935 Bacteria 1394
183 Ga0207669_10327476 3300025937 Bacteria 1175
184 Ga0207704_10465125 3300025938 Unclassified 1012
185 Ga0207691_10003791 3300025940 Bacteria 14671
186 Ga0207711_10000505 3300025941 Bacteria 40314
187 Ga0207711_10602113 3300025941 Unclassified 1025
188 Ga0207689_10086666 3300025942 Bacteria 2574
189 Ga0207679_10040467 3300025945 Bacteria 3337
190 Ga0207651_10585267 3300025960 Bacteria 974
191 Ga0207712_11160173 3300025961 Unclassified 689
192 Ga0207668_10313453 3300025972 Unclassified 1299
193 Ga0207640_11230897 3300025981 Unclassified 666
194 Ga0207658_10020491 3300025986 Bacteria 4578
195 Ga0207703_10111455 3300026035 Bacteria 2336
196 Ga0207678_10155244 3300026067 Bacteria 1954
197 Ga0207678_10327338 3300026067 Bacteria 1319
198 Ga0207708_10376463 3300026075 Bacteria 1170
199 Ga0207708_10662248 3300026075 Bacteria 889
200 Ga0207702_10079027 3300026078 Bacteria 2850
201 Ga0207648_10005684 3300026089 Bacteria 12509
202 Ga0207648_11078752 3300026089 Unclassified 753
203 Ga0207676_10165406 3300026095 Bacteria 1921
204 Ga0207674_10470829 3300026116 Bacteria 1214
205 Ga0207675_100001189 3300026118 Bacteria 25928
206 Ga0207683_10159578 3300026121 Bacteria 2038
207 Ga0207683_12031837 3300026121 Unclassified 523
208 Ga0207698_12318360 3300026142 Bacteria 549
209 Ga0207428_10096497 3300027907 Bacteria 2289
210 Ga0268266_10022137 3300028379 Bacteria 5417
211 Ga0268265_10071742 3300028380 Bacteria 2698
212 Ga0268265_11929124 3300028380 Bacteria 598
213 Ga0268264_10006119 3300028381 Bacteria 10166
214 Ga0268264_10341865 3300028381 Unclassified 1422
215 Ga0268264_10348045 3300028381 Bacteria 1410
216 Ga0307405_11780052 3300031731 Unclassified 547
217 Ga0316577_10027570 3300031733 Bacteria 3167
218 Ga0307411_10887930 3300032005 Unclassified 791
219 Ga0451577_1541651 3300042876 Unclassified 587
220 Ga0451576_0140247 3300045051 Bacteria 2521
221 Ga0451576_1182670 3300045051 Unclassified 799
222 Ga0495582_0261791 3300046473 Unclassified 992
223 Ga0495668_0349177 3300046616 Bacteria 812
224 Ga0495647_0023451 3300046681 Bacteria 2237
225 Ga0495658_0191291 3300046683 Bacteria 1272
226 Ga0496101_0020412 3300048904 Bacteria 4535
227 Ga0496102_0023383 3300048905 Bacteria 5488
228 Ga0496103_0024106 3300048906 Bacteria 3670
229 Ga0496106_0000918 3300048909 Bacteria 21419
230 Ga0496107_0014998 3300048910 Bacteria 5427
231 Ga0496108_0808255 3300048911 Unclassified 809
232 Ga0496109_0189002 3300048912 Bacteria 1935
233 Ga0496110_0124898 3300048913 Bacteria 2321
234 Ga0496113_0198549 3300048916 Bacteria 1594
235 Ga0496115_0168718 3300048918 Bacteria 1810
236 Ga0501291_073977 3300049514 Bacteria 666
237 Ga0501031_0485746 3300049568 Unclassified 797
238 Ga0501032_0033391 3300049569 Bacteria 3525
239 Ga0501032_0107800 3300049569 Bacteria 1844
240 Ga0501033_0125820 3300049570 Bacteria 1858
241 Ga0501033_0198296 3300049570 Bacteria 1434
242 Ga0501034_0044742 3300049571 Bacteria 4475
243 Ga0501034_0342949 3300049571 Bacteria 1423
244 Ga0501036_0025332 3300049572 Bacteria 5005
245 Ga0501036_0052708 3300049572 Bacteria 3446
246 Ga0501036_0055446 3300049572 Bacteria 3357
247 Ga0501036_0072308 3300049572 Bacteria 2915
248 Ga0501036_0371708 3300049572 Bacteria 1193
249 Ga0501036_0456116 3300049572 Unclassified 1065
250 Ga0501037_0007115 3300049573 Bacteria 8176
251 Ga0501037_0320427 3300049573 Bacteria 1073
252 Ga0501037_0351629 3300049573 Unclassified 1017
253 Ga0501037_0623411 3300049573 Bacteria 723
254 Ga0501038_0002894 3300049574 Bacteria 16007
255 Ga0501038_0055328 3300049574 Bacteria 3409
256 Ga0501038_0162954 3300049574 Bacteria 1810
257 Ga0501038_0785276 3300049574 Bacteria 708
258 Ga0501038_0931664 3300049574 Bacteria 640
259 Ga0501039_0010832 3300049575 Bacteria 6949
260 Ga0501039_0013012 3300049575 Bacteria 6360
261 Ga0501039_0377599 3300049575 Bacteria 1113
262 Ga0501040_0073440 3300049576 Bacteria 2363
263 Ga0501040_0122261 3300049576 Bacteria 1827
264 Ga0501040_0134845 3300049576 Bacteria 1738
265 Ga0501040_0847658 3300049576 Bacteria 662
266 Ga0501041_0043014 3300049577 Bacteria 2746
267 Ga0501041_0044095 3300049577 Unclassified 2711
268 Ga0501041_0350153 3300049577 Bacteria 933
269 Ga0501041_1066651 3300049577 Bacteria 520
270 Ga0501042_0053978 3300049578 Bacteria 2867
271 Ga0501042_0063322 3300049578 Bacteria 2643
272 Ga0501042_0091938 3300049578 Bacteria 2178
273 Ga0501042_0871728 3300049578 Unclassified 655
274 Ga0501043_0054934 3300049579 Bacteria 3128
275 Ga0501043_0088848 3300049579 Bacteria 2428
276 Ga0501043_0355255 3300049579 Bacteria 1113
277 Ga0501046_0020043 3300049580 Bacteria 5537
278 Ga0501046_0035630 3300049580 Bacteria 4009
279 Ga0501046_0061262 3300049580 Bacteria 2943
280 Ga0501047_0195534 3300049581 Bacteria 1885
281 Ga0501047_0196953 3300049581 Bacteria 1876
282 Ga0501047_0259000 3300049581 Bacteria 1587
283 Ga0501048_0017597 3300049582 Bacteria 5262
284 Ga0501048_0131238 3300049582 Bacteria 1771
285 Ga0501048_0207331 3300049582 Bacteria 1390
286 Ga0501048_0532907 3300049582 Unclassified 842
287 Ga0501048_0910506 3300049582 Bacteria 632
288 Ga0501067_0009022 3300049583 Bacteria 5526
289 Ga0501067_0044751 3300049583 Bacteria 2459
290 Ga0501067_0154313 3300049583 Bacteria 1279
291 Ga0501068_0054971 3300049584 Bacteria 2412
292 Ga0501068_0074286 3300049584 Bacteria 2078
293 Ga0501068_0140053 3300049584 Bacteria 1516
294 Ga0501068_0263073 3300049584 Unclassified 1100
295 Ga0501068_0274971 3300049584 Bacteria 1076
296 Ga0501069_0005260 3300049585 Bacteria 6721
297 Ga0501069_0068117 3300049585 Bacteria 1992
298 Ga0501069_0462105 3300049585 Bacteria 755
299 Ga0501069_0688102 3300049585 Unclassified 616
300 Ga0501070_0079666 3300049586 Bacteria 2710
301 Ga0501070_0278243 3300049586 Bacteria 1366
302 Ga0501070_0495663 3300049586 Bacteria 982
303 Ga0501070_0500282 3300049586 Bacteria 976
304 Ga0501070_0504837 3300049586 Bacteria 971
305 Ga0501071_0020633 3300049587 Bacteria 4582
306 Ga0501071_0155149 3300049587 Bacteria 1709
307 Ga0501071_0193372 3300049587 Bacteria 1526
308 Ga0501071_0873934 3300049587 Unclassified 693
309 Ga0501071_1409878 3300049587 Bacteria 538
310 Ga0501072_0003706 3300049588 Bacteria 11527
311 Ga0501072_0007046 3300049588 Bacteria 8534
312 Ga0501072_0327424 3300049588 Bacteria 1217
313 Ga0501072_0603267 3300049588 Bacteria 865
314 Ga0501072_0772614 3300049588 Unclassified 753
315 Ga0501072_0882565 3300049588 Bacteria 699
316 Ga0501073_0003363 3300049589 Bacteria 12015
317 Ga0501073_0011803 3300049589 Bacteria 6377
318 Ga0501073_0279670 3300049589 Bacteria 1151
319 Ga0501073_1030255 3300049589 Bacteria 566
320 Ga0501074_0002382 3300049590 Bacteria 13107
321 Ga0501074_0032525 3300049590 Bacteria 3779
322 Ga0501074_0060634 3300049590 Bacteria 2726
323 Ga0501074_0135610 3300049590 Unclassified 1761
324 Ga0501074_0896402 3300049590 Bacteria 624
325 Ga0501075_0000078 3300049591 Bacteria 43796
326 Ga0501075_0223430 3300049591 Bacteria 1436
327 Ga0501075_0303985 3300049591 Bacteria 1215
328 Ga0501075_0471249 3300049591 Unclassified 958
329 Ga0501075_0485350 3300049591 Bacteria 943
330 Ga0501075_0607487 3300049591 Bacteria 834
331 Ga0501075_1099586 3300049591 Bacteria 604
332 Ga0501076_0000002 3300049592 Bacteria 165396
333 Ga0501076_0000332 3300049592 Bacteria 29226
334 Ga0501076_0126242 3300049592 Bacteria 2073
335 Ga0501076_0148880 3300049592 Bacteria 1904
336 Ga0501076_0319998 3300049592 Unclassified 1272
337 Ga0501076_0518688 3300049592 Bacteria 982
338 Ga0501076_1728355 3300049592 Unclassified 513
339 Ga0501077_0013261 3300049593 Bacteria 5165
340 Ga0501077_0086152 3300049593 Bacteria 1991
341 Ga0501077_0100455 3300049593 Bacteria 1833
342 Ga0501077_1122609 3300049593 Bacteria 506
343 Ga0501079_0023367 3300049741 Bacteria 4745
344 Ga0501079_0112791 3300049741 Unclassified 2113
345 Ga0501079_0142504 3300049741 Bacteria 1867
346 Ga0501079_0190457 3300049741 Bacteria 1601
347 Ga0501079_0726271 3300049741 Bacteria 782
348 Ga0501080_0001882 3300049742 Bacteria 18048
349 Ga0501080_0101707 3300049742 Bacteria 2666
350 Ga0501080_0223006 3300049742 Bacteria 1724
351 Ga0501080_0324805 3300049742 Bacteria 1392
352 Ga0501080_0509183 3300049742 Bacteria 1075
353 Ga0501080_0671721 3300049742 Bacteria 915
354 Ga0501080_0873315 3300049742 Bacteria 785
355 Ga0501081_0079309 3300049743 Bacteria 2296
356 Ga0501081_0154264 3300049743 Bacteria 1651
357 Ga0501081_0253956 3300049743 Bacteria 1284
358 Ga0501081_0406281 3300049743 Unclassified 1008
359 Ga0501083_0043815 3300049744 Bacteria 3031
360 Ga0501083_0129064 3300049744 Bacteria 1657
361 Ga0501083_0526877 3300049744 Bacteria 769
362 Ga0501083_0681334 3300049744 Bacteria 669
363 Ga0501035_0169367 3300049822 Bacteria 1887
364 Ga0501035_0262816 3300049822 Bacteria 1463
365 Ga0501044_0000458 3300049823 Bacteria 49695
366 Ga0501044_0071769 3300049823 Bacteria 3520
367 Ga0501044_0331451 3300049823 Bacteria 1444
368 Ga0501044_1005197 3300049823 Unclassified 706
369 Ga0501045_0061694 3300049824 Bacteria 2751
370 Ga0501045_0064781 3300049824 Bacteria 2683
371 Ga0501045_0332623 3300049824 Unclassified 1130
372 Ga0501045_0619913 3300049824 Unclassified 800
373 Ga0501045_1195426 3300049824 Bacteria 555
374 Ga0501045_1318834 3300049824 Bacteria 525
375 nmdc:mga0yw44_153910_c1 3300050492 Bacteria 1501
376 nmdc:mga05p37_1520001_c1 3300050507 Unclassified 665
377 nmdc:mga05p37_1586283_c1 3300050507 Unclassified 646
378 nmdc:mga05p37_2222_c1 3300050507 Bacteria 22625
379 nmdc:mga05p37_272993_c1 3300050507 Bacteria 1687
380 nmdc:mga05p37_389706_c1 3300050507 Bacteria 1630
381 nmdc:mga05p37_400506_c1 3300050507 Bacteria 1603
382 nmdc:mga05p37_58172_c1 3300050507 Bacteria 4761
383 nmdc:mga05p37_7633_c1 3300050507 Bacteria 12764
384 nmdc:mga09592_1687694_c1 3300050508 Unclassified 511
385 nmdc:mga08y16_119053_c1 3300050511 Bacteria 2749
386 nmdc:mga0n895_23812_c1 3300050512 Bacteria 5761
387 nmdc:mga0a205_80696_c1 3300050515 Bacteria 3143
388 Ga0501084_0007063 3300054114 Bacteria 9253
389 Ga0501084_0014260 3300054114 Bacteria 6583
390 Ga0501084_0129063 3300054114 Unclassified 2128
391 Ga0501084_0312337 3300054114 Bacteria 1327
392 Ga0501084_0354557 3300054114 Bacteria 1239
393 Ga0501084_0434172 3300054114 Unclassified 1110
394 Ga0501084_0587778 3300054114 Bacteria 941
395 Ga0501084_1010467 3300054114 Bacteria 699
396 Ga0590077_006229 3300059426 Bacteria 2446
397 Ga0501082_0000079 3300060353 Bacteria 71956
398 Ga0501082_0002441 3300060353 Bacteria 16312
399 Ga0501082_0027010 3300060353 Bacteria 4946
400 Ga0501082_0096895 3300060353 Unclassified 2550
401 Ga0501082_0284452 3300060353 Bacteria 1439
402 Ga0501082_0389806 3300060353 Bacteria 1215
403 Ga0501082_1177612 3300060353 Bacteria 670
404 Ga0501082_1251750 3300060353 Unclassified 648
405 Ga0501082_1446511 3300060353 Bacteria 600
406 Ga0530510_0000024 3300061734 Bacteria 68684
407 Ga0530510_0001411 3300061734 Bacteria 16097
408 Ga0530510_0029514 3300061734 Bacteria 3937
409 Ga0530510_0153981 3300061734 Bacteria 1698
410 Ga0530510_0545071 3300061734 Unclassified 881
411 Ga0530510_0742675 3300061734 Unclassified 748
412 Ga0530510_1123331 3300061734 Bacteria 602
413 Ga0065704_10124715
414 SwRhRL3b_contig_3456523
415 JGI25405J52794_10137129
416 Ga0065715_10398038
417 Ga0065715_10545963
418 Ga0065707_10090428
419 Ga0070676_10081440
420 Ga0070666_10000422
421 Ga0070680_100419010
422 Ga0070680_100847056
423 Ga0070660_101707542
424 Ga0070692_10196811
425 Ga0070668_100075295
426 Ga0070668_100088014
427 Ga0070669_100091320
428 Ga0070675_100940541
429 Ga0070674_100232909
430 Ga0070673_100079370
431 Ga0070688_100381359
432 Ga0070659_100343899
433 Ga0070667_100005287
434 Ga0070703_10034026
435 Ga0070701_10150290
436 Ga0070705_100045018
437 Ga0070705_100594198
438 Ga0070700_100387190
439 Ga0070694_100068850
440 Ga0070694_100372544
441 Ga0070694_100640353
442 Ga0070694_100880140
443 Ga0070708_100048488
444 Ga0070708_100215989
445 Ga0070708_101127097
446 Ga0070708_101986767
447 Ga0070663_100017778
448 Ga0070678_100127723
449 Ga0070662_100028302
450 Ga0070662_100860715
451 Ga0070681_10035032
452 Ga0068867_100022645
453 Ga0068867_101100754
454 Ga0070706_100078524
455 Ga0070706_100101202
456 Ga0070706_100406553
457 Ga0070707_100154798
458 Ga0070707_100337006
459 Ga0070707_100406639
460 Ga0070707_100455853
461 Ga0070698_100211577
462 Ga0070698_100717080
463 Ga0070699_100262904
464 Ga0070699_100358444
465 Ga0070699_100994060
466 Ga0070679_101536173
467 Ga0070697_100027505
468 Ga0070697_100080094
469 Ga0070697_100164928
470 Ga0070697_100920036
471 Ga0070697_101090480
472 Ga0070672_100009282
473 Ga0070672_101844902
474 Ga0070695_100216224
475 Ga0070695_100528308
476 Ga0070696_100001928
477 Ga0070696_100564625
478 Ga0070693_100078856
479 Ga0070665_100009691
480 Ga0070665_102509755
481 Ga0070704_100016414
482 Ga0070704_100036858
483 Ga0070704_100104712
484 Ga0070704_101813762
485 Ga0070704_102077462
486 Ga0070704_102085711
487 Ga0070664_100033959
488 Ga0068857_100216440
489 Ga0068854_100281679
490 Ga0068856_100007192
491 Ga0070702_100028173
492 Ga0070702_100210721
493 Ga0068852_100999460
494 Ga0068859_100008604
495 Ga0068859_102674272
496 Ga0068864_101635874
497 Ga0068866_10597815
498 Ga0068861_100008721
499 Ga0068870_10088916
500 Ga0068858_100001316
501 Ga0068860_100002581
502 Ga0068860_100700948
503 Ga0068862_100020732
504 Ga0081455_10217999
505 Ga0081538_10012506
506 Ga0081540_1046358
507 Ga0075365_10195053
508 Ga0075364_10635968
509 Ga0070716_101300338
510 Ga0075367_10952450
511 Ga0097621_100030463
512 Ga0097621_100900151
513 Ga0097621_101862744
514 Ga0068871_100207541
515 Ga0068871_100611629
516 Ga0068871_100785659
517 Ga0075428_100036920
518 Ga0075428_100750107
519 Ga0075428_101464009
520 Ga0075431_100240754
521 Ga0075433_10095502
522 Ga0075433_11265435
523 Ga0075433_11525720
524 Ga0075434_100005533
525 Ga0075429_100130272
526 Ga0068865_100329169
527 Ga0097620_100008604
528 Ga0097620_102674331
529 Ga0111539_10020879
530 Ga0111539_11969749
531 Ga0105245_11808295
532 Ga0105247_10065029
533 Ga0114129_10009524
534 Ga0114129_10051075
535 Ga0114129_10067853
536 Ga0114129_10110770
537 Ga0114129_10124380
538 Ga0114129_10316011
539 Ga0114129_10608709
540 Ga0114129_11855522
541 Ga0114129_13006647
542 Ga0105243_10373331
543 Ga0105241_10119201
544 Ga0105241_10835579
545 Ga0105241_11766341
546 Ga0105242_10736599
547 Ga0105248_10003736
548 Ga0105248_11163309
549 Ga0105248_11441430
550 Ga0105249_10025787
551 Ga0105249_10165955
552 Ga0105249_10998122
553 Ga0105249_13131461
554 Ga0105030_100199
555 Ga0105246_10352312
556 Ga0157373_10402801
557 Ga0157374_11772298
558 Ga0157378_10034526
559 Ga0157378_11562268
560 Ga0157375_10014265
561 Ga0157375_13532019
562 Ga0163163_10720286
563 Ga0157380_10054717
564 Ga0157380_10225881
565 Ga0157380_12315635
566 Ga0157379_10000926
567 Ga0157376_10207887
568 Ga0157376_11135151
569 Ga0163161_10970404
570 Ga0207653_10002637
571 Ga0207710_10652542
572 Ga0207680_10000632
573 Ga0207645_10039226
574 Ga0207643_10557555
575 Ga0207684_10002138
576 Ga0207684_10048599
577 Ga0207654_10269441
578 Ga0207707_11426960
579 Ga0207660_10603149
580 Ga0207657_10907122
581 Ga0207649_10491744
582 Ga0207652_11500604
583 Ga0207646_10019038
584 Ga0207646_10128122
585 Ga0207646_10501151
586 Ga0207646_10949987
587 Ga0207681_10204712
588 Ga0207650_10675996
589 Ga0207659_10944089
590 Ga0207687_11709900
591 Ga0207690_10996617
592 Ga0207706_10018455
593 Ga0207706_10910241
594 Ga0207709_10210903
595 Ga0207669_10327476
596 Ga0207704_10465125
597 Ga0207691_10003791
598 Ga0207711_10000505
599 Ga0207711_10602113
600 Ga0207689_10086666
601 Ga0207679_10040467
602 Ga0207651_10585267
603 Ga0207712_11160173
604 Ga0207668_10313453
605 Ga0207640_11230897
606 Ga0207658_10020491
607 Ga0207703_10111455
608 Ga0207678_10155244
609 Ga0207678_10327338
610 Ga0207708_10376463
611 Ga0207708_10662248
612 Ga0207702_10079027
613 Ga0207648_10005684
614 Ga0207648_11078752
615 Ga0207676_10165406
616 Ga0207674_10470829
617 Ga0207675_100001189
618 Ga0207683_10159578
619 Ga0207683_12031837
620 Ga0207698_12318360
621 Ga0207428_10096497
622 Ga0268266_10022137
623 Ga0268265_10071742
624 Ga0268265_11929124
625 Ga0268264_10006119
626 Ga0268264_10341865
627 Ga0268264_10348045
628 Ga0307405_11780052
629 Ga0316577_10027570
630 Ga0307411_10887930
631 Ga0451577_1541651
632 Ga0451576_0140247
633 Ga0451576_1182670
634 Ga0495582_0261791
635 Ga0495668_0349177
636 Ga0495647_0023451
637 Ga0495658_0191291
638 Ga0496101_0020412
639 Ga0496102_0023383
640 Ga0496103_0024106
641 Ga0496106_0000918
642 Ga0496107_0014998
643 Ga0496108_0808255
644 Ga0496109_0189002
645 Ga0496110_0124898
646 Ga0496113_0198549
647 Ga0496115_0168718
648 Ga0501291_073977
649 Ga0501031_0485746
650 Ga0501032_0033391
651 Ga0501032_0107800
652 Ga0501033_0125820
653 Ga0501033_0198296
654 Ga0501034_0044742
655 Ga0501034_0342949
656 Ga0501036_0025332
657 Ga0501036_0052708
658 Ga0501036_0055446
659 Ga0501036_0072308
660 Ga0501036_0371708
661 Ga0501036_0456116
662 Ga0501037_0007115
663 Ga0501037_0320427
664 Ga0501037_0351629
665 Ga0501037_0623411
666 Ga0501038_0002894
667 Ga0501038_0055328
668 Ga0501038_0162954
669 Ga0501038_0785276
670 Ga0501038_0931664
671 Ga0501039_0010832
672 Ga0501039_0013012
673 Ga0501039_0377599
674 Ga0501040_0073440
675 Ga0501040_0122261
676 Ga0501040_0134845
677 Ga0501040_0847658
678 Ga0501041_0043014
679 Ga0501041_0044095
680 Ga0501041_0350153
681 Ga0501041_1066651
682 Ga0501042_0053978
683 Ga0501042_0063322
684 Ga0501042_0091938
685 Ga0501042_0871728
686 Ga0501043_0054934
687 Ga0501043_0088848
688 Ga0501043_0355255
689 Ga0501046_0020043
690 Ga0501046_0035630
691 Ga0501046_0061262
692 Ga0501047_0195534
693 Ga0501047_0196953
694 Ga0501047_0259000
695 Ga0501048_0017597
696 Ga0501048_0131238
697 Ga0501048_0207331
698 Ga0501048_0532907
699 Ga0501048_0910506
700 Ga0501067_0009022
701 Ga0501067_0044751
702 Ga0501067_0154313
703 Ga0501068_0054971
704 Ga0501068_0074286
705 Ga0501068_0140053
706 Ga0501068_0263073
707 Ga0501068_0274971
708 Ga0501069_0005260
709 Ga0501069_0068117
710 Ga0501069_0462105
711 Ga0501069_0688102
712 Ga0501070_0079666
713 Ga0501070_0278243
714 Ga0501070_0495663
715 Ga0501070_0500282
716 Ga0501070_0504837
717 Ga0501071_0020633
718 Ga0501071_0155149
719 Ga0501071_0193372
720 Ga0501071_0873934
721 Ga0501071_1409878
722 Ga0501072_0003706
723 Ga0501072_0007046
724 Ga0501072_0327424
725 Ga0501072_0603267
726 Ga0501072_0772614
727 Ga0501072_0882565
728 Ga0501073_0003363
729 Ga0501073_0011803
730 Ga0501073_0279670
731 Ga0501073_1030255
732 Ga0501074_0002382
733 Ga0501074_0032525
734 Ga0501074_0060634
735 Ga0501074_0135610
736 Ga0501074_0896402
737 Ga0501075_0000078
738 Ga0501075_0223430
739 Ga0501075_0303985
740 Ga0501075_0471249
741 Ga0501075_0485350
742 Ga0501075_0607487
743 Ga0501075_1099586
744 Ga0501076_0000002
745 Ga0501076_0000332
746 Ga0501076_0126242
747 Ga0501076_0148880
748 Ga0501076_0319998
749 Ga0501076_0518688
750 Ga0501076_1728355
751 Ga0501077_0013261
752 Ga0501077_0086152
753 Ga0501077_0100455
754 Ga0501077_1122609
755 Ga0501079_0023367
756 Ga0501079_0112791
757 Ga0501079_0142504
758 Ga0501079_0190457
759 Ga0501079_0726271
760 Ga0501080_0001882
761 Ga0501080_0101707
762 Ga0501080_0223006
763 Ga0501080_0324805
764 Ga0501080_0509183
765 Ga0501080_0671721
766 Ga0501080_0873315
767 Ga0501081_0079309
768 Ga0501081_0154264
769 Ga0501081_0253956
770 Ga0501081_0406281
771 Ga0501083_0043815
772 Ga0501083_0129064
773 Ga0501083_0526877
774 Ga0501083_0681334
775 Ga0501035_0169367
776 Ga0501035_0262816
777 Ga0501044_0000458
778 Ga0501044_0071769
779 Ga0501044_0331451
780 Ga0501044_1005197
781 Ga0501045_0061694
782 Ga0501045_0064781
783 Ga0501045_0332623
784 Ga0501045_0619913
785 Ga0501045_1195426
786 Ga0501045_1318834
787 nmdc:mga0yw44_153910_c1
788 nmdc:mga05p37_1520001_c1
789 nmdc:mga05p37_1586283_c1
790 nmdc:mga05p37_2222_c1
791 nmdc:mga05p37_272993_c1
792 nmdc:mga05p37_389706_c1
793 nmdc:mga05p37_400506_c1
794 nmdc:mga05p37_58172_c1
795 nmdc:mga05p37_7633_c1
796 nmdc:mga09592_1687694_c1
797 nmdc:mga08y16_119053_c1
798 nmdc:mga0n895_23812_c1
799 nmdc:mga0a205_80696_c1
800 Ga0501084_0007063
801 Ga0501084_0014260
802 Ga0501084_0129063
803 Ga0501084_0312337
804 Ga0501084_0354557
805 Ga0501084_0434172
806 Ga0501084_0587778
807 Ga0501084_1010467
808 Ga0590077_006229
809 Ga0501082_0000079
810 Ga0501082_0002441
811 Ga0501082_0027010
812 Ga0501082_0096895
813 Ga0501082_0284452
814 Ga0501082_0389806
815 Ga0501082_1177612
816 Ga0501082_1251750
817 Ga0501082_1446511
818 Ga0530510_0000024
819 Ga0530510_0001411
820 Ga0530510_0029514
821 Ga0530510_0153981
822 Ga0530510_0545071
823 Ga0530510_0742675
824 Ga0530510_1123331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map