F437602

General Info

Members Datasets Scaffolds Average Seq Length
411 239 408 266

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0120061|Ga0495641_0120061_262_1119
Length 285
Sequence LSLKVTLLGTGTSQGVPMIGCGCAVCQSTDPRDRRSRPSIFIEVVGELAEPLPEAASAVRHVLVDTSPDLRTQALARGIQRVDAILFTHSHADHIMGMDDVRRFNAIQGGAIPAYADERTAGDLRRAFSYVFTPPDQKGGGVPQLELSTIDGRFNVGSVGIEPVPIFHGLRPILGFRFGSFAYVTDCNRMTDAAWSILAGVDVLILGALRYRPHPTHFTVSEALQVVEALKPRQSFFTHICHDLPHAATNAALPPGVALAHDGLKFDVEVAAAFAPAEVAERKWT

Samples

Sample ID Description Type Environment
1 2773857925 Microvirga vignae BR3299 Isolate Unclassified
2 2842694124 Methylopila sp. R-72369 Isolate Unclassified
3 2909042592 Labrys sp. LIt4 Isolate Nodule
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.24
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.84
Nodule 0.24
Rhizoplane 15.33
Rhizosphere 76.4
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10003737 3300002244 Bacteria 2471
2 JGI25406J46586_10009199 3300003203 Bacteria 4430
3 Ga0070676_10197258 3300005328 Bacteria 1318
4 Ga0070690_100012848 3300005330 Bacteria 4935
5 Ga0070670_100077104 3300005331 Bacteria 2864
6 Ga0070670_100251756 3300005331 Bacteria 1539
7 Ga0070680_100192312 3300005336 Bacteria 1719
8 Ga0068868_100007445 3300005338 Bacteria 7795
9 Ga0070689_100011289 3300005340 Bacteria 6395
10 Ga0070689_100362515 3300005340 Bacteria 1218
11 Ga0070687_100001322 3300005343 Bacteria 8663
12 Ga0070692_10045998 3300005345 Bacteria 2253
13 Ga0070668_100012197 3300005347 Bacteria 6401
14 Ga0070669_100023889 3300005353 Bacteria 4380
15 Ga0070675_100029570 3300005354 Bacteria 4420
16 Ga0070674_100002023 3300005356 Bacteria 11113
17 Ga0070673_100030271 3300005364 Bacteria 4047
18 Ga0070667_100006086 3300005367 Bacteria 10016
19 Ga0070667_100077143 3300005367 Bacteria 2845
20 Ga0070703_10016668 3300005406 Bacteria 2110
21 Ga0070709_10014990 3300005434 Bacteria 4400
22 Ga0070714_100000098 3300005435 Bacteria 74167
23 Ga0070714_100060306 3300005435 Bacteria 3255
24 Ga0070714_100074934 3300005435 Bacteria 2935
25 Ga0070713_100014283 3300005436 Bacteria 5891
26 Ga0070713_100332770 3300005436 Bacteria 1405
27 Ga0070710_10091423 3300005437 Bacteria 1796
28 Ga0070701_10000544 3300005438 Bacteria 12999
29 Ga0070701_10041960 3300005438 Bacteria 2333
30 Ga0070711_100047236 3300005439 Bacteria 2938
31 Ga0070705_100009336 3300005440 Bacteria 4873
32 Ga0070663_100023145 3300005455 Bacteria 4161
33 Ga0070663_100299256 3300005455 Bacteria 1287
34 Ga0070678_100135016 3300005456 Bacteria 1966
35 Ga0070662_100006609 3300005457 Bacteria 7486
36 Ga0068867_100006600 3300005459 Bacteria 8201
37 Ga0070685_10001171 3300005466 Bacteria 14029
38 Ga0070707_100227453 3300005468 Bacteria 1816
39 Ga0070707_100371401 3300005468 Unclassified 1390
40 Ga0070698_100237818 3300005471 Bacteria 1754
41 Ga0070698_100469481 3300005471 Bacteria 1195
42 Ga0070679_100158376 3300005530 Bacteria 2238
43 Ga0070684_100101853 3300005535 Bacteria 2566
44 Ga0070684_100102665 3300005535 Bacteria 2557
45 Ga0070672_100007959 3300005543 Bacteria 7240
46 Ga0070686_100035432 3300005544 Bacteria 3082
47 Ga0070664_100135186 3300005564 Bacteria 2168
48 Ga0070664_100154894 3300005564 Bacteria 2024
49 Ga0068857_100125155 3300005577 Bacteria 2316
50 Ga0068854_100028596 3300005578 Bacteria 3854
51 Ga0068856_100049795 3300005614 Bacteria 4129
52 Ga0070702_100003914 3300005615 Bacteria 6751
53 Ga0070702_100233429 3300005615 Bacteria 1237
54 Ga0068859_100602845 3300005617 Bacteria 1191
55 Ga0068864_100002387 3300005618 Bacteria 15520
56 Ga0068866_10005160 3300005718 Bacteria 5382
57 Ga0068861_100058391 3300005719 Bacteria 2950
58 Ga0068870_10001771 3300005840 Bacteria 8848
59 Ga0068863_100007012 3300005841 Bacteria 11043
60 Ga0068863_100147910 3300005841 Bacteria 2247
61 Ga0068863_100619338 3300005841 Bacteria 1072
62 Ga0068858_100005914 3300005842 Bacteria 11940
63 Ga0068860_100078622 3300005843 Bacteria 3136
64 Ga0068862_100014438 3300005844 Bacteria 6553
65 Ga0068862_100201934 3300005844 Bacteria 1793
66 Ga0081455_10000769 3300005937 Bacteria 41419
67 Ga0081455_10007568 3300005937 Bacteria 11418
68 Ga0081455_10014052 3300005937 Bacteria 7869
69 Ga0081455_10180660 3300005937 Bacteria 1598
70 Ga0081538_10006193 3300005981 Bacteria 10600
71 Ga0081538_10031838 3300005981 Bacteria 3548
72 Ga0081540_1004744 3300005983 Bacteria 10280
73 Ga0081539_10006007 3300005985 Bacteria 11928
74 Ga0075365_10015836 3300006038 Bacteria 4569
75 Ga0075365_10021113 3300006038 Bacteria 4055
76 Ga0075365_10036632 3300006038 Bacteria 3179
77 Ga0075365_10064979 3300006038 Bacteria 2445
78 Ga0075363_100100103 3300006048 Bacteria 1603
79 Ga0075364_10085610 3300006051 Bacteria 2087
80 Ga0070712_100004631 3300006175 Bacteria 8501
81 Ga0070712_100070468 3300006175 Bacteria 2498
82 Ga0070712_100071675 3300006175 Bacteria 2480
83 Ga0075362_10075657 3300006177 Bacteria 1544
84 Ga0075366_10001525 3300006195 Bacteria 11575
85 Ga0075366_10284305 3300006195 Bacteria 1011
86 Ga0097621_100030663 3300006237 Bacteria 4260
87 Ga0097621_100194365 3300006237 Bacteria 1758
88 Ga0068871_100016532 3300006358 Bacteria 5561
89 Ga0068871_100529338 3300006358 Bacteria 1065
90 Ga0075428_100001218 3300006844 Bacteria 27549
91 Ga0075428_100022676 3300006844 Bacteria 6949
92 Ga0075428_100038529 3300006844 Bacteria 5261
93 Ga0075428_100482070 3300006844 Bacteria 1327
94 Ga0075430_100000152 3300006846 Bacteria 44881
95 Ga0075430_100200171 3300006846 Bacteria 1659
96 Ga0075431_100000613 3300006847 Bacteria 30137
97 Ga0075431_100147618 3300006847 Bacteria 2423
98 Ga0075431_100165174 3300006847 Bacteria 2275
99 Ga0075431_100322363 3300006847 Bacteria 1558
100 Ga0075431_100559605 3300006847 Bacteria 1130
101 Ga0075431_100648260 3300006847 Bacteria 1037
102 Ga0075433_10277004 3300006852 Bacteria 1486
103 Ga0075434_100057828 3300006871 Bacteria 3854
104 Ga0075434_100159446 3300006871 Bacteria 2276
105 Ga0075429_100068661 3300006880 Bacteria 3085
106 Ga0075429_100119479 3300006880 Bacteria 2303
107 Ga0075429_100183680 3300006880 Bacteria 1833
108 Ga0068865_100013020 3300006881 Bacteria 5245
109 Ga0097620_100602888 3300006931 Bacteria 1191
110 Ga0099794_10003112 3300007265 Bacteria 6280
111 Ga0099795_10020860 3300007788 Bacteria 2141
112 Ga0105250_10069574 3300009092 Bacteria 1421
113 Ga0111539_10000840 3300009094 Bacteria 39968
114 Ga0111539_10041700 3300009094 Bacteria 5516
115 Ga0111539_10149694 3300009094 Bacteria 2732
116 Ga0111539_10160838 3300009094 Bacteria 2626
117 Ga0111539_10321254 3300009094 Bacteria 1801
118 Ga0111539_10653858 3300009094 Bacteria 1224
119 Ga0105245_10049519 3300009098 Bacteria 3763
120 Ga0105247_10011483 3300009101 Bacteria 5339
121 Ga0105247_10242400 3300009101 Bacteria 1229
122 Ga0114129_10000320 3300009147 Bacteria 56319
123 Ga0114129_10002097 3300009147 Bacteria 27432
124 Ga0114129_10034224 3300009147 Bacteria 7175
125 Ga0114129_10072986 3300009147 Bacteria 4782
126 Ga0114129_10267374 3300009147 Bacteria 2289
127 Ga0114129_10390717 3300009147 Bacteria 1835
128 Ga0114129_10830643 3300009147 Bacteria 1176
129 Ga0114129_10963600 3300009147 Bacteria 1077
130 Ga0105243_10060278 3300009148 Bacteria 3031
131 Ga0105243_10115614 3300009148 Bacteria 2253
132 Ga0105242_10521194 3300009176 Bacteria 1134
133 Ga0105248_10025028 3300009177 Bacteria 6635
134 Ga0105248_10058984 3300009177 Bacteria 4310
135 Ga0105248_10118323 3300009177 Bacteria 2989
136 Ga0105248_10345414 3300009177 Bacteria 1675
137 Ga0105237_10032626 3300009545 Bacteria 5272
138 Ga0105238_10114452 3300009551 Bacteria 2677
139 Ga0105249_10032441 3300009553 Bacteria 4725
140 Ga0105249_10330749 3300009553 Bacteria 1537
141 Ga0105239_10076217 3300010375 Bacteria 3688
142 Ga0105239_10173497 3300010375 Bacteria 2412
143 Ga0157369_10130337 3300013105 Bacteria 2665
144 Ga0157374_10013392 3300013296 Bacteria 7160
145 Ga0157378_10014031 3300013297 Bacteria 7014
146 Ga0163162_11058638 3300013306 Bacteria 918
147 Ga0157375_10029995 3300013308 Bacteria 5121
148 Ga0163163_10026389 3300014325 Bacteria 5552
149 Ga0157380_10003106 3300014326 Bacteria 11331
150 Ga0157380_10028029 3300014326 Bacteria 4290
151 Ga0157380_10233285 3300014326 Bacteria 1654
152 Ga0157377_10011739 3300014745 Bacteria 4381
153 Ga0157377_10197048 3300014745 Bacteria 1276
154 Ga0157379_10002037 3300014968 Bacteria 16773
155 Ga0157376_10017818 3300014969 Bacteria 5428
156 Ga0157376_10051761 3300014969 Bacteria 3412
157 Ga0163161_10005982 3300017792 Bacteria 8433
158 Ga0213876_10007625 3300021384 Bacteria 5876
159 Ga0213875_10000007 3300021388 Bacteria 562717
160 Ga0213875_10140745 3300021388 Bacteria 1129
161 Ga0224572_1002407 3300024225 Bacteria 3011
162 Ga0207653_10034021 3300025885 Bacteria 1654
163 Ga0207642_10008872 3300025899 Bacteria 3473
164 Ga0207710_10064952 3300025900 Bacteria 1663
165 Ga0207688_10000130 3300025901 Bacteria 31681
166 Ga0207647_10002385 3300025904 Bacteria 14262
167 Ga0207645_10032401 3300025907 Bacteria 3359
168 Ga0207643_10001538 3300025908 Bacteria 13167
169 Ga0207671_10038954 3300025914 Bacteria 3521
170 Ga0207693_10016124 3300025915 Bacteria 5979
171 Ga0207693_10258173 3300025915 Bacteria 1366
172 Ga0207693_10516415 3300025915 Bacteria 932
173 Ga0207663_10587863 3300025916 Bacteria 874
174 Ga0207660_10465558 3300025917 Bacteria 1023
175 Ga0207662_10009228 3300025918 Bacteria 5421
176 Ga0207662_10120031 3300025918 Bacteria 1648
177 Ga0207657_10015944 3300025919 Bacteria 7259
178 Ga0207649_10059241 3300025920 Bacteria 2401
179 Ga0207681_10017150 3300025923 Bacteria 4543
180 Ga0207650_10004418 3300025925 Bacteria 9604
181 Ga0207687_10110352 3300025927 Bacteria 2040
182 Ga0207664_10000663 3300025929 Bacteria 23701
183 Ga0207664_10045973 3300025929 Bacteria 3425
184 Ga0207664_10048956 3300025929 Bacteria 3326
185 Ga0207664_10546176 3300025929 Bacteria 1039
186 Ga0207644_10035067 3300025931 Bacteria 3513
187 Ga0207690_10080463 3300025932 Bacteria 2274
188 Ga0207706_10002801 3300025933 Bacteria 16940
189 Ga0207686_10121085 3300025934 Bacteria 1781
190 Ga0207669_10006157 3300025937 Bacteria 5457
191 Ga0207704_10003655 3300025938 Bacteria 6989
192 Ga0207665_10074411 3300025939 Bacteria 2325
193 Ga0207665_10205241 3300025939 Bacteria 1437
194 Ga0207691_10000921 3300025940 Bacteria 29187
195 Ga0207711_10246408 3300025941 Bacteria 1639
196 Ga0207711_10460192 3300025941 Bacteria 1184
197 Ga0207689_10000756 3300025942 Bacteria 31021
198 Ga0207661_10088984 3300025944 Bacteria 2568
199 Ga0207667_10222284 3300025949 Bacteria 1935
200 Ga0207651_10060456 3300025960 Bacteria 2630
201 Ga0207668_10033558 3300025972 Bacteria 3401
202 Ga0207658_10196635 3300025986 Bacteria 1680
203 Ga0207658_10207338 3300025986 Bacteria 1640
204 Ga0207677_10012844 3300026023 Bacteria 4834
205 Ga0207703_10011569 3300026035 Bacteria 6861
206 Ga0207678_10002027 3300026067 Bacteria 18385
207 Ga0207678_10349535 3300026067 Bacteria 1275
208 Ga0207708_10000567 3300026075 Bacteria 28570
209 Ga0207708_10168254 3300026075 Bacteria 1734
210 Ga0207702_10093193 3300026078 Bacteria 2641
211 Ga0207648_10009209 3300026089 Bacteria 9483
212 Ga0207648_10096051 3300026089 Bacteria 2593
213 Ga0207676_10007771 3300026095 Bacteria 7625
214 Ga0207675_100004438 3300026118 Bacteria 13564
215 Ga0207675_100457449 3300026118 Bacteria 1265
216 Ga0207683_10015749 3300026121 Bacteria 6434
217 Ga0207698_10489811 3300026142 Bacteria 1194
218 Ga0207428_10005811 3300027907 Bacteria 11439
219 Ga0207428_10078394 3300027907 Bacteria 2585
220 Ga0268266_10214311 3300028379 Bacteria 1767
221 Ga0268265_10153743 3300028380 Bacteria 1944
222 Ga0268264_10047473 3300028381 Bacteria 3570
223 Ga0265338_10041131 3300028800 Bacteria 4328
224 Ga0265338_10079787 3300028800 Bacteria 2753
225 Ga0265760_10016690 3300031090 Bacteria 2108
226 Ga0265325_10042203 3300031241 Bacteria 2386
227 Ga0265325_10108287 3300031241 Bacteria 1353
228 Ga0265339_10000074 3300031249 Bacteria 85897
229 Ga0265339_10069856 3300031249 Bacteria 1874
230 Ga0265331_10145803 3300031250 Bacteria 1076
231 Ga0265313_10000033 3300031595 Bacteria 128053
232 Ga0265342_10251746 3300031712 Bacteria 942
233 Ga0373938_0039404 3300034957 Bacteria 1045
234 Ga0373954_0191194 3300035118 Bacteria 1005
235 Ga0373931_0038354 3300035691 Bacteria 2506
236 Ga0373927_0027804 3300035695 Bacteria 3693
237 Ga0373933_0128127 3300035724 Bacteria 1594
238 Ga0373925_0280409 3300037068 Bacteria 1342
239 Ga0395900_0020998 3300037418 Bacteria 6675
240 Ga0436364_0309649 3300037853 Bacteria 36034
241 Ga0436364_1505735 3300037853 Bacteria 910
242 Ga0436365_0183648 3300039437 Bacteria 3768
243 Ga0436365_0717946 3300039437 Bacteria 1598
244 Ga0436361_0589778 3300039447 Bacteria 9307
245 Ga0439435_0012267 3300042436 Bacteria 2073
246 Ga0439459_0023390 3300042438 Bacteria 1204
247 Ga0439459_0033318 3300042438 Bacteria 1060
248 Ga0466964_0330831 3300044706 Bacteria 777
249 Ga0453684_0753472 3300044712 Bacteria 1054
250 Ga0466968_0104427 3300044735 Bacteria 1268
251 Ga0495641_0120061 3300046461 Bacteria 1173
252 Ga0495653_0179641 3300046463 Bacteria 1454
253 Ga0495582_0216846 3300046473 Bacteria 1094
254 Ga0495664_0197343 3300046477 Bacteria 1220
255 Ga0495584_0016997 3300046491 Bacteria 3707
256 Ga0495665_0138665 3300046531 Bacteria 1272
257 Ga0495640_0158272 3300046533 Bacteria 1453
258 Ga0495598_0111295 3300046537 Unclassified 918
259 Ga0495656_0016719 3300046615 Bacteria 2788
260 Ga0495668_0096898 3300046616 Bacteria 1614
261 Ga0495659_0076888 3300046664 Bacteria 1260
262 Ga0495613_0230284 3300046689 Bacteria 1298
263 Ga0495671_0070701 3300046692 Bacteria 1715
264 Ga0495683_0116000 3300047323 Bacteria 1275
265 Ga0495684_0227989 3300047471 Bacteria 1363
266 Ga0496100_0037063 3300048903 Bacteria 3080
267 Ga0496100_0152137 3300048903 Bacteria 1651
268 Ga0496100_0297897 3300048903 Bacteria 1206
269 Ga0496100_0572196 3300048903 Bacteria 875
270 Ga0496101_0002538 3300048904 Bacteria 11215
271 Ga0496101_0107305 3300048904 Bacteria 2098
272 Ga0496102_0002933 3300048905 Bacteria 14466
273 Ga0496102_0005716 3300048905 Bacteria 10564
274 Ga0496102_0011238 3300048905 Bacteria 7714
275 Ga0496102_0013581 3300048905 Bacteria 7058
276 Ga0496103_0001124 3300048906 Bacteria 18587
277 Ga0496104_0000125 3300048907 Bacteria 71005
278 Ga0496104_0000284 3300048907 Bacteria 44754
279 Ga0496104_0010922 3300048907 Bacteria 8124
280 Ga0496104_0036538 3300048907 Bacteria 4592
281 Ga0496104_0377760 3300048907 Bacteria 1330
282 Ga0496104_0425361 3300048907 Bacteria 1240
283 Ga0496104_0588105 3300048907 Bacteria 1023
284 Ga0496105_0005555 3300048908 Bacteria 9575
285 Ga0496105_0008842 3300048908 Bacteria 7846
286 Ga0496105_0013032 3300048908 Bacteria 6589
287 Ga0496105_0015114 3300048908 Bacteria 6143
288 Ga0496105_0025177 3300048908 Bacteria 4840
289 Ga0496106_0045623 3300048909 Bacteria 3292
290 Ga0496106_0046666 3300048909 Bacteria 3257
291 Ga0496106_0157108 3300048909 Bacteria 1796
292 Ga0496106_0278343 3300048909 Bacteria 1340
293 Ga0496106_0515200 3300048909 Unclassified 960
294 Ga0496107_0001252 3300048910 Bacteria 15543
295 Ga0496107_0032079 3300048910 Bacteria 3753
296 Ga0496107_0116197 3300048910 Bacteria 1969
297 Ga0496108_0001187 3300048911 Bacteria 20358
298 Ga0496108_0011588 3300048911 Bacteria 7170
299 Ga0496108_0354115 3300048911 Bacteria 1281
300 Ga0496108_0499785 3300048911 Bacteria 1062
301 Ga0496109_0005207 3300048912 Bacteria 10863
302 Ga0496109_0015512 3300048912 Bacteria 6642
303 Ga0496109_0017308 3300048912 Bacteria 6314
304 Ga0496109_0098938 3300048912 Bacteria 2705
305 Ga0496109_0160154 3300048912 Bacteria 2108
306 Ga0496109_0707312 3300048912 Bacteria 945
307 Ga0496110_0001389 3300048913 Bacteria 17461
308 Ga0496110_0008745 3300048913 Bacteria 8155
309 Ga0496110_0012668 3300048913 Bacteria 6939
310 Ga0496110_0018219 3300048913 Bacteria 5885
311 Ga0496111_0020440 3300048914 Bacteria 4609
312 Ga0496111_0073288 3300048914 Bacteria 2493
313 Ga0496111_0123278 3300048914 Bacteria 1915
314 Ga0496112_0001346 3300048915 Bacteria 18695
315 Ga0496112_0087171 3300048915 Bacteria 3089
316 Ga0496112_0159477 3300048915 Bacteria 2222
317 Ga0496112_0550269 3300048915 Bacteria 1088
318 Ga0496112_0672120 3300048915 Bacteria 964
319 Ga0496113_0001229 3300048916 Bacteria 14079
320 Ga0496113_0034704 3300048916 Bacteria 3682
321 Ga0496113_0259044 3300048916 Bacteria 1389
322 Ga0496113_0260122 3300048916 Bacteria 1386
323 Ga0496114_0019043 3300048917 Bacteria 5562
324 Ga0496114_0280433 3300048917 Bacteria 1469
325 Ga0496114_0325211 3300048917 Bacteria 1359
326 Ga0496115_0003119 3300048918 Bacteria 11913
327 Ga0496115_0079256 3300048918 Bacteria 2673
328 Ga0496115_0414898 3300048918 Bacteria 1091
329 Ga0501032_0201531 3300049569 Bacteria 1299
330 Ga0501034_0037319 3300049571 Bacteria 4920
331 Ga0501034_0072058 3300049571 Bacteria 3464
332 Ga0501036_0192077 3300049572 Bacteria 1718
333 Ga0501036_0607226 3300049572 Bacteria 907
334 Ga0501043_0074822 3300049579 Bacteria 2661
335 Ga0501047_0024390 3300049581 Bacteria 5806
336 Ga0501047_0047771 3300049581 Bacteria 4134
337 Ga0501048_0242588 3300049582 Bacteria 1279
338 Ga0501071_0522325 3300049587 Bacteria 911
339 Ga0501072_0137655 3300049588 Bacteria 1947
340 Ga0501073_0006067 3300049589 Bacteria 9015
341 Ga0501075_0133117 3300049591 Bacteria 1894
342 Ga0501075_0181300 3300049591 Bacteria 1606
343 Ga0501075_0334028 3300049591 Unclassified 1155
344 Ga0501076_0067167 3300049592 Bacteria 2863
345 Ga0501076_0141271 3300049592 Bacteria 1956
346 Ga0501077_0073758 3300049593 Bacteria 2162
347 Ga0501077_0264796 3300049593 Bacteria 1093
348 Ga0501079_0351922 3300049741 Bacteria 1154
349 Ga0501080_0395022 3300049742 Bacteria 1245
350 Ga0501080_0657734 3300049742 Bacteria 927
351 Ga0501044_0020774 3300049823 Bacteria 7007
352 nmdc:mga03683_188266_c1 3300050489 Bacteria 943
353 nmdc:mga00v17_173759_c1 3300050491 Bacteria 1390
354 nmdc:mga00v17_52620_c1 3300050491 Bacteria 1098
355 nmdc:mga0yw44_263347_c1 3300050492 Bacteria 1149
356 nmdc:mga0yw44_36137_c1 3300050492 Bacteria 2909
357 nmdc:mga0yw44_7295_c1 3300050492 Bacteria 5426
358 nmdc:mga0k408_14517_c1 3300050493 Bacteria 4343
359 nmdc:mga06z11_114749_c1 3300050494 Bacteria 1496
360 nmdc:mga06z11_233158_c1 3300050494 Bacteria 1079
361 nmdc:mga04h51_118945_c1 3300050495 Bacteria 982
362 nmdc:mga07m45_309482_c1 3300050496 Bacteria 918
363 nmdc:mga07m45_358777_c1 3300050496 Bacteria 847
364 nmdc:mga05p37_116611_c1 3300050507 Bacteria 3282
365 nmdc:mga05p37_324279_c1 3300050507 Bacteria 1822
366 nmdc:mga05p37_374_c1 3300050507 Bacteria 48074
367 nmdc:mga05p37_391483_c1 3300050507 Bacteria 1625
368 nmdc:mga05p37_707359_c1 3300050507 Bacteria 1118
369 nmdc:mga05p37_85871_c1 3300050507 Bacteria 3878
370 nmdc:mga05p37_86368_c1 3300050507 Bacteria 3866
371 nmdc:mga09592_106552_c1 3300050508 Bacteria 2404
372 nmdc:mga09592_156224_c1 3300050508 Bacteria 1969
373 nmdc:mga09592_2601_c1 3300050508 Bacteria 14611
374 nmdc:mga09592_300863_c1 3300050508 Bacteria 1391
375 nmdc:mga0qj67_177625_c1 3300050509 Bacteria 1729
376 nmdc:mga0qj67_309770_c1 3300050509 Bacteria 1279
377 nmdc:mga0qj67_402653_c1 3300050509 Bacteria 1104
378 nmdc:mga0qj67_59_c1 3300050509 Bacteria 80290
379 nmdc:mga06r32_123743_c1 3300050510 Bacteria 1379
380 nmdc:mga06r32_233931_c1 3300050510 Bacteria 1825
381 nmdc:mga06r32_241091_c1 3300050510 Bacteria 1795
382 nmdc:mga06r32_397_c1 3300050510 Bacteria 36835
383 nmdc:mga06r32_651127_c1 3300050510 Bacteria 1022
384 nmdc:mga06r32_89680_c1 3300050510 Bacteria 3002
385 nmdc:mga08y16_174748_c1 3300050511 Bacteria 2230
386 nmdc:mga08y16_184_c1 3300050511 Bacteria 55479
387 nmdc:mga08y16_269118_c1 3300050511 Bacteria 1759
388 nmdc:mga08y16_318849_c1 3300050511 Bacteria 1600
389 nmdc:mga08y16_34932_c1 3300050511 Bacteria 5282
390 nmdc:mga0n895_199123_c1 3300050512 Bacteria 2034
391 nmdc:mga0n895_304452_c1 3300050512 Bacteria 1616
392 nmdc:mga0n895_7062_c1 3300050512 Bacteria 9596
393 nmdc:mga0rr50_218276_c1 3300050513 Bacteria 1574
394 nmdc:mga0a205_154787_c1 3300050515 Bacteria 2191
395 Ga0495601_0020571 3300053077 Bacteria 4032
396 Ga0495655_0001622 3300053083 Bacteria 3474
397 Ga0495619_0074977 3300053085 Bacteria 2270
398 Ga0495619_0112604 3300053085 Bacteria 1860
399 Ga0500643_016232 3300053087 Bacteria 2528
400 Ga0500562_013448 3300053108 Bacteria 2091
401 Ga0500593_012928 3300053117 Bacteria 3552
402 Ga0501084_0661653 3300054114 Bacteria 882
403 Ga0501082_0082760 3300060353 Bacteria 2769
404 Ga0501082_0107564 3300060353 Bacteria 2413
405 Ga0501082_0180592 3300060353 Bacteria 1835
406 Ga0501082_0454477 3300060353 Unclassified 1119
407 Ga0530510_0107158 3300061734 Bacteria 2045
408 Ga0530510_0162071 3300061734 Bacteria 1654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048909 Ga0496106_0515200 Ga0496106_0515200_31_711 226
2 3300049587 Ga0501071_0522325 Ga0501071_0522325_100_894 226
3 3300049742 Ga0501080_0657734 Ga0501080_0657734_20_703 227
4 3300014745 Ga0157377_10197048 Ga0157377_101970482 228
5 3300046537 Ga0495598_0111295 Ga0495598_0111295_221_907 228
6 3300050495 nmdc:mga04h51_118945_c1 nmdc:mga04h51_118945_c1_238_924 228
7 3300044706 Ga0466964_0330831 Ga0466964_0330831_49_741 229
8 3300006038 Ga0075365_10064979 Ga0075365_100649792 235
9 3300050491 nmdc:mga00v17_52620_c1 nmdc:mga00v17_52620_c1_244_1053 235
10 3300050492 nmdc:mga0yw44_7295_c1 nmdc:mga0yw44_7295_c1_2418_3227 235
11 3300050494 nmdc:mga06z11_233158_c1 nmdc:mga06z11_233158_c1_234_1043 235
12 3300009094 Ga0111539_10041700 Ga0111539_100417004 240
13 3300006237 Ga0097621_100194365 Ga0097621_1001943652 245
14 3300025941 Ga0207711_10246408 Ga0207711_102464082 245
15 3300005983 Ga0081540_1004744 Ga0081540_10047443 247
16 3300005439 Ga0070711_100047236 Ga0070711_1000472363 248
17 3300006175 Ga0070712_100004631 Ga0070712_1000046313 248
18 3300025915 Ga0207693_10016124 Ga0207693_100161242 248
19 3300031090 Ga0265760_10016690 Ga0265760_100166903 248
20 3300009094 Ga0111539_10321254 Ga0111539_103212542 249
21 3300006048 Ga0075363_100100103 Ga0075363_1001001032 250
22 3300006195 Ga0075366_10284305 Ga0075366_102843051 250
23 3300009177 Ga0105248_10025028 Ga0105248_100250287 250
24 3300013306 Ga0163162_11058638 Ga0163162_110586381 250
25 3300025941 Ga0207711_10460192 Ga0207711_104601921 250
26 3300046692 Ga0495671_0070701 Ga0495671_0070701_768_1577 250
27 3300048903 Ga0496100_0572196 Ga0496100_0572196_27_836 250
28 3300048917 Ga0496114_0280433 Ga0496114_0280433_335_1144 250
29 3300050496 nmdc:mga07m45_309482_c1 nmdc:mga07m45_309482_c1_65_874 250
30 3300053077 Ga0495601_0020571 Ga0495601_0020571_51_860 250
31 3300053083 Ga0495655_0001622 Ga0495655_0001622_1893_2702 250
32 3300049572 Ga0501036_0607226 Ga0501036_0607226_17_775 251
33 3300049742 Ga0501080_0395022 Ga0501080_0395022_68_850 251
34 3300005340 Ga0070689_100362515 Ga0070689_1003625152 252
35 3300005435 Ga0070714_100000098 Ga0070714_10000009860 252
36 3300005615 Ga0070702_100233429 Ga0070702_1002334291 252
37 3300005841 Ga0068863_100619338 Ga0068863_1006193382 252
38 3300025929 Ga0207664_10000663 Ga0207664_1000066312 252
39 3300025949 Ga0207667_10222284 Ga0207667_102222842 252
40 3300048905 Ga0496102_0002933 Ga0496102_0002933_12105_12917 252
41 3300048905 Ga0496102_0013581 Ga0496102_0013581_4198_4965 252
42 3300048907 Ga0496104_0010922 Ga0496104_0010922_184_996 252
43 3300048908 Ga0496105_0015114 Ga0496105_0015114_1823_2635 252
44 3300048909 Ga0496106_0157108 Ga0496106_0157108_65_877 252
45 3300048909 Ga0496106_0278343 Ga0496106_0278343_42_809 252
46 3300048910 Ga0496107_0116197 Ga0496107_0116197_1134_1946 252
47 3300048912 Ga0496109_0017308 Ga0496109_0017308_4522_5334 252
48 3300048915 Ga0496112_0672120 Ga0496112_0672120_113_925 252
49 3300050496 nmdc:mga07m45_358777_c1 nmdc:mga07m45_358777_c1_65_826 252
50 3300024225 Ga0224572_1002407 Ga0224572_10024072 253
51 3300049579 Ga0501043_0074822 Ga0501043_0074822_1205_1999 253
52 3300049581 Ga0501047_0024390 Ga0501047_0024390_3681_4475 253
53 3300049591 Ga0501075_0334028 Ga0501075_0334028_197_979 253
54 3300049823 Ga0501044_0020774 Ga0501044_0020774_2117_2911 253
55 3300060353 Ga0501082_0454477 Ga0501082_0454477_159_941 253
56 3300005331 Ga0070670_100251756 Ga0070670_1002517563 254
57 3300005841 Ga0068863_100147910 Ga0068863_1001479103 254
58 3300028800 Ga0265338_10079787 Ga0265338_100797872 254
59 3300031249 Ga0265339_10069856 Ga0265339_100698562 254
60 3300031250 Ga0265331_10145803 Ga0265331_101458031 254
61 3300046463 Ga0495653_0179641 Ga0495653_0179641_426_1202 254
62 3300046531 Ga0495665_0138665 Ga0495665_0138665_306_1082 254
63 3300047471 Ga0495684_0227989 Ga0495684_0227989_186_962 254
64 3300005844 Ga0068862_100201934 Ga0068862_1002019342 255
65 3300006847 Ga0075431_100322363 Ga0075431_1003223632 255
66 3300009147 Ga0114129_10072986 Ga0114129_100729865 255
67 3300014326 Ga0157380_10028029 Ga0157380_100280294 255
68 3300028380 Ga0268265_10153743 Ga0268265_101537432 255
69 3300042436 Ga0439435_0012267 Ga0439435_0012267_937_1728 255
70 3300050507 nmdc:mga05p37_86368_c1 nmdc:mga05p37_86368_c1_1220_2011 255
71 3300050508 nmdc:mga09592_300863_c1 nmdc:mga09592_300863_c1_51_842 255
72 3300050510 nmdc:mga06r32_123743_c1 nmdc:mga06r32_123743_c1_117_908 255
73 3300050511 nmdc:mga08y16_34932_c1 nmdc:mga08y16_34932_c1_3273_4082 255
74 3300005438 Ga0070701_10041960 Ga0070701_100419601 256
75 3300009094 Ga0111539_10653858 Ga0111539_106538582 256
76 3300009177 Ga0105248_10118323 Ga0105248_101183232 256
77 3300014969 Ga0157376_10017818 Ga0157376_100178184 256
78 3300049741 Ga0501079_0351922 Ga0501079_0351922_204_1031 256
79 3300009177 Ga0105248_10058984 Ga0105248_100589844 260
80 3300028800 Ga0265338_10041131 Ga0265338_100411312 260
81 3300031241 Ga0265325_10042203 Ga0265325_100422032 260
82 3300031249 Ga0265339_10000074 Ga0265339_100000749 260
83 3300031595 Ga0265313_10000033 Ga0265313_1000003313 260
84 3300046461 Ga0495641_0120061 Ga0495641_0120061_262_1119 260
85 iso_pu_bacteria 2773857925 2774871623 261
86 iso_pu_bacteria 2842694124 2842694402 261
87 3300005367 Ga0070667_100077143 Ga0070667_1000771432 262
88 3300005468 Ga0070707_100371401 Ga0070707_1003714012 262
89 3300005471 Ga0070698_100469481 Ga0070698_1004694811 262
90 3300005981 Ga0081538_10006193 Ga0081538_100061934 262
91 3300009148 Ga0105243_10060278 Ga0105243_100602782 262
92 3300009176 Ga0105242_10521194 Ga0105242_105211942 262
93 3300009553 Ga0105249_10330749 Ga0105249_103307492 262
94 3300010375 Ga0105239_10173497 Ga0105239_101734973 262
95 3300025972 Ga0207668_10033558 Ga0207668_100335583 262
96 3300025986 Ga0207658_10196635 Ga0207658_101966352 262
97 3300026089 Ga0207648_10096051 Ga0207648_100960511 262
98 3300026118 Ga0207675_100457449 Ga0207675_1004574492 262
99 3300042438 Ga0439459_0023390 Ga0439459_0023390_235_1029 262
100 3300048907 Ga0496104_0000125 Ga0496104_0000125_30892_31704 262
101 3300048907 Ga0496104_0000284 Ga0496104_0000284_2056_2865 262
102 3300048908 Ga0496105_0008842 Ga0496105_0008842_4533_5345 262
103 3300048908 Ga0496105_0013032 Ga0496105_0013032_2177_2986 262
104 3300048911 Ga0496108_0499785 Ga0496108_0499785_92_904 262
105 3300048912 Ga0496109_0098938 Ga0496109_0098938_755_1567 262
106 3300048912 Ga0496109_0160154 Ga0496109_0160154_673_1482 262
107 3300048913 Ga0496110_0018219 Ga0496110_0018219_1951_2763 262
108 3300048916 Ga0496113_0260122 Ga0496113_0260122_325_1137 262
109 3300048918 Ga0496115_0079256 Ga0496115_0079256_1041_1853 262
110 3300049569 Ga0501032_0201531 Ga0501032_0201531_49_846 262
111 3300049571 Ga0501034_0037319 Ga0501034_0037319_3501_4298 262
112 3300049581 Ga0501047_0047771 Ga0501047_0047771_1538_2335 262
113 3300049589 Ga0501073_0006067 Ga0501073_0006067_6545_7342 262
114 3300053087 Ga0500643_016232 Ga0500643_016232_657_1451 262
115 3300054114 Ga0501084_0661653 Ga0501084_0661653_40_837 262
116 3300060353 Ga0501082_0180592 Ga0501082_0180592_584_1381 262
117 3300005336 Ga0070680_100192312 Ga0070680_1001923122 263
118 3300005435 Ga0070714_100074934 Ga0070714_1000749343 263
119 3300005530 Ga0070679_100158376 Ga0070679_1001583762 263
120 3300005535 Ga0070684_100101853 Ga0070684_1001018532 263
121 3300006177 Ga0075362_10075657 Ga0075362_100756572 263
122 3300006195 Ga0075366_10001525 Ga0075366_100015253 263
123 3300009101 Ga0105247_10242400 Ga0105247_102424001 263
124 3300009551 Ga0105238_10114452 Ga0105238_101144523 263
125 3300013105 Ga0157369_10130337 Ga0157369_101303371 263
126 3300014326 Ga0157380_10233285 Ga0157380_102332852 263
127 3300025915 Ga0207693_10516415 Ga0207693_105164151 263
128 3300025917 Ga0207660_10465558 Ga0207660_104655581 263
129 3300025918 Ga0207662_10120031 Ga0207662_101200313 263
130 3300025939 Ga0207665_10074411 Ga0207665_100744113 263
131 3300026075 Ga0207708_10168254 Ga0207708_101682542 263
132 3300026142 Ga0207698_10489811 Ga0207698_104898112 263
133 3300044712 Ga0453684_0753472 Ga0453684_0753472_26_823 263
134 3300048907 Ga0496104_0588105 Ga0496104_0588105_179_976 263
135 3300048912 Ga0496109_0707312 Ga0496109_0707312_105_902 263
136 3300048915 Ga0496112_0087171 Ga0496112_0087171_862_1659 263
137 3300048917 Ga0496114_0325211 Ga0496114_0325211_286_1083 263
138 3300049571 Ga0501034_0072058 Ga0501034_0072058_281_1081 263
139 3300050493 nmdc:mga0k408_14517_c1 nmdc:mga0k408_14517_c1_1304_2101 263
140 3300003203 JGI25406J46586_10009199 JGI25406J46586_100091991 264
141 3300005985 Ga0081539_10006007 Ga0081539_1000600711 264
142 3300006846 Ga0075430_100200171 Ga0075430_1002001712 264
143 3300006847 Ga0075431_100147618 Ga0075431_1001476183 264
144 3300006847 Ga0075431_100165174 Ga0075431_1001651742 264
145 3300009147 Ga0114129_10002097 Ga0114129_1000209712 264
146 3300042438 Ga0439459_0033318 Ga0439459_0033318_51_860 264
147 3300050507 nmdc:mga05p37_324279_c1 nmdc:mga05p37_324279_c1_875_1693 264
148 3300050509 nmdc:mga0qj67_177625_c1 nmdc:mga0qj67_177625_c1_343_1146 264
149 3300050510 nmdc:mga06r32_89680_c1 nmdc:mga06r32_89680_c1_1345_2148 264
150 3300053117 Ga0500593_012928 Ga0500593_012928_1785_2585 264
151 3300006846 Ga0075430_100000152 Ga0075430_10000015242 265
152 3300006847 Ga0075431_100559605 Ga0075431_1005596051 265
153 3300007788 Ga0099795_10020860 Ga0099795_100208601 265
154 3300009147 Ga0114129_10267374 Ga0114129_102673741 265
155 3300009147 Ga0114129_10830643 Ga0114129_108306432 265
156 3300031241 Ga0265325_10108287 Ga0265325_101082871 265
157 3300031712 Ga0265342_10251746 Ga0265342_102517461 265
158 3300046491 Ga0495584_0016997 Ga0495584_0016997_2328_3131 265
159 3300050489 nmdc:mga03683_188266_c1 nmdc:mga03683_188266_c1_61_864 265
160 3300050509 nmdc:mga0qj67_402653_c1 nmdc:mga0qj67_402653_c1_178_984 265
161 3300050509 nmdc:mga0qj67_59_c1 nmdc:mga0qj67_59_c1_20982_21785 265
162 3300050510 nmdc:mga06r32_233931_c1 nmdc:mga06r32_233931_c1_139_942 265
163 iso_pu_bacteria 2909042592 2909045943 265
164 3300049572 Ga0501036_0192077 Ga0501036_0192077_48_854 266
165 3300049582 Ga0501048_0242588 Ga0501048_0242588_41_847 266
166 3300049588 Ga0501072_0137655 Ga0501072_0137655_957_1763 266
167 3300049591 Ga0501075_0133117 Ga0501075_0133117_358_1167 266
168 3300049591 Ga0501075_0181300 Ga0501075_0181300_38_844 266
169 3300049592 Ga0501076_0067167 Ga0501076_0067167_1508_2317 266
170 3300049592 Ga0501076_0141271 Ga0501076_0141271_740_1546 266
171 3300049593 Ga0501077_0264796 Ga0501077_0264796_27_836 266
172 3300060353 Ga0501082_0082760 Ga0501082_0082760_1660_2466 266
173 3300060353 Ga0501082_0107564 Ga0501082_0107564_722_1531 266
174 3300061734 Ga0530510_0107158 Ga0530510_0107158_786_1595 266
175 3300061734 Ga0530510_0162071 Ga0530510_0162071_113_919 266
176 3300002244 JGI24742J22300_10003737 JGI24742J22300_100037372 267
177 3300005328 Ga0070676_10197258 Ga0070676_101972581 267
178 3300005330 Ga0070690_100012848 Ga0070690_1000128485 267
179 3300005331 Ga0070670_100077104 Ga0070670_1000771042 267
180 3300005338 Ga0068868_100007445 Ga0068868_1000074451 267
181 3300005340 Ga0070689_100011289 Ga0070689_1000112895 267
182 3300005343 Ga0070687_100001322 Ga0070687_1000013224 267
183 3300005345 Ga0070692_10045998 Ga0070692_100459982 267
184 3300005347 Ga0070668_100012197 Ga0070668_1000121976 267
185 3300005353 Ga0070669_100023889 Ga0070669_1000238892 267
186 3300005354 Ga0070675_100029570 Ga0070675_1000295702 267
187 3300005356 Ga0070674_100002023 Ga0070674_1000020236 267
188 3300005364 Ga0070673_100030271 Ga0070673_1000302714 267
189 3300005367 Ga0070667_100006086 Ga0070667_1000060861 267
190 3300005406 Ga0070703_10016668 Ga0070703_100166682 267
191 3300005434 Ga0070709_10014990 Ga0070709_100149902 267
192 3300005435 Ga0070714_100060306 Ga0070714_1000603062 267
193 3300005436 Ga0070713_100014283 Ga0070713_1000142833 267
194 3300005436 Ga0070713_100332770 Ga0070713_1003327702 267
195 3300005437 Ga0070710_10091423 Ga0070710_100914232 267
196 3300005438 Ga0070701_10000544 Ga0070701_1000054412 267
197 3300005440 Ga0070705_100009336 Ga0070705_1000093362 267
198 3300005455 Ga0070663_100023145 Ga0070663_1000231453 267
199 3300005455 Ga0070663_100299256 Ga0070663_1002992562 267
200 3300005456 Ga0070678_100135016 Ga0070678_1001350162 267
201 3300005457 Ga0070662_100006609 Ga0070662_1000066094 267
202 3300005459 Ga0068867_100006600 Ga0068867_1000066001 267
203 3300005466 Ga0070685_10001171 Ga0070685_1000117114 267
204 3300005468 Ga0070707_100227453 Ga0070707_1002274532 267
205 3300005471 Ga0070698_100237818 Ga0070698_1002378182 267
206 3300005535 Ga0070684_100102665 Ga0070684_1001026653 267
207 3300005543 Ga0070672_100007959 Ga0070672_1000079597 267
208 3300005544 Ga0070686_100035432 Ga0070686_1000354323 267
209 3300005564 Ga0070664_100135186 Ga0070664_1001351862 267
210 3300005564 Ga0070664_100154894 Ga0070664_1001548941 267
211 3300005577 Ga0068857_100125155 Ga0068857_1001251551 267
212 3300005578 Ga0068854_100028596 Ga0068854_1000285965 267
213 3300005614 Ga0068856_100049795 Ga0068856_1000497955 267
214 3300005615 Ga0070702_100003914 Ga0070702_1000039143 267
215 3300005617 Ga0068859_100602845 Ga0068859_1006028452 267
216 3300005618 Ga0068864_100002387 Ga0068864_10000238713 267
217 3300005718 Ga0068866_10005160 Ga0068866_100051605 267
218 3300005719 Ga0068861_100058391 Ga0068861_1000583911 267
219 3300005840 Ga0068870_10001771 Ga0068870_100017718 267
220 3300005841 Ga0068863_100007012 Ga0068863_1000070125 267
221 3300005842 Ga0068858_100005914 Ga0068858_1000059143 267
222 3300005843 Ga0068860_100078622 Ga0068860_1000786223 267
223 3300005844 Ga0068862_100014438 Ga0068862_1000144383 267
224 3300005937 Ga0081455_10000769 Ga0081455_1000076910 267
225 3300005937 Ga0081455_10007568 Ga0081455_100075682 267
226 3300005937 Ga0081455_10014052 Ga0081455_100140527 267
227 3300005937 Ga0081455_10180660 Ga0081455_101806602 267
228 3300005981 Ga0081538_10031838 Ga0081538_100318384 267
229 3300006038 Ga0075365_10015836 Ga0075365_100158362 267
230 3300006038 Ga0075365_10021113 Ga0075365_100211133 267
231 3300006038 Ga0075365_10036632 Ga0075365_100366321 267
232 3300006051 Ga0075364_10085610 Ga0075364_100856102 267
233 3300006175 Ga0070712_100070468 Ga0070712_1000704683 267
234 3300006175 Ga0070712_100071675 Ga0070712_1000716752 267
235 3300006237 Ga0097621_100030663 Ga0097621_1000306631 267
236 3300006358 Ga0068871_100016532 Ga0068871_1000165325 267
237 3300006358 Ga0068871_100529338 Ga0068871_1005293382 267
238 3300006844 Ga0075428_100001218 Ga0075428_10000121815 267
239 3300006844 Ga0075428_100022676 Ga0075428_1000226762 267
240 3300006844 Ga0075428_100038529 Ga0075428_1000385292 267
241 3300006844 Ga0075428_100482070 Ga0075428_1004820702 267
242 3300006847 Ga0075431_100000613 Ga0075431_10000061318 267
243 3300006847 Ga0075431_100648260 Ga0075431_1006482601 267
244 3300006852 Ga0075433_10277004 Ga0075433_102770042 267
245 3300006871 Ga0075434_100057828 Ga0075434_1000578284 267
246 3300006871 Ga0075434_100159446 Ga0075434_1001594463 267
247 3300006880 Ga0075429_100068661 Ga0075429_1000686612 267
248 3300006880 Ga0075429_100119479 Ga0075429_1001194792 267
249 3300006880 Ga0075429_100183680 Ga0075429_1001836802 267
250 3300006881 Ga0068865_100013020 Ga0068865_1000130203 267
251 3300006931 Ga0097620_100602888 Ga0097620_1006028882 267
252 3300007265 Ga0099794_10003112 Ga0099794_100031126 267
253 3300009092 Ga0105250_10069574 Ga0105250_100695742 267
254 3300009094 Ga0111539_10000840 Ga0111539_100008409 267
255 3300009094 Ga0111539_10149694 Ga0111539_101496942 267
256 3300009094 Ga0111539_10160838 Ga0111539_101608382 267
257 3300009098 Ga0105245_10049519 Ga0105245_100495193 267
258 3300009101 Ga0105247_10011483 Ga0105247_100114832 267
259 3300009147 Ga0114129_10000320 Ga0114129_1000032050 267
260 3300009147 Ga0114129_10034224 Ga0114129_100342247 267
261 3300009147 Ga0114129_10390717 Ga0114129_103907172 267
262 3300009147 Ga0114129_10963600 Ga0114129_109636002 267
263 3300009148 Ga0105243_10115614 Ga0105243_101156143 267
264 3300009177 Ga0105248_10345414 Ga0105248_103454141 267
265 3300009545 Ga0105237_10032626 Ga0105237_100326266 267
266 3300009553 Ga0105249_10032441 Ga0105249_100324413 267
267 3300010375 Ga0105239_10076217 Ga0105239_100762172 267
268 3300013296 Ga0157374_10013392 Ga0157374_100133925 267
269 3300013297 Ga0157378_10014031 Ga0157378_100140312 267
270 3300013308 Ga0157375_10029995 Ga0157375_100299952 267
271 3300014325 Ga0163163_10026389 Ga0163163_100263893 267
272 3300014326 Ga0157380_10003106 Ga0157380_100031062 267
273 3300014745 Ga0157377_10011739 Ga0157377_100117391 267
274 3300014968 Ga0157379_10002037 Ga0157379_100020373 267
275 3300014969 Ga0157376_10051761 Ga0157376_100517613 267
276 3300017792 Ga0163161_10005982 Ga0163161_100059823 267
277 3300021384 Ga0213876_10007625 Ga0213876_100076254 267
278 3300021388 Ga0213875_10000007 Ga0213875_10000007174 267
279 3300021388 Ga0213875_10140745 Ga0213875_101407451 267
280 3300025885 Ga0207653_10034021 Ga0207653_100340211 267
281 3300025899 Ga0207642_10008872 Ga0207642_100088723 267
282 3300025900 Ga0207710_10064952 Ga0207710_100649521 267
283 3300025901 Ga0207688_10000130 Ga0207688_1000013018 267
284 3300025904 Ga0207647_10002385 Ga0207647_1000238510 267
285 3300025907 Ga0207645_10032401 Ga0207645_100324011 267
286 3300025908 Ga0207643_10001538 Ga0207643_100015386 267
287 3300025914 Ga0207671_10038954 Ga0207671_100389541 267
288 3300025915 Ga0207693_10258173 Ga0207693_102581731 267
289 3300025916 Ga0207663_10587863 Ga0207663_105878631 267
290 3300025918 Ga0207662_10009228 Ga0207662_100092283 267
291 3300025919 Ga0207657_10015944 Ga0207657_100159444 267
292 3300025920 Ga0207649_10059241 Ga0207649_100592411 267
293 3300025923 Ga0207681_10017150 Ga0207681_100171505 267
294 3300025925 Ga0207650_10004418 Ga0207650_100044185 267
295 3300025927 Ga0207687_10110352 Ga0207687_101103522 267
296 3300025929 Ga0207664_10045973 Ga0207664_100459731 267
297 3300025929 Ga0207664_10048956 Ga0207664_100489563 267
298 3300025929 Ga0207664_10546176 Ga0207664_105461762 267
299 3300025931 Ga0207644_10035067 Ga0207644_100350671 267
300 3300025932 Ga0207690_10080463 Ga0207690_100804632 267
301 3300025933 Ga0207706_10002801 Ga0207706_100028018 267
302 3300025934 Ga0207686_10121085 Ga0207686_101210852 267
303 3300025937 Ga0207669_10006157 Ga0207669_100061573 267
304 3300025938 Ga0207704_10003655 Ga0207704_100036556 267
305 3300025939 Ga0207665_10205241 Ga0207665_102052412 267
306 3300025940 Ga0207691_10000921 Ga0207691_1000092129 267
307 3300025942 Ga0207689_10000756 Ga0207689_1000075617 267
308 3300025944 Ga0207661_10088984 Ga0207661_100889841 267
309 3300025960 Ga0207651_10060456 Ga0207651_100604562 267
310 3300025986 Ga0207658_10207338 Ga0207658_102073382 267
311 3300026023 Ga0207677_10012844 Ga0207677_100128443 267
312 3300026035 Ga0207703_10011569 Ga0207703_100115691 267
313 3300026067 Ga0207678_10002027 Ga0207678_100020275 267
314 3300026067 Ga0207678_10349535 Ga0207678_103495351 267
315 3300026075 Ga0207708_10000567 Ga0207708_1000056726 267
316 3300026078 Ga0207702_10093193 Ga0207702_100931931 267
317 3300026089 Ga0207648_10009209 Ga0207648_100092099 267
318 3300026095 Ga0207676_10007771 Ga0207676_100077711 267
319 3300026118 Ga0207675_100004438 Ga0207675_1000044388 267
320 3300026121 Ga0207683_10015749 Ga0207683_100157496 267
321 3300027907 Ga0207428_10005811 Ga0207428_100058119 267
322 3300027907 Ga0207428_10078394 Ga0207428_100783943 267
323 3300028379 Ga0268266_10214311 Ga0268266_102143112 267
324 3300028381 Ga0268264_10047473 Ga0268264_100474733 267
325 3300034957 Ga0373938_0039404 Ga0373938_0039404_122_931 267
326 3300035118 Ga0373954_0191194 Ga0373954_0191194_141_956 267
327 3300035691 Ga0373931_0038354 Ga0373931_0038354_497_1306 267
328 3300035695 Ga0373927_0027804 Ga0373927_0027804_233_1048 267
329 3300035724 Ga0373933_0128127 Ga0373933_0128127_468_1283 267
330 3300037068 Ga0373925_0280409 Ga0373925_0280409_382_1197 267
331 3300037418 Ga0395900_0020998 Ga0395900_0020998_539_1351 267
332 3300037853 Ga0436364_0309649 Ga0436364_0309649_29321_30133 267
333 3300037853 Ga0436364_1505735 Ga0436364_1505735_78_890 267
334 3300039437 Ga0436365_0183648 Ga0436365_0183648_2288_3100 267
335 3300039437 Ga0436365_0717946 Ga0436365_0717946_410_1222 267
336 3300039447 Ga0436361_0589778 Ga0436361_0589778_1448_2269 267
337 3300044735 Ga0466968_0104427 Ga0466968_0104427_396_1223 267
338 3300046473 Ga0495582_0216846 Ga0495582_0216846_33_848 267
339 3300046477 Ga0495664_0197343 Ga0495664_0197343_217_1032 267
340 3300046533 Ga0495640_0158272 Ga0495640_0158272_447_1256 267
341 3300046615 Ga0495656_0016719 Ga0495656_0016719_1311_2123 267
342 3300046616 Ga0495668_0096898 Ga0495668_0096898_489_1298 267
343 3300046664 Ga0495659_0076888 Ga0495659_0076888_124_936 267
344 3300046689 Ga0495613_0230284 Ga0495613_0230284_427_1236 267
345 3300047323 Ga0495683_0116000 Ga0495683_0116000_107_916 267
346 3300048903 Ga0496100_0037063 Ga0496100_0037063_1256_2068 267
347 3300048903 Ga0496100_0152137 Ga0496100_0152137_688_1497 267
348 3300048903 Ga0496100_0297897 Ga0496100_0297897_65_877 267
349 3300048904 Ga0496101_0002538 Ga0496101_0002538_2757_3566 267
350 3300048904 Ga0496101_0107305 Ga0496101_0107305_479_1294 267
351 3300048905 Ga0496102_0005716 Ga0496102_0005716_7581_8390 267
352 3300048905 Ga0496102_0011238 Ga0496102_0011238_234_1043 267
353 3300048906 Ga0496103_0001124 Ga0496103_0001124_4000_4809 267
354 3300048907 Ga0496104_0036538 Ga0496104_0036538_1974_2783 267
355 3300048907 Ga0496104_0377760 Ga0496104_0377760_102_914 267
356 3300048907 Ga0496104_0425361 Ga0496104_0425361_40_855 267
357 3300048908 Ga0496105_0005555 Ga0496105_0005555_1558_2367 267
358 3300048908 Ga0496105_0025177 Ga0496105_0025177_4011_4820 267
359 3300048909 Ga0496106_0045623 Ga0496106_0045623_1599_2408 267
360 3300048909 Ga0496106_0046666 Ga0496106_0046666_492_1301 267
361 3300048910 Ga0496107_0001252 Ga0496107_0001252_12347_13156 267
362 3300048910 Ga0496107_0032079 Ga0496107_0032079_355_1164 267
363 3300048911 Ga0496108_0001187 Ga0496108_0001187_13777_14586 267
364 3300048911 Ga0496108_0011588 Ga0496108_0011588_4729_5538 267
365 3300048911 Ga0496108_0354115 Ga0496108_0354115_364_1176 267
366 3300048912 Ga0496109_0005207 Ga0496109_0005207_8209_9018 267
367 3300048912 Ga0496109_0015512 Ga0496109_0015512_4619_5431 267
368 3300048913 Ga0496110_0001389 Ga0496110_0001389_14478_15287 267
369 3300048913 Ga0496110_0008745 Ga0496110_0008745_1970_2782 267
370 3300048913 Ga0496110_0012668 Ga0496110_0012668_1656_2465 267
371 3300048914 Ga0496111_0020440 Ga0496111_0020440_2768_3580 267
372 3300048914 Ga0496111_0073288 Ga0496111_0073288_117_926 267
373 3300048914 Ga0496111_0123278 Ga0496111_0123278_699_1511 267
374 3300048915 Ga0496112_0001346 Ga0496112_0001346_6726_7535 267
375 3300048915 Ga0496112_0159477 Ga0496112_0159477_1067_1879 267
376 3300048915 Ga0496112_0550269 Ga0496112_0550269_209_1021 267
377 3300048916 Ga0496113_0001229 Ga0496113_0001229_6977_7786 267
378 3300048916 Ga0496113_0034704 Ga0496113_0034704_2477_3286 267
379 3300048916 Ga0496113_0259044 Ga0496113_0259044_455_1267 267
380 3300048917 Ga0496114_0019043 Ga0496114_0019043_509_1318 267
381 3300048918 Ga0496115_0003119 Ga0496115_0003119_4012_4821 267
382 3300048918 Ga0496115_0414898 Ga0496115_0414898_93_908 267
383 3300049593 Ga0501077_0073758 Ga0501077_0073758_415_1263 267
384 3300050491 nmdc:mga00v17_173759_c1 nmdc:mga00v17_173759_c1_536_1354 267
385 3300050492 nmdc:mga0yw44_263347_c1 nmdc:mga0yw44_263347_c1_24_842 267
386 3300050492 nmdc:mga0yw44_36137_c1 nmdc:mga0yw44_36137_c1_2024_2845 267
387 3300050494 nmdc:mga06z11_114749_c1 nmdc:mga06z11_114749_c1_447_1265 267
388 3300050507 nmdc:mga05p37_116611_c1 nmdc:mga05p37_116611_c1_872_1684 267
389 3300050507 nmdc:mga05p37_374_c1 nmdc:mga05p37_374_c1_47059_47895 267
390 3300050507 nmdc:mga05p37_391483_c1 nmdc:mga05p37_391483_c1_558_1370 267
391 3300050507 nmdc:mga05p37_707359_c1 nmdc:mga05p37_707359_c1_248_1060 267
392 3300050507 nmdc:mga05p37_85871_c1 nmdc:mga05p37_85871_c1_1672_2481 267
393 3300050508 nmdc:mga09592_106552_c1 nmdc:mga09592_106552_c1_1053_1865 267
394 3300050508 nmdc:mga09592_156224_c1 nmdc:mga09592_156224_c1_229_1038 267
395 3300050508 nmdc:mga09592_2601_c1 nmdc:mga09592_2601_c1_12536_13372 267
396 3300050509 nmdc:mga0qj67_309770_c1 nmdc:mga0qj67_309770_c1_175_987 267
397 3300050510 nmdc:mga06r32_241091_c1 nmdc:mga06r32_241091_c1_216_1025 267
398 3300050510 nmdc:mga06r32_397_c1 nmdc:mga06r32_397_c1_12134_12970 267
399 3300050510 nmdc:mga06r32_651127_c1 nmdc:mga06r32_651127_c1_113_925 267
400 3300050511 nmdc:mga08y16_174748_c1 nmdc:mga08y16_174748_c1_927_1736 267
401 3300050511 nmdc:mga08y16_184_c1 nmdc:mga08y16_184_c1_25362_26198 267
402 3300050511 nmdc:mga08y16_269118_c1 nmdc:mga08y16_269118_c1_512_1327 267
403 3300050511 nmdc:mga08y16_318849_c1 nmdc:mga08y16_318849_c1_511_1320 267
404 3300050512 nmdc:mga0n895_199123_c1 nmdc:mga0n895_199123_c1_963_1775 267
405 3300050512 nmdc:mga0n895_304452_c1 nmdc:mga0n895_304452_c1_24_833 267
406 3300050512 nmdc:mga0n895_7062_c1 nmdc:mga0n895_7062_c1_6035_6850 267
407 3300050513 nmdc:mga0rr50_218276_c1 nmdc:mga0rr50_218276_c1_17_829 267
408 3300050515 nmdc:mga0a205_154787_c1 nmdc:mga0a205_154787_c1_1222_2037 267
409 3300053085 Ga0495619_0074977 Ga0495619_0074977_908_1720 267
410 3300053085 Ga0495619_0112604 Ga0495619_0112604_862_1707 267
411 3300053108 Ga0500562_013448 Ga0500562_013448_392_1210 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

60

240

0.92

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

57

184

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qh8-assembly1.cif.gz_A crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data 0.9851 2 262
3qh8-assembly1.cif.gz_A crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data 0.9632 2 262
6b9v-assembly1.cif.gz_A crystal structure of a new diphosphatase from the phnp family 0.9487 2 260
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.9429 2 264
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.9212 2 264
ID Description Score Start End Superfamily
3py6A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9852 2 262 3.60.15.10
3py6A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9633 2 262 3.60.15.10
af_O74545_3_299_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9197 2 262 3.60.15.10
af_C4J9M0_89_373_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9037 2 263 3.60.15.10
af_O74545_3_299_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8998 2 262 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A6J4KXZ5-F1-model_v4 Metal-dependent hydrolases of the beta-lactamase superfamily I PhnP protein 0.9974 196 262 GO:0016787
AF-A0A3M1PQR0-F1-model_v4 MBL fold metallo-hydrolase 0.9971 198 262 GO:0016787
AF-A0A527Y641-F1-model_v4 MBL fold metallo-hydrolase 0.9963 192 262 GO:0016787
AF-A0A537PAK9-F1-model_v4 YchF/TatD family DNA exonuclease 0.9957 27 263 GO:0004527
GO:0004536
GO:0005829
AF-A0A1M3NP87-F1-model_v4 Phosphoribosyl 1,2-cyclic phosphodiesterase 0.9947 20 262

Feature Viewer

pLDDT pTM Quality
96.64 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map