F437482

General Info

Members Datasets Scaffolds Average Seq Length
411 162 411 472

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10023975|Ga0081539_100239753
Length 504
Sequence MPGVSRQVKIPQPIFLGLWSTHSLETPMILGKPAPFVRAFIDAVDDAIRAQHPSHAMSATQRAWLAFCVTAVLITNSICWARFERASLGTYSLAALSWMFRHSKLPWDHLLVASVRVILRHHGLTSGTLVIDDTDNPRSKSAQTLAYLYKLRDKASGGYLWGQSLVVLCLVTPQISIPVGFAFYQPAPELSAWYKQEKPLKKRGVPKHQRPPKPAPNPQYPPKEQLALRLLEAFKAHHPHIRVHCIMADALYGTATFVDGASAIFGGVHVLSQIRSHQNIRLGQRVQHVADYFATHPGTPQRLRIRGGPEVVATIGSARLYVCSHHTKRFIVAIKYEEEESYRYLIASDLRWRTLDIVQGHTLRWLVEVFIQDWKSYEGWSPLTKQPGEEGARHSVILSLLVDHSLFMHPDQQEQLKNNLPAYTVGSLRANVQVECLVEVIAALVSSDNPQEKLQRFTQAVHEVFAFGHSKKHMIQRPWGRLEPTPFLKYRADEVMRNMPVLST

Samples

Sample ID Description Type Environment
1 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
74 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
75 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
76 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
77 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
110 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
111 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
112 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
115 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
116 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
117 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
120 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
121 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
122 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
123 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
127 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.24
Rhizosphere 99.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilYngRDRAFT_c00610 3300000042 Plasmid 3718
2 ARSoilYngRDRAFT_c01076 3300000042 Unclassified 1778
3 ARcpr5yngRDRAFT_c002976 3300000043 Unclassified 1707
4 ARSoilOldRDRAFT_c001723 3300000044 Bacteria 2006
5 ARCol0yngRDRAFT_1000616 3300000652 Plasmid 3775
6 ARCol0yngRDRAFT_1001695 3300000652 Unclassified 1744
7 ARCol0yngRDRAFT_1001709 3300000652 Unclassified 1737
8 ARCol0yngRDRAFT_1001757 3300000652 Unclassified 1709
9 JGI24750J21931_1000933 3300002070 Bacteria 3900
10 JGI24750J21931_1004235 3300002070 Unclassified 1732
11 JGI24750J21931_1004436 3300002070 Bacteria 1700
12 JGI24033J26618_1002480 3300002155 Bacteria 1893
13 JGI25406J46586_10024890 3300003203 Bacteria 2334
14 JGI25406J46586_10039059 3300003203 Bacteria 1695
15 JGI25407J50210_10005112 3300003373 Unclassified 3216
16 JGI25407J50210_10010356 3300003373 Unclassified 2371
17 JGI25407J50210_10020815 3300003373 Bacteria 1705
18 JGI25407J50210_10021343 3300003373 Bacteria 1684
19 JGI25404J52841_10012448 3300003659 Bacteria 1842
20 JGI25404J52841_10014425 3300003659 Bacteria 1714
21 JGI25405J52794_10011405 3300003911 Unclassified 1701
22 JGI25405J52794_10011642 3300003911 Bacteria 1685
23 Ga0065717_1002548 3300005276 Unclassified 1828
24 Ga0065704_10003903 3300005289 Bacteria 3718
25 Ga0065704_10080895 3300005289 Bacteria 3858
26 Ga0065704_10127132 3300005289 Bacteria 1679
27 Ga0065707_10003973 3300005295 Bacteria 3578
28 Ga0065707_10138841 3300005295 Bacteria 1801
29 Ga0070676_10082123 3300005328 Bacteria 1957
30 Ga0068869_100120151 3300005334 Bacteria 2009
31 Ga0068868_100109289 3300005338 Bacteria 2245
32 Ga0070689_100088408 3300005340 Bacteria 2439
33 Ga0070687_100062201 3300005343 Bacteria 1976
34 Ga0070668_100037454 3300005347 Bacteria 3703
35 Ga0070668_100152075 3300005347 Unclassified 1872
36 Ga0070669_100109801 3300005353 Bacteria 2092
37 Ga0070674_100088031 3300005356 Bacteria 2234
38 Ga0070688_100062576 3300005365 Bacteria 2356
39 Ga0070659_100191516 3300005366 Bacteria 1681
40 Ga0070667_100203557 3300005367 Bacteria 1757
41 Ga0070701_10074730 3300005438 Bacteria 1821
42 Ga0070701_10083559 3300005438 Unclassified 1734
43 Ga0070700_100062862 3300005441 Bacteria 2347
44 Ga0070700_100091949 3300005441 Bacteria 1982
45 Ga0070694_100103230 3300005444 Bacteria 2020
46 Ga0070708_100048901 3300005445 Bacteria 3741
47 Ga0070708_100109462 3300005445 Bacteria 2538
48 Ga0070708_100217006 3300005445 Bacteria 1793
49 Ga0070662_100168824 3300005457 Bacteria 1717
50 Ga0068867_100074256 3300005459 Bacteria 2548
51 Ga0068867_100100048 3300005459 Bacteria 2213
52 Ga0070685_10091607 3300005466 Bacteria 1841
53 Ga0070706_100176257 3300005467 Bacteria 1996
54 Ga0070699_100092481 3300005518 Unclassified 2646
55 Ga0070697_100124421 3300005536 Unclassified 2159
56 Ga0070672_100136929 3300005543 Bacteria 2017
57 Ga0070686_100022999 3300005544 Bacteria 3720
58 Ga0070686_100097708 3300005544 Bacteria 1977
59 Ga0070696_100159515 3300005546 Unclassified 1661
60 Ga0070704_100099253 3300005549 Bacteria 2190
61 Ga0068855_100251784 3300005563 Unclassified 1970
62 Ga0068857_100148713 3300005577 Bacteria 2121
63 Ga0068856_100193333 3300005614 Bacteria 2048
64 Ga0068859_100170749 3300005617 Bacteria 2255
65 Ga0068859_100250233 3300005617 Bacteria 1863
66 Ga0068866_10056216 3300005718 Bacteria 2023
67 Ga0068861_100032966 3300005719 Bacteria 3818
68 Ga0068861_100118507 3300005719 Bacteria 2132
69 Ga0068861_100138014 3300005719 Unclassified 1986
70 Ga0068861_100164647 3300005719 Bacteria 1832
71 Ga0068870_10032305 3300005840 Bacteria 2659
72 Ga0068858_100236219 3300005842 Bacteria 1733
73 Ga0068860_100181414 3300005843 Unclassified 2034
74 Ga0068860_100211476 3300005843 Bacteria 1881
75 Ga0068860_100224954 3300005843 Bacteria 1822
76 Ga0068862_100070361 3300005844 Unclassified 3021
77 Ga0068862_100171190 3300005844 Bacteria 1944
78 Ga0068862_100183839 3300005844 Bacteria 1877
79 Ga0081455_10014234 3300005937 Bacteria 7806
80 Ga0081455_10039377 3300005937 Bacteria 4178
81 Ga0081455_10039587 3300005937 Bacteria 4165
82 Ga0081455_10045623 3300005937 Bacteria 3812
83 Ga0081455_10090279 3300005937 Bacteria 2485
84 Ga0081455_10125258 3300005937 Bacteria 2018
85 Ga0081455_10130903 3300005937 Bacteria 1962
86 Ga0081455_10137045 3300005937 Bacteria 1906
87 Ga0081538_10008197 3300005981 Bacteria 8917
88 Ga0081538_10015427 3300005981 Bacteria 5913
89 Ga0081538_10022334 3300005981 Bacteria 4586
90 Ga0081538_10041597 3300005981 Bacteria 2914
91 Ga0081538_10054744 3300005981 Bacteria 2356
92 Ga0081538_10055505 3300005981 Bacteria 2331
93 Ga0081538_10058042 3300005981 Bacteria 2248
94 Ga0081538_10059720 3300005981 Bacteria 2200
95 Ga0081538_10075755 3300005981 Unclassified 1823
96 Ga0081540_1007726 3300005983 Bacteria 7623
97 Ga0081540_1011754 3300005983 Bacteria 5824
98 Ga0081540_1016470 3300005983 Bacteria 4622
99 Ga0081540_1017882 3300005983 Bacteria 4371
100 Ga0081540_1023666 3300005983 Bacteria 3585
101 Ga0081540_1056316 3300005983 Unclassified 1909
102 Ga0081540_1056487 3300005983 Bacteria 1659
103 Ga0081539_10003381 3300005985 Bacteria 19747
104 Ga0081539_10011930 3300005985 Bacteria 6781
105 Ga0081539_10019777 3300005985 Unclassified 4590
106 Ga0081539_10023975 3300005985 Unclassified 3977
107 Ga0081539_10054884 3300005985 Bacteria 2221
108 Ga0075432_10022522 3300006058 Bacteria 2155
109 Ga0075432_10030367 3300006058 Unclassified 1867
110 Ga0075432_10030447 3300006058 Bacteria 1865
111 Ga0075432_10037865 3300006058 Bacteria 1679
112 Ga0075427_10000628 3300006194 Bacteria 4143
113 Ga0075427_10001247 3300006194 Bacteria 3241
114 Ga0075427_10001314 3300006194 Unclassified 3186
115 Ga0075427_10001493 3300006194 Bacteria 3011
116 Ga0075427_10005036 3300006194 Bacteria 1874
117 Ga0075428_100065270 3300006844 Bacteria 3986
118 Ga0075428_100098426 3300006844 Unclassified 3189
119 Ga0075428_100126186 3300006844 Bacteria 2785
120 Ga0075428_100132683 3300006844 Unclassified 2708
121 Ga0075428_100169759 3300006844 Bacteria 2365
122 Ga0075428_100199881 3300006844 Bacteria 2161
123 Ga0075428_100280911 3300006844 Bacteria 1791
124 Ga0075430_100040968 3300006846 Bacteria 3919
125 Ga0075430_100041152 3300006846 Bacteria 3910
126 Ga0075430_100085132 3300006846 Unclassified 2647
127 Ga0075430_100098505 3300006846 Bacteria 2443
128 Ga0075430_100098915 3300006846 Bacteria 2436
129 Ga0075430_100100328 3300006846 Bacteria 2418
130 Ga0075430_100126656 3300006846 Bacteria 2129
131 Ga0075430_100128727 3300006846 Bacteria 2110
132 Ga0075430_100137210 3300006846 Unclassified 2037
133 Ga0075430_100147227 3300006846 Bacteria 1961
134 Ga0075430_100182870 3300006846 Bacteria 1743
135 Ga0075431_100158606 3300006847 Bacteria 2327
136 Ga0075431_100184164 3300006847 Bacteria 2142
137 Ga0075431_100185632 3300006847 Bacteria 2132
138 Ga0075431_100234812 3300006847 Bacteria 1867
139 Ga0075431_100249808 3300006847 Bacteria 1802
140 Ga0075433_10052650 3300006852 Unclassified 3547
141 Ga0075433_10063032 3300006852 Unclassified 3247
142 Ga0075433_10119286 3300006852 Bacteria 2341
143 Ga0075433_10130747 3300006852 Bacteria 2230
144 Ga0075433_10135530 3300006852 Bacteria 2189
145 Ga0075433_10151131 3300006852 Bacteria 2066
146 Ga0075434_100059729 3300006871 Unclassified 3791
147 Ga0075434_100117352 3300006871 Bacteria 2674
148 Ga0075434_100138973 3300006871 Bacteria 2449
149 Ga0075434_100168574 3300006871 Bacteria 2210
150 Ga0075434_100232605 3300006871 Bacteria 1863
151 Ga0075434_100234362 3300006871 Bacteria 1855
152 Ga0075429_100062056 3300006880 Bacteria 3256
153 Ga0075429_100091061 3300006880 Bacteria 2660
154 Ga0075429_100119743 3300006880 Bacteria 2300
155 Ga0075429_100122690 3300006880 Bacteria 2271
156 Ga0075429_100141665 3300006880 Bacteria 2104
157 Ga0075429_100158698 3300006880 Bacteria 1980
158 Ga0075429_100159320 3300006880 Bacteria 1976
159 Ga0075429_100217508 3300006880 Bacteria 1674
160 Ga0068865_100172313 3300006881 Unclassified 1660
161 Ga0075436_100116471 3300006914 Unclassified 1867
162 Ga0075436_100129838 3300006914 Bacteria 1767
163 Ga0075436_100139231 3300006914 Unclassified 1705
164 Ga0097620_100170740 3300006931 Bacteria 2255
165 Ga0097620_100250226 3300006931 Bacteria 1863
166 Ga0075435_100080874 3300007076 Bacteria 2668
167 Ga0075435_100086924 3300007076 Bacteria 2575
168 Ga0075435_100118869 3300007076 Bacteria 2204
169 Ga0075435_100154910 3300007076 Bacteria 1928
170 Ga0099794_10023482 3300007265 Bacteria 2821
171 Ga0099794_10063095 3300007265 Bacteria 1803
172 Ga0105240_10218621 3300009093 Bacteria 2221
173 Ga0105240_10339828 3300009093 Bacteria 1706
174 Ga0111539_10088188 3300009094 Unclassified 3645
175 Ga0111539_10095934 3300009094 Bacteria 3483
176 Ga0111539_10117784 3300009094 Bacteria 3113
177 Ga0111539_10144836 3300009094 Bacteria 2781
178 Ga0111539_10205154 3300009094 Bacteria 2298
179 Ga0111539_10223351 3300009094 Bacteria 2194
180 Ga0114129_10235520 3300009147 Unclassified 2463
181 Ga0114129_10321389 3300009147 Bacteria 2057
182 Ga0114129_10330731 3300009147 Unclassified 2023
183 Ga0114129_10337075 3300009147 Bacteria 2001
184 Ga0114129_10346144 3300009147 Bacteria 1970
185 Ga0114129_10352944 3300009147 Bacteria 1948
186 Ga0114129_10353945 3300009147 Bacteria 1944
187 Ga0114129_10442201 3300009147 Bacteria 1707
188 Ga0114129_10457608 3300009147 Unclassified 1673
189 Ga0114129_10457791 3300009147 Bacteria 1672
190 Ga0114129_10510857 3300009147 Unclassified 1568
191 Ga0114129_10584801 3300009147 Bacteria 1448
192 Ga0105241_10164255 3300009174 Bacteria 1828
193 Ga0105249_10042729 3300009553 Bacteria 4123
194 Ga0105249_10146208 3300009553 Bacteria 2271
195 Ga0105249_10158601 3300009553 Bacteria 2184
196 Ga0105249_10199591 3300009553 Bacteria 1957
197 Ga0105249_10204862 3300009553 Bacteria 1932
198 Ga0105249_10241131 3300009553 Bacteria 1787
199 Ga0105239_10203262 3300010375 Bacteria 2220
200 Ga0105239_10400847 3300010375 Bacteria 1552
201 Ga0105246_10125558 3300011119 Bacteria 1908
202 Ga0105246_10163846 3300011119 Bacteria 1696
203 Ga0157321_1000530 3300012487 Unclassified 1743
204 Ga0157329_1000313 3300012491 Unclassified 1737
205 Ga0157345_1000993 3300012498 Bacteria 2076
206 Ga0157347_1001070 3300012502 Unclassified 2047
207 Ga0157324_1000526 3300012506 Unclassified 1838
208 Ga0163162_10155294 3300013306 Unclassified 2408
209 Ga0163162_10162665 3300013306 Bacteria 2354
210 Ga0163162_10177471 3300013306 Bacteria 2256
211 Ga0163162_10349826 3300013306 Unclassified 1610
212 Ga0157375_10246211 3300013308 Bacteria 1948
213 Ga0157380_10166996 3300014326 Bacteria 1919
214 Ga0157379_10196337 3300014968 Bacteria 1824
215 Ga0163161_10031189 3300017792 Bacteria 3797
216 Ga0163161_10063578 3300017792 Bacteria 2690
217 Ga0163161_10124026 3300017792 Unclassified 1943
218 Ga0207642_10067700 3300025899 Bacteria 1687
219 Ga0207645_10113462 3300025907 Bacteria 1756
220 Ga0207643_10047943 3300025908 Unclassified 2419
221 Ga0207684_10066044 3300025910 Unclassified 3072
222 Ga0207654_10107132 3300025911 Bacteria 1732
223 Ga0207662_10100214 3300025918 Unclassified 1794
224 Ga0207681_10138484 3300025923 Bacteria 1809
225 Ga0207687_10163688 3300025927 Bacteria 1710
226 Ga0207706_10045099 3300025933 Bacteria 3907
227 Ga0207706_10057102 3300025933 Bacteria 3440
228 Ga0207706_10157570 3300025933 Bacteria 1996
229 Ga0207670_10156212 3300025936 Bacteria 1698
230 Ga0207669_10043990 3300025937 Unclassified 2619
231 Ga0207691_10153699 3300025940 Bacteria 2022
232 Ga0207689_10104890 3300025942 Bacteria 2323
233 Ga0207667_10269850 3300025949 Unclassified 1739
234 Ga0207712_10014934 3300025961 Bacteria 5002
235 Ga0207712_10108603 3300025961 Bacteria 2077
236 Ga0207712_10159850 3300025961 Bacteria 1750
237 Ga0207712_10162829 3300025961 Unclassified 1736
238 Ga0207712_10169538 3300025961 Bacteria 1705
239 Ga0207668_10029486 3300025972 Unclassified 3596
240 Ga0207668_10135452 3300025972 Bacteria 1886
241 Ga0207668_10166567 3300025972 Bacteria 1723
242 Ga0207668_10167293 3300025972 Bacteria 1720
243 Ga0207703_10219471 3300026035 Bacteria 1699
244 Ga0207708_10061015 3300026075 Bacteria 2879
245 Ga0207708_10085166 3300026075 Bacteria 2431
246 Ga0207648_10052840 3300026089 Bacteria 3552
247 Ga0207648_10140501 3300026089 Bacteria 2128
248 Ga0207674_10103716 3300026116 Bacteria 2823
249 Ga0207675_100082318 3300026118 Bacteria 3018
250 Ga0207675_100215721 3300026118 Unclassified 1847
251 Ga0209588_1017581 3300027671 Bacteria 2218
252 Ga0207428_10025496 3300027907 Bacteria 4949
253 Ga0207428_10049429 3300027907 Bacteria 3370
254 Ga0207428_10090166 3300027907 Bacteria 2382
255 Ga0207428_10106769 3300027907 Bacteria 2158
256 Ga0207428_10111655 3300027907 Bacteria 2103
257 Ga0207428_10145190 3300027907 Unclassified 1809
258 Ga0207428_10164902 3300027907 Bacteria 1681
259 Ga0268265_10037120 3300028380 Bacteria 3573
260 Ga0268265_10191776 3300028380 Bacteria 1765
261 Ga0268265_10207498 3300028380 Bacteria 1704
262 Ga0268265_10208054 3300028380 Unclassified 1702
263 Ga0268264_10231106 3300028381 Bacteria 1708
264 Ga0268264_10231379 3300028381 Bacteria 1707
265 Ga0268264_10247079 3300028381 Unclassified 1656
266 Ga0268264_10257416 3300028381 Unclassified 1624
267 Ga0395901_0231851 3300038443 Bacteria 1927
268 Ga0439447_005882 3300041407 Bacteria 4034
269 Ga0439453_0007117 3300041408 Bacteria 1763
270 Ga0439433_0016422 3300041999 Bacteria 1640
271 Ga0439443_002734 3300042003 Bacteria 2145
272 Ga0439448_0027331 3300042005 Bacteria 1797
273 Ga0439450_007654 3300042008 Bacteria 1988
274 Ga0439450_007674 3300042008 Unclassified 1986
275 Ga0439450_007926 3300042008 Bacteria 1964
276 Ga0439450_011021 3300042008 Bacteria 1758
277 Ga0439455_0009496 3300042012 Bacteria 2113
278 Ga0439456_009170 3300042013 Bacteria 2043
279 Ga0439463_008819 3300042016 Bacteria 2481
280 Ga0439434_0030599 3300042435 Bacteria 1634
281 Ga0439435_0001064 3300042436 Bacteria 4856
282 Ga0439444_0009854 3300042437 Bacteria 1514
283 Ga0439464_0013954 3300042439 Bacteria 2157
284 Ga0439464_0027880 3300042439 Unclassified 1572
285 Ga0439460_0004786 3300042461 Bacteria 3304
286 Ga0439460_0007517 3300042461 Bacteria 2730
287 Ga0439460_0008661 3300042461 Bacteria 2570
288 Ga0439460_0018498 3300042461 Bacteria 1877
289 Ga0439460_0019177 3300042461 Unclassified 1849
290 Ga0439440_0010618 3300042993 Unclassified 1928
291 Ga0439440_0011914 3300042993 Bacteria 1841
292 Ga0439440_0013482 3300042993 Bacteria 1754
293 Ga0453683_0091452 3300044673 Unclassified 1907
294 Ga0466968_0041201 3300044735 Bacteria 1948
295 Ga0495627_034033 3300046453 Bacteria 1594
296 Ga0495591_038190 3300046458 Bacteria 1384
297 Ga0495585_0051133 3300046492 Bacteria 2290
298 Ga0495596_0038612 3300046500 Bacteria 1887
299 Ga0495607_0063524 3300046501 Bacteria 2088
300 Ga0495631_0030804 3300046518 Bacteria 2431
301 Ga0495644_0033693 3300046523 Bacteria 1934
302 Ga0495644_0041204 3300046523 Bacteria 1739
303 Ga0495663_0011510 3300046525 Bacteria 2461
304 Ga0495598_0018524 3300046537 Unclassified 1811
305 Ga0495598_0019897 3300046537 Bacteria 1765
306 Ga0495609_0057571 3300046538 Bacteria 1720
307 Ga0495621_0028686 3300046539 Bacteria 1893
308 Ga0495621_0037331 3300046539 Bacteria 1689
309 Ga0495633_0059008 3300046558 Bacteria 1800
310 Ga0495633_0075761 3300046558 Bacteria 1566
311 Ga0495656_0047187 3300046615 Bacteria 1825
312 Ga0495656_0049731 3300046615 Bacteria 1786
313 Ga0495656_0052686 3300046615 Bacteria 1745
314 Ga0495656_0053806 3300046615 Bacteria 1730
315 Ga0495656_0054479 3300046615 Unclassified 1721
316 Ga0495611_0057856 3300046648 Bacteria 1757
317 Ga0495659_0014290 3300046664 Bacteria 2598
318 Ga0495659_0054557 3300046664 Bacteria 1462
319 Ga0495661_0035466 3300046665 Bacteria 3129
320 Ga0495661_0077527 3300046665 Bacteria 1925
321 Ga0495661_0085933 3300046665 Bacteria 1802
322 Ga0495670_0075285 3300046691 Bacteria 1713
323 Ga0495677_0047425 3300047445 Bacteria 1577
324 Ga0495679_012247 3300047446 Unclassified 3272
325 Ga0495685_009954 3300047447 Bacteria 3183
326 Ga0496102_0249626 3300048905 Bacteria 1673
327 Ga0501039_0161349 3300049575 Unclassified 1762
328 Ga0501048_0089274 3300049582 Unclassified 2174
329 Ga0501072_0049257 3300049588 Bacteria 3316
330 Ga0501045_0022819 3300049824 Unclassified 4483
331 nmdc:mga05p37_128110_c1 3300050507 Bacteria 3116
332 nmdc:mga05p37_217925_c1 3300050507 Bacteria 2305
333 nmdc:mga05p37_236104_c1 3300050507 Bacteria 2201
334 nmdc:mga05p37_236658_c1 3300050507 Unclassified 2198
335 nmdc:mga05p37_26921_c1 3300050507 Bacteria 6997
336 nmdc:mga05p37_280148_c1 3300050507 Bacteria 1989
337 nmdc:mga05p37_286148_c1 3300050507 Unclassified 1964
338 nmdc:mga05p37_289889_c1 3300050507 Bacteria 1949
339 nmdc:mga05p37_318453_c1 3300050507 Bacteria 1842
340 nmdc:mga05p37_326638_c1 3300050507 Unclassified 1814
341 nmdc:mga05p37_331444_c1 3300050507 Bacteria 1798
342 nmdc:mga05p37_341849_c1 3300050507 Bacteria 1765
343 nmdc:mga05p37_365616_c1 3300050507 Unclassified 1695
344 nmdc:mga05p37_373571_c1 3300050507 Bacteria 1673
345 nmdc:mga05p37_379080_c1 3300050507 Unclassified 1658
346 nmdc:mga05p37_56511_c1 3300050507 Bacteria 4833
347 nmdc:mga05p37_75090_c1 3300050507 Bacteria 4161
348 nmdc:mga09592_123743_c1 3300050508 Bacteria 2223
349 nmdc:mga09592_124179_c1 3300050508 Bacteria 2219
350 nmdc:mga09592_155080_c1 3300050508 Unclassified 1977
351 nmdc:mga09592_196016_c1 3300050508 Bacteria 1749
352 nmdc:mga09592_199717_c1 3300050508 Bacteria 1732
353 nmdc:mga09592_201949_c1 3300050508 Bacteria 1722
354 nmdc:mga09592_23533_c1 3300050508 Bacteria 5089
355 nmdc:mga09592_5914_c1 3300050508 Bacteria 9976
356 nmdc:mga09592_86580_c1 3300050508 Bacteria 2674
357 nmdc:mga0qj67_133436_c1 3300050509 Bacteria 2012
358 nmdc:mga0qj67_160584_c1 3300050509 Bacteria 1825
359 nmdc:mga0qj67_160623_c1 3300050509 Bacteria 1824
360 nmdc:mga0qj67_170389_c1 3300050509 Bacteria 1768
361 nmdc:mga0qj67_173551_c1 3300050509 Unclassified 1751
362 nmdc:mga0qj67_175573_c1 3300050509 Bacteria 1740
363 nmdc:mga0qj67_179270_c1 3300050509 Unclassified 1721
364 nmdc:mga0qj67_179670_c1 3300050509 Bacteria 1719
365 nmdc:mga0qj67_34292_c1 3300050509 Bacteria 3965
366 nmdc:mga0qj67_36316_c1 3300050509 Bacteria 3855
367 nmdc:mga0qj67_89175_c1 3300050509 Bacteria 2477
368 nmdc:mga06r32_127905_c1 3300050510 Bacteria 2510
369 nmdc:mga06r32_132694_c1 3300050510 Bacteria 2464
370 nmdc:mga06r32_169298_c1 3300050510 Unclassified 2168
371 nmdc:mga06r32_222980_c1 3300050510 Bacteria 1874
372 nmdc:mga06r32_240841_c1 3300050510 Bacteria 1797
373 nmdc:mga06r32_253474_c1 3300050510 Bacteria 1748
374 nmdc:mga06r32_259727_c1 3300050510 Bacteria 1725
375 nmdc:mga06r32_265278_c1 3300050510 Unclassified 1705
376 nmdc:mga06r32_431376_c1 3300050510 Bacteria 1299
377 nmdc:mga06r32_84680_c1 3300050510 Bacteria 3091
378 nmdc:mga08y16_105127_c1 3300050511 Bacteria 2940
379 nmdc:mga08y16_117380_c1 3300050511 Bacteria 2770
380 nmdc:mga08y16_168798_c1 3300050511 Unclassified 2273
381 nmdc:mga08y16_226480_c1 3300050511 Bacteria 1935
382 nmdc:mga08y16_46057_c1 3300050511 Bacteria 4568
383 nmdc:mga08y16_71121_c1 3300050511 Unclassified 3626
384 nmdc:mga0n895_174795_c1 3300050512 Bacteria 2179
385 nmdc:mga0n895_247124_c1 3300050512 Bacteria 1811
386 nmdc:mga0n895_247155_c1 3300050512 Bacteria 1811
387 nmdc:mga0n895_262467_c1 3300050512 Bacteria 1753
388 nmdc:mga0n895_273982_c1 3300050512 Bacteria 1712
389 nmdc:mga0n895_321298_c1 3300050512 Unclassified 1569
390 nmdc:mga0n895_58678_c1 3300050512 Unclassified 3795
391 nmdc:mga0n895_98246_c1 3300050512 Unclassified 2935
392 nmdc:mga0rr50_143673_c1 3300050513 Bacteria 1922
393 nmdc:mga0rr50_153610_c1 3300050513 Bacteria 1863
394 nmdc:mga0rr50_159869_c1 3300050513 Unclassified 1828
395 nmdc:mga0rr50_169553_c1 3300050513 Bacteria 1778
396 nmdc:mga0rr50_177452_c1 3300050513 Bacteria 1740
397 nmdc:mga0rr50_181902_c1 3300050513 Unclassified 1719
398 nmdc:mga0rr50_279425_c1 3300050513 Unclassified 1393
399 nmdc:mga08x19_114368_c1 3300050514 Unclassified 1803
400 nmdc:mga08x19_115831_c1 3300050514 Bacteria 1792
401 nmdc:mga08x19_73354_c1 3300050514 Unclassified 2234
402 nmdc:mga08x19_99269_c1 3300050514 Unclassified 1930
403 nmdc:mga0a205_113187_c1 3300050515 Unclassified 2613
404 nmdc:mga0a205_151456_c1 3300050515 Bacteria 2219
405 nmdc:mga0a205_180292_c1 3300050515 Unclassified 2007
406 nmdc:mga0a205_284759_c1 3300050515 Bacteria 1528
407 nmdc:mga0a205_69102_c1 3300050515 Bacteria 3412
408 nmdc:mga0a205_96916_c1 3300050515 Unclassified 2849
409 Ga0495655_0012585 3300053083 Bacteria 1728
410 Ga0501084_0213690 3300054114 Unclassified 1627
411 Ga0530510_0120940 3300061734 Unclassified 1922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_431376_c1 nmdc:mga06r32_431376_c1_100_1281 365
2 3300042461 Ga0439460_0019177 Ga0439460_0019177_12_1193 383
3 3300050507 nmdc:mga05p37_379080_c1 nmdc:mga05p37_379080_c1_406_1638 400
4 3300009147 Ga0114129_10321389 Ga0114129_103213891 405
5 3300046458 Ga0495591_038190 Ga0495591_038190_27_1373 417
6 3300042439 Ga0439464_0027880 Ga0439464_0027880_32_1333 423
7 3300046665 Ga0495661_0085933 Ga0495661_0085933_437_1774 423
8 3300009147 Ga0114129_10510857 Ga0114129_105108571 426
9 3300050513 nmdc:mga0rr50_279425_c1 nmdc:mga0rr50_279425_c1_54_1376 430
10 3300009147 Ga0114129_10584801 Ga0114129_105848011 438
11 3300042435 Ga0439434_0030599 Ga0439434_0030599_41_1387 438
12 3300042437 Ga0439444_0009854 Ga0439444_0009854_38_1384 438
13 3300050509 nmdc:mga0qj67_175573_c1 nmdc:mga0qj67_175573_c1_14_1360 438
14 3300003203 JGI25406J46586_10039059 JGI25406J46586_100390591 442
15 3300005445 Ga0070708_100217006 Ga0070708_1002170061 442
16 3300005981 Ga0081538_10041597 Ga0081538_100415972 442
17 3300005985 Ga0081539_10003381 Ga0081539_1000338113 442
18 3300006846 Ga0075430_100128727 Ga0075430_1001287272 442
19 3300006880 Ga0075429_100217508 Ga0075429_1002175081 442
20 3300009147 Ga0114129_10457608 Ga0114129_104576081 442
21 3300027907 Ga0207428_10049429 Ga0207428_100494291 442
22 3300050507 nmdc:mga05p37_289889_c1 nmdc:mga05p37_289889_c1_180_1613 442
23 3300050508 nmdc:mga09592_199717_c1 nmdc:mga09592_199717_c1_206_1645 442
24 3300050513 nmdc:mga0rr50_181902_c1 nmdc:mga0rr50_181902_c1_60_1574 442
25 3300005536 Ga0070697_100124421 Ga0070697_1001244212 443
26 3300006880 Ga0075429_100158698 Ga0075429_1001586982 444
27 3300009147 Ga0114129_10352944 Ga0114129_103529441 444
28 3300050507 nmdc:mga05p37_331444_c1 nmdc:mga05p37_331444_c1_277_1746 444
29 3300050507 nmdc:mga05p37_341849_c1 nmdc:mga05p37_341849_c1_69_1502 444
30 3300050515 nmdc:mga0a205_284759_c1 nmdc:mga0a205_284759_c1_74_1507 444
31 3300005983 Ga0081540_1016470 Ga0081540_10164704 445
32 3300042003 Ga0439443_002734 Ga0439443_002734_270_1703 445
33 3300006914 Ga0075436_100139231 Ga0075436_1001392312 446
34 3300041407 Ga0439447_005882 Ga0439447_005882_44_1477 446
35 3300041999 Ga0439433_0016422 Ga0439433_0016422_106_1539 446
36 3300046453 Ga0495627_034033 Ga0495627_034033_22_1455 446
37 3300046492 Ga0495585_0051133 Ga0495585_0051133_280_1713 446
38 3300046500 Ga0495596_0038612 Ga0495596_0038612_310_1743 446
39 3300046501 Ga0495607_0063524 Ga0495607_0063524_280_1713 446
40 3300046518 Ga0495631_0030804 Ga0495631_0030804_163_1596 446
41 3300046523 Ga0495644_0033693 Ga0495644_0033693_145_1578 446
42 3300046537 Ga0495598_0019897 Ga0495598_0019897_62_1495 446
43 3300046538 Ga0495609_0057571 Ga0495609_0057571_74_1507 446
44 3300046539 Ga0495621_0028686 Ga0495621_0028686_429_1862 446
45 3300046558 Ga0495633_0075761 Ga0495633_0075761_77_1510 446
46 3300046615 Ga0495656_0052686 Ga0495656_0052686_227_1660 446
47 3300046648 Ga0495611_0057856 Ga0495611_0057856_289_1722 446
48 3300046664 Ga0495659_0014290 Ga0495659_0014290_1101_2534 446
49 3300046665 Ga0495661_0035466 Ga0495661_0035466_809_2242 446
50 3300047445 Ga0495677_0047425 Ga0495677_0047425_81_1514 446
51 3300047446 Ga0495679_012247 Ga0495679_012247_1544_2977 446
52 3300047447 Ga0495685_009954 Ga0495685_009954_139_1572 446
53 3300050507 nmdc:mga05p37_365616_c1 nmdc:mga05p37_365616_c1_30_1463 446
54 3300050513 nmdc:mga0rr50_159869_c1 nmdc:mga0rr50_159869_c1_343_1776 446
55 3300050514 nmdc:mga08x19_114368_c1 nmdc:mga08x19_114368_c1_290_1723 446
56 3300044673 Ga0453683_0091452 Ga0453683_0091452_361_1794 448
57 3300006194 Ga0075427_10001314 Ga0075427_100013143 449
58 3300006852 Ga0075433_10130747 Ga0075433_101307473 449
59 3300006880 Ga0075429_100062056 Ga0075429_1000620563 449
60 3300007076 Ga0075435_100080874 Ga0075435_1000808742 449
61 3300009094 Ga0111539_10205154 Ga0111539_102051542 449
62 3300009553 Ga0105249_10241131 Ga0105249_102411312 449
63 3300027907 Ga0207428_10111655 Ga0207428_101116551 449
64 3300046523 Ga0495644_0041204 Ga0495644_0041204_267_1700 449
65 3300046525 Ga0495663_0011510 Ga0495663_0011510_269_1702 449
66 3300046537 Ga0495598_0018524 Ga0495598_0018524_260_1693 449
67 3300046539 Ga0495621_0037331 Ga0495621_0037331_14_1447 449
68 3300046558 Ga0495633_0059008 Ga0495633_0059008_259_1692 449
69 3300046615 Ga0495656_0047187 Ga0495656_0047187_158_1591 449
70 3300046665 Ga0495661_0077527 Ga0495661_0077527_112_1545 449
71 3300046691 Ga0495670_0075285 Ga0495670_0075285_259_1692 449
72 3300050509 nmdc:mga0qj67_160584_c1 nmdc:mga0qj67_160584_c1_254_1687 449
73 3300007265 Ga0099794_10023482 Ga0099794_100234821 450
74 3300013306 Ga0163162_10155294 Ga0163162_101552941 450
75 3300027671 Ga0209588_1017581 Ga0209588_10175811 450
76 3300005546 Ga0070696_100159515 Ga0070696_1001595151 451
77 3300005981 Ga0081538_10059720 Ga0081538_100597202 451
78 3300006871 Ga0075434_100138973 Ga0075434_1001389732 451
79 3300003373 JGI25407J50210_10020815 JGI25407J50210_100208151 452
80 3300005981 Ga0081538_10055505 Ga0081538_100555052 452
81 3300050507 nmdc:mga05p37_56511_c1 nmdc:mga05p37_56511_c1_1050_2513 452
82 3300050508 nmdc:mga09592_23533_c1 nmdc:mga09592_23533_c1_2322_3785 452
83 3300050509 nmdc:mga0qj67_34292_c1 nmdc:mga0qj67_34292_c1_1509_2972 452
84 3300005457 Ga0070662_100168824 Ga0070662_1001688241 453
85 3300005614 Ga0068856_100193333 Ga0068856_1001933332 453
86 3300005937 Ga0081455_10014234 Ga0081455_100142342 453
87 3300005937 Ga0081455_10090279 Ga0081455_100902792 453
88 3300005981 Ga0081538_10022334 Ga0081538_100223345 453
89 3300009093 Ga0105240_10339828 Ga0105240_103398281 453
90 3300009174 Ga0105241_10164255 Ga0105241_101642552 453
91 3300010375 Ga0105239_10400847 Ga0105239_104008471 453
92 3300025911 Ga0207654_10107132 Ga0207654_101071322 453
93 3300002070 JGI24750J21931_1000933 JGI24750J21931_10009332 454
94 3300002070 JGI24750J21931_1004235 JGI24750J21931_10042351 454
95 3300003911 JGI25405J52794_10011642 JGI25405J52794_100116421 454
96 3300005289 Ga0065704_10003903 Ga0065704_100039031 454
97 3300005289 Ga0065704_10080895 Ga0065704_100808951 454
98 3300005289 Ga0065704_10127132 Ga0065704_101271321 454
99 3300005295 Ga0065707_10003973 Ga0065707_100039732 454
100 3300005295 Ga0065707_10138841 Ga0065707_101388411 454
101 3300005347 Ga0070668_100037454 Ga0070668_1000374542 454
102 3300005347 Ga0070668_100152075 Ga0070668_1001520752 454
103 3300005563 Ga0068855_100251784 Ga0068855_1002517842 454
104 3300005719 Ga0068861_100032966 Ga0068861_1000329661 454
105 3300005719 Ga0068861_100118507 Ga0068861_1001185072 454
106 3300005719 Ga0068861_100138014 Ga0068861_1001380142 454
107 3300005843 Ga0068860_100181414 Ga0068860_1001814142 454
108 3300005844 Ga0068862_100070361 Ga0068862_1000703612 454
109 3300005844 Ga0068862_100183839 Ga0068862_1001838391 454
110 3300005937 Ga0081455_10137045 Ga0081455_101370452 454
111 3300005983 Ga0081540_1011754 Ga0081540_10117542 454
112 3300005983 Ga0081540_1023666 Ga0081540_10236661 454
113 3300009093 Ga0105240_10218621 Ga0105240_102186212 454
114 3300009094 Ga0111539_10223351 Ga0111539_102233512 454
115 3300009553 Ga0105249_10042729 Ga0105249_100427292 454
116 3300009553 Ga0105249_10146208 Ga0105249_101462081 454
117 3300013306 Ga0163162_10162665 Ga0163162_101626652 454
118 3300013306 Ga0163162_10177471 Ga0163162_101774712 454
119 3300017792 Ga0163161_10031189 Ga0163161_100311893 454
120 3300017792 Ga0163161_10124026 Ga0163161_101240261 454
121 3300025933 Ga0207706_10045099 Ga0207706_100450993 454
122 3300025933 Ga0207706_10057102 Ga0207706_100571022 454
123 3300025949 Ga0207667_10269850 Ga0207667_102698501 454
124 3300025961 Ga0207712_10014934 Ga0207712_100149342 454
125 3300025961 Ga0207712_10159850 Ga0207712_101598501 454
126 3300025961 Ga0207712_10162829 Ga0207712_101628291 454
127 3300025972 Ga0207668_10029486 Ga0207668_100294862 454
128 3300025972 Ga0207668_10135452 Ga0207668_101354521 454
129 3300025972 Ga0207668_10167293 Ga0207668_101672931 454
130 3300026118 Ga0207675_100215721 Ga0207675_1002157211 454
131 3300028380 Ga0268265_10037120 Ga0268265_100371202 454
132 3300028380 Ga0268265_10208054 Ga0268265_102080541 454
133 3300028381 Ga0268264_10257416 Ga0268264_102574161 454
134 3300042993 Ga0439440_0010618 Ga0439440_0010618_198_1631 454
135 3300050507 nmdc:mga05p37_217925_c1 nmdc:mga05p37_217925_c1_732_2165 454
136 3300050508 nmdc:mga09592_124179_c1 nmdc:mga09592_124179_c1_741_2174 454
137 3300050509 nmdc:mga0qj67_179670_c1 nmdc:mga0qj67_179670_c1_244_1677 454
138 3300050510 nmdc:mga06r32_84680_c1 nmdc:mga06r32_84680_c1_222_1655 454
139 3300002155 JGI24033J26618_1002480 JGI24033J26618_10024802 455
140 3300005328 Ga0070676_10082123 Ga0070676_100821231 455
141 3300005334 Ga0068869_100120151 Ga0068869_1001201512 455
142 3300005353 Ga0070669_100109801 Ga0070669_1001098011 455
143 3300005356 Ga0070674_100088031 Ga0070674_1000880312 455
144 3300005438 Ga0070701_10074730 Ga0070701_100747301 455
145 3300005441 Ga0070700_100062862 Ga0070700_1000628622 455
146 3300005444 Ga0070694_100103230 Ga0070694_1001032301 455
147 3300005459 Ga0068867_100100048 Ga0068867_1001000482 455
148 3300005518 Ga0070699_100092481 Ga0070699_1000924812 455
149 3300005543 Ga0070672_100136929 Ga0070672_1001369292 455
150 3300005544 Ga0070686_100022999 Ga0070686_1000229991 455
151 3300005549 Ga0070704_100099253 Ga0070704_1000992532 455
152 3300005577 Ga0068857_100148713 Ga0068857_1001487132 455
153 3300005617 Ga0068859_100250233 Ga0068859_1002502331 455
154 3300005718 Ga0068866_10056216 Ga0068866_100562161 455
155 3300005840 Ga0068870_10032305 Ga0068870_100323053 455
156 3300005844 Ga0068862_100171190 Ga0068862_1001711902 455
157 3300005937 Ga0081455_10039377 Ga0081455_100393772 455
158 3300006931 Ga0097620_100250226 Ga0097620_1002502261 455
159 3300009094 Ga0111539_10095934 Ga0111539_100959341 455
160 3300009553 Ga0105249_10204862 Ga0105249_102048621 455
161 3300011119 Ga0105246_10163846 Ga0105246_101638462 455
162 3300013308 Ga0157375_10246211 Ga0157375_102462111 455
163 3300014326 Ga0157380_10166996 Ga0157380_101669961 455
164 3300025899 Ga0207642_10067700 Ga0207642_100677001 455
165 3300025907 Ga0207645_10113462 Ga0207645_101134621 455
166 3300025908 Ga0207643_10047943 Ga0207643_100479433 455
167 3300025923 Ga0207681_10138484 Ga0207681_101384841 455
168 3300025937 Ga0207669_10043990 Ga0207669_100439902 455
169 3300025940 Ga0207691_10153699 Ga0207691_101536992 455
170 3300025942 Ga0207689_10104890 Ga0207689_101048902 455
171 3300025961 Ga0207712_10169538 Ga0207712_101695381 455
172 3300026075 Ga0207708_10061015 Ga0207708_100610152 455
173 3300026089 Ga0207648_10140501 Ga0207648_101405012 455
174 3300026116 Ga0207674_10103716 Ga0207674_101037162 455
175 3300027907 Ga0207428_10164902 Ga0207428_101649021 455
176 3300028380 Ga0268265_10207498 Ga0268265_102074981 455
177 3300028381 Ga0268264_10247079 Ga0268264_102470791 455
178 3300042008 Ga0439450_011021 Ga0439450_011021_90_1523 455
179 3300042439 Ga0439464_0013954 Ga0439464_0013954_378_1811 455
180 3300042461 Ga0439460_0008661 Ga0439460_0008661_957_2390 455
181 3300042993 Ga0439440_0013482 Ga0439440_0013482_289_1722 455
182 3300046615 Ga0495656_0049731 Ga0495656_0049731_300_1745 455
183 3300050510 nmdc:mga06r32_132694_c1 nmdc:mga06r32_132694_c1_705_2138 455
184 3300050511 nmdc:mga08y16_226480_c1 nmdc:mga08y16_226480_c1_259_1746 455
185 3300000652 ARCol0yngRDRAFT_1000616 ARCol0yngRDRAFT_10006161 456
186 3300003373 JGI25407J50210_10005112 JGI25407J50210_100051121 456
187 3300003911 JGI25405J52794_10011405 JGI25405J52794_100114051 456
188 3300005937 Ga0081455_10130903 Ga0081455_101309032 456
189 3300005981 Ga0081538_10015427 Ga0081538_100154277 456
190 3300046615 Ga0495656_0053806 Ga0495656_0053806_20_1453 456
191 3300007265 Ga0099794_10063095 Ga0099794_100630951 457
192 3300005981 Ga0081538_10058042 Ga0081538_100580422 458
193 3300005985 Ga0081539_10054884 Ga0081539_100548841 458
194 3300006844 Ga0075428_100169759 Ga0075428_1001697593 458
195 3300006846 Ga0075430_100100328 Ga0075430_1001003282 458
196 3300006846 Ga0075430_100137210 Ga0075430_1001372102 458
197 3300006847 Ga0075431_100158606 Ga0075431_1001586063 458
198 3300006847 Ga0075431_100249808 Ga0075431_1002498081 458
199 3300006880 Ga0075429_100141665 Ga0075429_1001416652 458
200 3300009094 Ga0111539_10088188 Ga0111539_100881882 458
201 3300009147 Ga0114129_10353945 Ga0114129_103539452 458
202 3300046664 Ga0495659_0054557 Ga0495659_0054557_20_1426 458
203 3300050507 nmdc:mga05p37_236104_c1 nmdc:mga05p37_236104_c1_529_1962 458
204 3300050508 nmdc:mga09592_123743_c1 nmdc:mga09592_123743_c1_385_1818 458
205 3300050509 nmdc:mga0qj67_173551_c1 nmdc:mga0qj67_173551_c1_285_1718 458
206 3300050511 nmdc:mga08y16_168798_c1 nmdc:mga08y16_168798_c1_550_1983 458
207 3300003373 JGI25407J50210_10021343 JGI25407J50210_100213432 460
208 3300005467 Ga0070706_100176257 Ga0070706_1001762572 460
209 3300005981 Ga0081538_10054744 Ga0081538_100547442 460
210 3300006194 Ga0075427_10001493 Ga0075427_100014933 460
211 3300025910 Ga0207684_10066044 Ga0207684_100660441 460
212 3300050508 nmdc:mga09592_5914_c1 nmdc:mga09592_5914_c1_3585_5018 460
213 3300050514 nmdc:mga08x19_99269_c1 nmdc:mga08x19_99269_c1_206_1681 461
214 3300003373 JGI25407J50210_10010356 JGI25407J50210_100103562 462
215 3300007076 Ga0075435_100118869 Ga0075435_1001188691 462
216 3300050512 nmdc:mga0n895_321298_c1 nmdc:mga0n895_321298_c1_42_1475 462
217 3300050513 nmdc:mga0rr50_177452_c1 nmdc:mga0rr50_177452_c1_65_1540 462
218 3300006844 Ga0075428_100132683 Ga0075428_1001326834 465
219 3300009094 Ga0111539_10144836 Ga0111539_101448364 465
220 3300009147 Ga0114129_10235520 Ga0114129_102355201 465
221 3300050510 nmdc:mga06r32_127905_c1 nmdc:mga06r32_127905_c1_311_1738 465
222 3300000042 ARSoilYngRDRAFT_c00610 ARSoilYngRDRAFT_006103 467
223 3300000042 ARSoilYngRDRAFT_c01076 ARSoilYngRDRAFT_010761 467
224 3300000043 ARcpr5yngRDRAFT_c002976 ARcpr5yngRDRAFT_0029762 467
225 3300000044 ARSoilOldRDRAFT_c001723 ARSoilOldRDRAFT_0017231 467
226 3300000652 ARCol0yngRDRAFT_1001695 ARCol0yngRDRAFT_10016951 467
227 3300000652 ARCol0yngRDRAFT_1001709 ARCol0yngRDRAFT_10017091 467
228 3300000652 ARCol0yngRDRAFT_1001757 ARCol0yngRDRAFT_10017571 467
229 3300002070 JGI24750J21931_1004436 JGI24750J21931_10044361 467
230 3300003203 JGI25406J46586_10024890 JGI25406J46586_100248902 467
231 3300003659 JGI25404J52841_10012448 JGI25404J52841_100124481 467
232 3300003659 JGI25404J52841_10014425 JGI25404J52841_100144251 467
233 3300005276 Ga0065717_1002548 Ga0065717_10025481 467
234 3300005338 Ga0068868_100109289 Ga0068868_1001092893 467
235 3300005340 Ga0070689_100088408 Ga0070689_1000884082 467
236 3300005343 Ga0070687_100062201 Ga0070687_1000622012 467
237 3300005365 Ga0070688_100062576 Ga0070688_1000625762 467
238 3300005366 Ga0070659_100191516 Ga0070659_1001915161 467
239 3300005367 Ga0070667_100203557 Ga0070667_1002035571 467
240 3300005438 Ga0070701_10083559 Ga0070701_100835591 467
241 3300005441 Ga0070700_100091949 Ga0070700_1000919492 467
242 3300005445 Ga0070708_100048901 Ga0070708_1000489012 467
243 3300005445 Ga0070708_100109462 Ga0070708_1001094622 467
244 3300005459 Ga0068867_100074256 Ga0068867_1000742563 467
245 3300005466 Ga0070685_10091607 Ga0070685_100916071 467
246 3300005544 Ga0070686_100097708 Ga0070686_1000977082 467
247 3300005617 Ga0068859_100170749 Ga0068859_1001707493 467
248 3300005719 Ga0068861_100164647 Ga0068861_1001646472 467
249 3300005842 Ga0068858_100236219 Ga0068858_1002362192 467
250 3300005843 Ga0068860_100211476 Ga0068860_1002114762 467
251 3300005843 Ga0068860_100224954 Ga0068860_1002249541 467
252 3300005937 Ga0081455_10039587 Ga0081455_100395874 467
253 3300005937 Ga0081455_10045623 Ga0081455_100456232 467
254 3300005937 Ga0081455_10125258 Ga0081455_101252582 467
255 3300005981 Ga0081538_10008197 Ga0081538_100081974 467
256 3300005981 Ga0081538_10075755 Ga0081538_100757551 467
257 3300005983 Ga0081540_1007726 Ga0081540_10077261 467
258 3300005983 Ga0081540_1017882 Ga0081540_10178822 467
259 3300005983 Ga0081540_1056316 Ga0081540_10563161 467
260 3300005983 Ga0081540_1056487 Ga0081540_10564871 467
261 3300005985 Ga0081539_10011930 Ga0081539_100119305 467
262 3300005985 Ga0081539_10019777 Ga0081539_100197773 467
263 3300005985 Ga0081539_10023975 Ga0081539_100239753 467
264 3300006058 Ga0075432_10022522 Ga0075432_100225222 467
265 3300006058 Ga0075432_10030367 Ga0075432_100303671 467
266 3300006058 Ga0075432_10030447 Ga0075432_100304472 467
267 3300006058 Ga0075432_10037865 Ga0075432_100378651 467
268 3300006194 Ga0075427_10000628 Ga0075427_100006287 467
269 3300006194 Ga0075427_10001247 Ga0075427_100012473 467
270 3300006194 Ga0075427_10005036 Ga0075427_100050362 467
271 3300006844 Ga0075428_100065270 Ga0075428_1000652702 467
272 3300006844 Ga0075428_100098426 Ga0075428_1000984262 467
273 3300006844 Ga0075428_100126186 Ga0075428_1001261862 467
274 3300006844 Ga0075428_100199881 Ga0075428_1001998812 467
275 3300006844 Ga0075428_100280911 Ga0075428_1002809112 467
276 3300006846 Ga0075430_100040968 Ga0075430_1000409684 467
277 3300006846 Ga0075430_100041152 Ga0075430_1000411522 467
278 3300006846 Ga0075430_100085132 Ga0075430_1000851321 467
279 3300006846 Ga0075430_100098505 Ga0075430_1000985052 467
280 3300006846 Ga0075430_100098915 Ga0075430_1000989152 467
281 3300006846 Ga0075430_100126656 Ga0075430_1001266562 467
282 3300006846 Ga0075430_100147227 Ga0075430_1001472271 467
283 3300006846 Ga0075430_100182870 Ga0075430_1001828702 467
284 3300006847 Ga0075431_100184164 Ga0075431_1001841642 467
285 3300006847 Ga0075431_100185632 Ga0075431_1001856322 467
286 3300006847 Ga0075431_100234812 Ga0075431_1002348121 467
287 3300006852 Ga0075433_10052650 Ga0075433_100526505 467
288 3300006852 Ga0075433_10063032 Ga0075433_100630324 467
289 3300006852 Ga0075433_10119286 Ga0075433_101192863 467
290 3300006852 Ga0075433_10135530 Ga0075433_101355301 467
291 3300006852 Ga0075433_10151131 Ga0075433_101511311 467
292 3300006871 Ga0075434_100059729 Ga0075434_1000597292 467
293 3300006871 Ga0075434_100117352 Ga0075434_1001173523 467
294 3300006871 Ga0075434_100168574 Ga0075434_1001685743 467
295 3300006871 Ga0075434_100232605 Ga0075434_1002326052 467
296 3300006871 Ga0075434_100234362 Ga0075434_1002343621 467
297 3300006880 Ga0075429_100091061 Ga0075429_1000910612 467
298 3300006880 Ga0075429_100119743 Ga0075429_1001197432 467
299 3300006880 Ga0075429_100122690 Ga0075429_1001226903 467
300 3300006880 Ga0075429_100159320 Ga0075429_1001593202 467
301 3300006881 Ga0068865_100172313 Ga0068865_1001723131 467
302 3300006914 Ga0075436_100116471 Ga0075436_1001164711 467
303 3300006914 Ga0075436_100129838 Ga0075436_1001298381 467
304 3300006931 Ga0097620_100170740 Ga0097620_1001707403 467
305 3300007076 Ga0075435_100086924 Ga0075435_1000869242 467
306 3300007076 Ga0075435_100154910 Ga0075435_1001549101 467
307 3300009094 Ga0111539_10117784 Ga0111539_101177842 467
308 3300009147 Ga0114129_10330731 Ga0114129_103307311 467
309 3300009147 Ga0114129_10337075 Ga0114129_103370751 467
310 3300009147 Ga0114129_10346144 Ga0114129_103461441 467
311 3300009147 Ga0114129_10442201 Ga0114129_104422011 467
312 3300009147 Ga0114129_10457791 Ga0114129_104577911 467
313 3300009553 Ga0105249_10158601 Ga0105249_101586011 467
314 3300009553 Ga0105249_10199591 Ga0105249_101995911 467
315 3300010375 Ga0105239_10203262 Ga0105239_102032621 467
316 3300011119 Ga0105246_10125558 Ga0105246_101255582 467
317 3300012487 Ga0157321_1000530 Ga0157321_10005301 467
318 3300012491 Ga0157329_1000313 Ga0157329_10003132 467
319 3300012498 Ga0157345_1000993 Ga0157345_10009932 467
320 3300012502 Ga0157347_1001070 Ga0157347_10010701 467
321 3300012506 Ga0157324_1000526 Ga0157324_10005262 467
322 3300013306 Ga0163162_10349826 Ga0163162_103498261 467
323 3300014968 Ga0157379_10196337 Ga0157379_101963372 467
324 3300017792 Ga0163161_10063578 Ga0163161_100635782 467
325 3300025918 Ga0207662_10100214 Ga0207662_101002142 467
326 3300025927 Ga0207687_10163688 Ga0207687_101636882 467
327 3300025933 Ga0207706_10157570 Ga0207706_101575701 467
328 3300025936 Ga0207670_10156212 Ga0207670_101562122 467
329 3300025961 Ga0207712_10108603 Ga0207712_101086031 467
330 3300025972 Ga0207668_10166567 Ga0207668_101665671 467
331 3300026035 Ga0207703_10219471 Ga0207703_102194711 467
332 3300026075 Ga0207708_10085166 Ga0207708_100851662 467
333 3300026089 Ga0207648_10052840 Ga0207648_100528404 467
334 3300026118 Ga0207675_100082318 Ga0207675_1000823181 467
335 3300027907 Ga0207428_10025496 Ga0207428_100254966 467
336 3300027907 Ga0207428_10090166 Ga0207428_100901661 467
337 3300027907 Ga0207428_10106769 Ga0207428_101067692 467
338 3300027907 Ga0207428_10145190 Ga0207428_101451901 467
339 3300028380 Ga0268265_10191776 Ga0268265_101917761 467
340 3300028381 Ga0268264_10231106 Ga0268264_102311061 467
341 3300028381 Ga0268264_10231379 Ga0268264_102313792 467
342 3300038443 Ga0395901_0231851 Ga0395901_0231851_292_1779 467
343 3300041408 Ga0439453_0007117 Ga0439453_0007117_246_1679 467
344 3300042005 Ga0439448_0027331 Ga0439448_0027331_74_1507 467
345 3300042008 Ga0439450_007654 Ga0439450_007654_487_1920 467
346 3300042008 Ga0439450_007674 Ga0439450_007674_455_1918 467
347 3300042008 Ga0439450_007926 Ga0439450_007926_276_1709 467
348 3300042012 Ga0439455_0009496 Ga0439455_0009496_232_1665 467
349 3300042013 Ga0439456_009170 Ga0439456_009170_558_1991 467
350 3300042016 Ga0439463_008819 Ga0439463_008819_134_1567 467
351 3300042436 Ga0439435_0001064 Ga0439435_0001064_134_1567 467
352 3300042461 Ga0439460_0004786 Ga0439460_0004786_1801_3234 467
353 3300042461 Ga0439460_0007517 Ga0439460_0007517_701_2164 467
354 3300042461 Ga0439460_0018498 Ga0439460_0018498_312_1745 467
355 3300042993 Ga0439440_0011914 Ga0439440_0011914_145_1578 467
356 3300044735 Ga0466968_0041201 Ga0466968_0041201_444_1877 467
357 3300046615 Ga0495656_0054479 Ga0495656_0054479_68_1501 467
358 3300048905 Ga0496102_0249626 Ga0496102_0249626_201_1634 467
359 3300049575 Ga0501039_0161349 Ga0501039_0161349_197_1630 467
360 3300049582 Ga0501048_0089274 Ga0501048_0089274_170_1603 467
361 3300049588 Ga0501072_0049257 Ga0501072_0049257_1589_3022 467
362 3300049824 Ga0501045_0022819 Ga0501045_0022819_423_1856 467
363 3300050507 nmdc:mga05p37_128110_c1 nmdc:mga05p37_128110_c1_1338_2771 467
364 3300050507 nmdc:mga05p37_236658_c1 nmdc:mga05p37_236658_c1_239_1672 467
365 3300050507 nmdc:mga05p37_26921_c1 nmdc:mga05p37_26921_c1_5544_6977 467
366 3300050507 nmdc:mga05p37_280148_c1 nmdc:mga05p37_280148_c1_446_1879 467
367 3300050507 nmdc:mga05p37_286148_c1 nmdc:mga05p37_286148_c1_353_1786 467
368 3300050507 nmdc:mga05p37_318453_c1 nmdc:mga05p37_318453_c1_145_1578 467
369 3300050507 nmdc:mga05p37_326638_c1 nmdc:mga05p37_326638_c1_256_1743 467
370 3300050507 nmdc:mga05p37_373571_c1 nmdc:mga05p37_373571_c1_21_1484 467
371 3300050507 nmdc:mga05p37_75090_c1 nmdc:mga05p37_75090_c1_2428_3861 467
372 3300050508 nmdc:mga09592_155080_c1 nmdc:mga09592_155080_c1_321_1754 467
373 3300050508 nmdc:mga09592_196016_c1 nmdc:mga09592_196016_c1_239_1702 467
374 3300050508 nmdc:mga09592_201949_c1 nmdc:mga09592_201949_c1_247_1680 467
375 3300050508 nmdc:mga09592_86580_c1 nmdc:mga09592_86580_c1_595_2028 467
376 3300050509 nmdc:mga0qj67_133436_c1 nmdc:mga0qj67_133436_c1_106_1539 467
377 3300050509 nmdc:mga0qj67_160623_c1 nmdc:mga0qj67_160623_c1_321_1754 467
378 3300050509 nmdc:mga0qj67_170389_c1 nmdc:mga0qj67_170389_c1_108_1541 467
379 3300050509 nmdc:mga0qj67_179270_c1 nmdc:mga0qj67_179270_c1_244_1677 467
380 3300050509 nmdc:mga0qj67_36316_c1 nmdc:mga0qj67_36316_c1_2396_3829 467
381 3300050509 nmdc:mga0qj67_89175_c1 nmdc:mga0qj67_89175_c1_32_1495 467
382 3300050510 nmdc:mga06r32_169298_c1 nmdc:mga06r32_169298_c1_314_1747 467
383 3300050510 nmdc:mga06r32_222980_c1 nmdc:mga06r32_222980_c1_109_1572 467
384 3300050510 nmdc:mga06r32_240841_c1 nmdc:mga06r32_240841_c1_124_1557 467
385 3300050510 nmdc:mga06r32_253474_c1 nmdc:mga06r32_253474_c1_36_1469 467
386 3300050510 nmdc:mga06r32_259727_c1 nmdc:mga06r32_259727_c1_55_1488 467
387 3300050510 nmdc:mga06r32_265278_c1 nmdc:mga06r32_265278_c1_20_1453 467
388 3300050511 nmdc:mga08y16_105127_c1 nmdc:mga08y16_105127_c1_470_1903 467
389 3300050511 nmdc:mga08y16_117380_c1 nmdc:mga08y16_117380_c1_1204_2637 467
390 3300050511 nmdc:mga08y16_46057_c1 nmdc:mga08y16_46057_c1_2790_4223 467
391 3300050511 nmdc:mga08y16_71121_c1 nmdc:mga08y16_71121_c1_402_1835 467
392 3300050512 nmdc:mga0n895_174795_c1 nmdc:mga0n895_174795_c1_492_1925 467
393 3300050512 nmdc:mga0n895_247124_c1 nmdc:mga0n895_247124_c1_84_1517 467
394 3300050512 nmdc:mga0n895_247155_c1 nmdc:mga0n895_247155_c1_234_1667 467
395 3300050512 nmdc:mga0n895_262467_c1 nmdc:mga0n895_262467_c1_39_1472 467
396 3300050512 nmdc:mga0n895_273982_c1 nmdc:mga0n895_273982_c1_37_1500 467
397 3300050512 nmdc:mga0n895_58678_c1 nmdc:mga0n895_58678_c1_2218_3651 467
398 3300050512 nmdc:mga0n895_98246_c1 nmdc:mga0n895_98246_c1_1257_2690 467
399 3300050513 nmdc:mga0rr50_143673_c1 nmdc:mga0rr50_143673_c1_53_1486 467
400 3300050513 nmdc:mga0rr50_153610_c1 nmdc:mga0rr50_153610_c1_286_1719 467
401 3300050513 nmdc:mga0rr50_169553_c1 nmdc:mga0rr50_169553_c1_316_1749 467
402 3300050514 nmdc:mga08x19_115831_c1 nmdc:mga08x19_115831_c1_317_1750 467
403 3300050514 nmdc:mga08x19_73354_c1 nmdc:mga08x19_73354_c1_422_1855 467
404 3300050515 nmdc:mga0a205_113187_c1 nmdc:mga0a205_113187_c1_1137_2570 467
405 3300050515 nmdc:mga0a205_151456_c1 nmdc:mga0a205_151456_c1_655_2088 467
406 3300050515 nmdc:mga0a205_180292_c1 nmdc:mga0a205_180292_c1_244_1677 467
407 3300050515 nmdc:mga0a205_69102_c1 nmdc:mga0a205_69102_c1_1838_3301 467
408 3300050515 nmdc:mga0a205_96916_c1 nmdc:mga0a205_96916_c1_925_2358 467
409 3300053083 Ga0495655_0012585 Ga0495655_0012585_53_1516 467
410 3300054114 Ga0501084_0213690 Ga0501084_0213690_138_1571 467
411 3300061734 Ga0530510_0120940 Ga0530510_0120940_370_1803 467

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13546

DDE_5

DDE superfamily endonuclease

55

319

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kge-assembly1.cif.gz_A structure of beta-lactamase asn 170 met mutant 0.6055 286 320
1kgg-assembly1.cif.gz_A structure of beta-lactamase glu166gln:asn170asp mutant 0.6008 286 320
6wgr-assembly3.cif.gz_C the crystal structure of a beta-lactamase from staphylococcus aureus subsp. aureus usa300_tch1516 0.5951 286 320
3hut-assembly1.cif.gz_A crystal structure of a putative branched-chain amino acid abc transporter from rhodospirillum rubrum 0.5877 195 244
1blc-assembly1.cif.gz_A inhibition of beta-lactamase by clavulanate: trapped intermediates in cryocrystallographic studies 0.5791 286 320
ID Description Score Start End Superfamily
af_B4FQK7_103_259_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.6569 195 245 3.80.10.10
af_Q6ESZ2_270_362_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6508 135 245 3.30.420.10
af_A0A0R0I7G1_209_351_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6325 85 235 3.30.420.10
af_E9AGS6_13_445_3.40.50.12780 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.626 201 243 3.40.50.12780
af_A0A0R0EK69_173_338_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6211 81 245 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A450TU25-F1-model_v4 Transposase DDE domain-containing protein 0.9352 203 351
AF-A0A401FR71-F1-model_v4 Uncharacterized protein 0.9298 224 311
AF-A0A450U2M2-F1-model_v4 Transposase DDE domain-containing protein 0.9293 232 351
AF-A0A0F9B5H7-F1-model_v4 Transposase IS4-like domain-containing protein 0.9174 216 437
AF-A0A451C202-F1-model_v4 DDE superfamily endonuclease 0.9161 134 269 GO:0004519

Feature Viewer

pLDDT pTM Quality
75.84 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map