F437460

General Info

Members Datasets Scaffolds Average Seq Length
411 254 379 967

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100000576|Ga0070663_10000057614
Length 1023
Sequence MKERLVFHNSATLQTALQNGVDATTQTKYRGANAQMHLRSYGGTPVVRTDIALAACILGLASVASAAKPALEAXXXXASELDANGHPRALLPGDGEFRFTRLPDGVQFRVKGITKTILFYGADTVRVNANLGENYWTARSLVVTAKPGGVSFSVTESPATLLIATQKLRIIADKQTGALRFTDAGGKLFTEERQADPEMLKRVTISGAPSYEAQNTLKLQRDEAIYGFGFTADDHSNRRGTDLLLVQTNMGIIIPVMMSSRRYGVMWDTYSQMRFKDDANGASLWAESAPGGVDYYFMAGNTPDDVVRAYRDLTGAAPMYPKQAFGLFMSKERYKTQEQLLDVASSFRKEGFPLDYIVQDWQYWGSDKDGSWSGMTWDPTRYPDPEGMIKALHDMHLKLMMSIWPSIGNDTALAHELDAHNLRFAPLHWISKHARVYDAYSPLGRQIYFKHIKAGLLDKGVDALWMDGTEVEVSSAMWNAADNIRDTKALGSNALGDFTRYLNPYSLLTTQGTYDGERATANKRVFTLTRSAWAGAQRTAAASWSGDIFASWKTLKQQIAGGVDVTVTGNPYWTQDTGGFFVSEFPGGEQNPAWRELYARWLQFATFNPLMRIHGTDVEREPYRFKSLDPQVYDSLLKSVQLRYRLLPYIYPLSWKVTSAGYTLMRPLMMDFPDDRATDTIDDSFMFGPSLLVHPVTRAMYHILPPPPATVPGEYLRTPDGKPGLAGQYFEGRFGVPKGEFVDAKIDHTWPDPPLADIPGGLTSLNDFSVRWQGTLTAPEDGTYELGLDGDDGYRLILDGKTVVSSWQNGAARYKGTEQTLRKGQVVNVTIEYFQGDGNRSLRFGWRRPSELQEARNAVHALDTSVATYLPKGAGWFDFWTNQRFAGGQRVTRQVPLDILPLYVRAGSIVPMGPKVQYATQAPGAPYELRIYPGADARFTIYEDDNETYDYEKGRYASYDLVWNDRTHSLIIGPRHGRFTGMIPTRRLNIAVMSERNATGLGAAPPSKSILYRGKPVTVSFAR

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
4 2643221556 Massilia sp. Root1485 Isolate Unclassified
5 2643221583 Caulobacter sp. Root655 Isolate Unclassified
6 2643221638 Duganella sp. Root336D2 Isolate Unclassified
7 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
8 2643221645 Massilia sp. Root351 Isolate Unclassified
9 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
10 2643221664 Massilia sp. Root418 Isolate Unclassified
11 2643221684 Massilia sp. Root133 Isolate Unclassified
12 2738541280 Massilia sp. GV090 Isolate Unclassified
13 2738541300 Massilia sp. GV016 Isolate Unclassified
14 2738543018 Massilia sp. GV045 Isolate Unclassified
15 2738543030 Massilia sp. GV097 Isolate Unclassified
16 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
17 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
18 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
19 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
20 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
21 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
22 2821131069 Duganella sp. 1224 Isolate Unclassified
23 2842711865 Duganella sp. R-73148 Isolate Unclassified
24 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
25 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
26 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
27 2904424332 Duganella sp. 1411 Isolate Rhizosphere
28 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
29 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
30 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
31 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
34 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
35 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
36 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
37 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
38 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
39 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
40 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
41 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
44 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
47 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
48 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
49 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
50 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
95 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
163 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
164 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
169 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
194 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
236 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
237 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
238 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
239 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
240 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
245 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
246 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
247 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
248 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
249 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
250 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
254 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.21
Metatranscriptomes 0
Isolates 7.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.84
Nodule 0
Rhizoplane 2.92
Rhizosphere 59.37
Stem 0
Stem Tuber 0
Unclassified 13.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000426 3300001915 Bacteria 12780
2 JGI24741J21665_1001663 3300001915 Bacteria 6175
3 JGI24740J21852_10006425 3300001979 Bacteria 4869
4 JGI24740J21852_10009529 3300001979 Bacteria 3796
5 JGI24735J21928_10002943 3300002067 Bacteria 5854
6 JGI24735J21928_10008643 3300002067 Bacteria 3287
7 JGI24744J21845_10000760 3300002077 Bacteria 6018
8 JGI25156J39149_1000026 3300002705 Bacteria 132099
9 JGI25154J39366_1002022 3300002738 Bacteria 5858
10 JGI25157J39369_1000008 3300002741 Bacteria 211083
11 JGI25152J39213_1000002 3300002773 Bacteria 219237
12 JGI25150J39212_1000038 3300002774 Bacteria 88070
13 JGI25165J46597_1000082 3300003214 Bacteria 174736
14 JGI25153J46596_10000005 3300003215 Bacteria 492839
15 JGI25153J46596_10007021 3300003215 Bacteria 5608
16 rootL2_10017473 3300003322 Bacteria 12107
17 rootL2_10093835 3300003322 Bacteria 3625
18 JGI25161J50226_1000062 3300003374 Bacteria 99783
19 JGI25161J50226_1000758 3300003374 Bacteria 12367
20 Ga0055539_1000561 3300003752 Bacteria 10746
21 Ga0055526_1000229 3300003771 Bacteria 47279
22 Ga0055526_1000734 3300003771 Bacteria 24710
23 Ga0055526_1002194 3300003771 Bacteria 13377
24 Ga0055537_1000516 3300003773 Bacteria 22835
25 Ga0055537_1000569 3300003773 Bacteria 20727
26 Ga0055537_1001433 3300003773 Bacteria 9319
27 Ga0055524_1000095 3300003775 Bacteria 109223
28 Ga0055524_1000105 3300003775 Bacteria 104121
29 Ga0055524_1000543 3300003775 Bacteria 28542
30 Ga0055536_1000614 3300003781 Bacteria 24285
31 Ga0055536_1000979 3300003781 Bacteria 18138
32 Ga0055528_1000296 3300003790 Bacteria 42288
33 Ga0055530_10000078 3300003791 Bacteria 83740
34 Ga0055530_10001470 3300003791 Bacteria 17163
35 Ga0055530_10001919 3300003791 Bacteria 14197
36 Ga0055530_10003310 3300003791 Bacteria 9312
37 Ga0055531_10001121 3300003794 Bacteria 20738
38 Ga0055531_10001916 3300003794 Bacteria 14551
39 Ga0055543_1000413 3300004625 Bacteria 26934
40 Ga0065165_1000261 3300005262 Bacteria 90816
41 Ga0065165_1001967 3300005262 Bacteria 19463
42 Ga0070658_10000198 3300005327 Bacteria 53037
43 Ga0070658_10000997 3300005327 Bacteria 24288
44 Ga0070658_10001963 3300005327 Bacteria 17312
45 Ga0070658_10037455 3300005327 Bacteria 3910
46 Ga0070658_10062123 3300005327 Bacteria 3044
47 Ga0068869_100002615 3300005334 Bacteria 10866
48 Ga0068868_100000025 3300005338 Bacteria 82086
49 Ga0070660_100000328 3300005339 Bacteria 31334
50 Ga0070660_100002358 3300005339 Bacteria 12979
51 Ga0070660_100002527 3300005339 Bacteria 12533
52 Ga0070660_100007482 3300005339 Bacteria 7614
53 Ga0070660_100017743 3300005339 Bacteria 5191
54 Ga0070660_100023355 3300005339 Bacteria 4581
55 Ga0070661_100004712 3300005344 Bacteria 9384
56 Ga0070673_100000016 3300005364 Bacteria 114927
57 Ga0070659_100000795 3300005366 Bacteria 22991
58 Ga0070663_100000576 3300005455 Bacteria 19619
59 Ga0070678_100000008 3300005456 Bacteria 64802
60 Ga0068867_100000962 3300005459 Bacteria 19626
61 Ga0070679_100007263 3300005530 Bacteria 10344
62 Ga0068853_100000036 3300005539 Bacteria 108488
63 Ga0068853_100001281 3300005539 Bacteria 18024
64 Ga0068855_100000007 3300005563 Bacteria 273676
65 Ga0068855_100008887 3300005563 Bacteria 12145
66 Ga0068855_100019042 3300005563 Bacteria 8252
67 Ga0068854_100000016 3300005578 Bacteria 145396
68 Ga0068854_100000092 3300005578 Bacteria 63516
69 Ga0068856_100053290 3300005614 Bacteria 3988
70 Ga0068852_100044171 3300005616 Bacteria 3782
71 Ga0068859_100000074 3300005617 Bacteria 92064
72 Ga0068861_100000017 3300005719 Bacteria 78362
73 Ga0068851_10004689 3300005834 Bacteria 6179
74 Ga0068858_100000608 3300005842 Bacteria 37381
75 Ga0075362_10007195 3300006177 Bacteria 4200
76 Ga0075370_10021119 3300006353 Bacteria 3566
77 Ga0068871_100005824 3300006358 Bacteria 8661
78 Ga0068865_100000026 3300006881 Bacteria 93349
79 Ga0097620_100000074 3300006931 Bacteria 92064
80 Ga0105240_10000025 3300009093 Bacteria 367124
81 Ga0105240_10008610 3300009093 Bacteria 14579
82 Ga0105240_10069202 3300009093 Bacteria 4370
83 Ga0105245_10000078 3300009098 Bacteria 100583
84 Ga0105245_10001409 3300009098 Bacteria 21801
85 Ga0105243_10000394 3300009148 Bacteria 46074
86 Ga0105243_10000475 3300009148 Bacteria 41145
87 Ga0105243_10018075 3300009148 Bacteria 5335
88 Ga0105241_10000625 3300009174 Bacteria 26580
89 Ga0105241_10012337 3300009174 Bacteria 6267
90 Ga0105241_10018109 3300009174 Bacteria 5179
91 Ga0105242_10000137 3300009176 Bacteria 53136
92 Ga0105242_10002432 3300009176 Bacteria 14627
93 Ga0105242_10009092 3300009176 Bacteria 7632
94 Ga0105248_10001759 3300009177 Bacteria 24104
95 Ga0105248_10027048 3300009177 Bacteria 6381
96 Ga0105237_10000130 3300009545 Bacteria 105282
97 Ga0105237_10036831 3300009545 Bacteria 4949
98 Ga0105239_10000605 3300010375 Bacteria 51086
99 Ga0105246_10008012 3300011119 Bacteria 6485
100 Ga0157371_10000094 3300013102 Bacteria 139074
101 Ga0157370_10000288 3300013104 Bacteria 63948
102 Ga0157374_10000087 3300013296 Bacteria 91263
103 Ga0157372_10021230 3300013307 Bacteria 7015
104 Ga0157372_10025027 3300013307 Bacteria 6486
105 Ga0157372_10039265 3300013307 Bacteria 5224
106 Ga0157375_10000503 3300013308 Bacteria 35295
107 Ga0157376_10003058 3300014969 Bacteria 11466
108 Ga0183365_10004 3300015684 Bacteria 333304
109 Ga0183365_10006 3300015684 Bacteria 225936
110 Ga0209436_100005 3300025208 Bacteria 151087
111 Ga0209436_100565 3300025208 Bacteria 15949
112 Ga0207427_102137 3300025231 Bacteria 5711
113 Ga0207425_1000001 3300025245 Bacteria 2525432
114 Ga0207425_1000119 3300025245 Bacteria 74008
115 Ga0209646_1000039 3300025246 Bacteria 349637
116 Ga0209026_1000006 3300025250 Bacteria 677225
117 Ga0209677_100549 3300025253 Bacteria 20845
118 Ga0209148_1000061 3300025254 Bacteria 349575
119 Ga0209148_1000650 3300025254 Bacteria 30019
120 Ga0209148_1001058 3300025254 Bacteria 16945
121 Ga0209759_1000020 3300025256 Bacteria 344904
122 Ga0209129_1000001 3300025258 Bacteria 1452436
123 Ga0209129_1004363 3300025258 Bacteria 5564
124 Ga0209233_1000041 3300025261 Bacteria 515463
125 Ga0209233_1007364 3300025261 Bacteria 3491
126 Ga0209565_1000008 3300025263 Bacteria 774179
127 Ga0209565_1000397 3300025263 Bacteria 36695
128 Ga0209565_1000643 3300025263 Bacteria 22611
129 Ga0209565_1000672 3300025263 Bacteria 21620
130 Ga0209565_1001325 3300025263 Bacteria 11340
131 Ga0209455_1000429 3300025272 Bacteria 32869
132 Ga0209673_1000007 3300025273 Bacteria 634477
133 Ga0209673_1001402 3300025273 Bacteria 23466
134 Ga0209130_1000055 3300025284 Bacteria 211696
135 Ga0209130_1001525 3300025284 Bacteria 14857
136 Ga0209675_1000003 3300025291 Bacteria 1003982
137 Ga0209675_1000234 3300025291 Bacteria 55443
138 Ga0209675_1000374 3300025291 Bacteria 37975
139 Ga0209676_1000295 3300025292 Bacteria 100711
140 Ga0209676_1000468 3300025292 Bacteria 67646
141 Ga0209564_1000124 3300025295 Bacteria 202046
142 Ga0209564_1000203 3300025295 Bacteria 136358
143 Ga0209564_1000444 3300025295 Bacteria 71274
144 Ga0209564_1000459 3300025295 Bacteria 68564
145 Ga0209564_1001715 3300025295 Bacteria 20596
146 Ga0209758_1000001 3300025297 Bacteria 1981790
147 Ga0209758_1000020 3300025297 Bacteria 734220
148 Ga0209050_1000253 3300025298 Bacteria 114525
149 Ga0209050_1000293 3300025298 Bacteria 106097
150 Ga0209050_1000313 3300025298 Bacteria 98580
151 Ga0209050_1000362 3300025298 Bacteria 87030
152 Ga0209050_1000486 3300025298 Bacteria 69279
153 Ga0209256_1000009 3300025299 Bacteria 922071
154 Ga0209256_1000010 3300025299 Bacteria 912110
155 Ga0209256_1000028 3300025299 Bacteria 420213
156 Ga0209256_1000097 3300025299 Bacteria 204513
157 Ga0209256_1000790 3300025299 Bacteria 40844
158 Ga0209256_1001184 3300025299 Bacteria 29313
159 Ga0209256_1001522 3300025299 Bacteria 23395
160 Ga0209256_1005370 3300025299 Bacteria 7418
161 Ga0209051_1009013 3300025303 Bacteria 5196
162 Ga0209257_1000003 3300025304 Bacteria 1702593
163 Ga0209257_1000520 3300025304 Bacteria 66890
164 Ga0209257_1000850 3300025304 Bacteria 43660
165 Ga0209257_1003579 3300025304 Bacteria 13165
166 Ga0209257_1006121 3300025304 Bacteria 7978
167 Ga0207656_10003715 3300025321 Bacteria 5284
168 Ga0207656_10012799 3300025321 Bacteria 3193
169 Ga0207688_10015724 3300025901 Bacteria 4105
170 Ga0207647_10004083 3300025904 Bacteria 10848
171 Ga0207647_10004207 3300025904 Bacteria 10674
172 Ga0207705_10000049 3300025909 Bacteria 170616
173 Ga0207705_10000249 3300025909 Bacteria 53095
174 Ga0207705_10007510 3300025909 Bacteria 8010
175 Ga0207705_10044287 3300025909 Unclassified 3198
176 Ga0207654_10000020 3300025911 Bacteria 167053
177 Ga0207654_10003662 3300025911 Bacteria 7751
178 Ga0207654_10014844 3300025911 Bacteria 4032
179 Ga0207695_10000025 3300025913 Bacteria 627211
180 Ga0207695_10005407 3300025913 Bacteria 16946
181 Ga0207695_10012282 3300025913 Bacteria 10287
182 Ga0207695_10017885 3300025913 Bacteria 8213
183 Ga0207671_10001177 3300025914 Bacteria 31119
184 Ga0207671_10023603 3300025914 Bacteria 4637
185 Ga0207657_10001967 3300025919 Bacteria 22194
186 Ga0207657_10002419 3300025919 Bacteria 20168
187 Ga0207657_10008244 3300025919 Bacteria 10606
188 Ga0207657_10032249 3300025919 Bacteria 4736
189 Ga0207657_10050412 3300025919 Bacteria 3623
190 Ga0207649_10009836 3300025920 Bacteria 5241
191 Ga0207652_10001407 3300025921 Bacteria 21349
192 Ga0207694_10007016 3300025924 Bacteria 8552
193 Ga0207694_10041828 3300025924 Bacteria 3532
194 Ga0207687_10002419 3300025927 Bacteria 12664
195 Ga0207664_10030391 3300025929 Unclassified 4125
196 Ga0207690_10004189 3300025932 Bacteria 8522
197 Ga0207706_10005052 3300025933 Bacteria 12318
198 Ga0207686_10002463 3300025934 Bacteria 10052
199 Ga0207709_10000139 3300025935 Bacteria 102200
200 Ga0207709_10000187 3300025935 Bacteria 82937
201 Ga0207709_10017749 3300025935 Bacteria 3977
202 Ga0207669_10001661 3300025937 Bacteria 9467
203 Ga0207704_10000006 3300025938 Bacteria 220005
204 Ga0207691_10014508 3300025940 Bacteria 7514
205 Ga0207711_10003423 3300025941 Bacteria 13728
206 Ga0207689_10001911 3300025942 Bacteria 19691
207 Ga0207667_10000006 3300025949 Bacteria 679876
208 Ga0207667_10000038 3300025949 Bacteria 280720
209 Ga0207667_10005692 3300025949 Bacteria 15198
210 Ga0207667_10010760 3300025949 Bacteria 10671
211 Ga0207651_10000001 3300025960 Bacteria 516823
212 Ga0207640_10000001 3300025981 Bacteria 628778
213 Ga0207640_10000142 3300025981 Bacteria 52324
214 Ga0207640_10004700 3300025981 Bacteria 7415
215 Ga0207677_10000016 3300026023 Bacteria 153771
216 Ga0207703_10000123 3300026035 Bacteria 92590
217 Ga0207639_10000058 3300026041 Bacteria 108456
218 Ga0207639_10001458 3300026041 Bacteria 15924
219 Ga0207639_10002766 3300026041 Bacteria 11786
220 Ga0207639_10005197 3300026041 Bacteria 8780
221 Ga0207678_10003654 3300026067 Bacteria 13821
222 Ga0207678_10004134 3300026067 Bacteria 13040
223 Ga0207678_10030842 3300026067 Unclassified 4681
224 Ga0207678_10042503 3300026067 Bacteria 3937
225 Ga0207702_10002032 3300026078 Bacteria 19607
226 Ga0207702_10002612 3300026078 Bacteria 16920
227 Ga0207702_10003011 3300026078 Bacteria 15666
228 Ga0207648_10000042 3300026089 Bacteria 114885
229 Ga0207674_10010322 3300026116 Bacteria 10588
230 Ga0207674_10023489 3300026116 Bacteria 6603
231 Ga0207675_100000462 3300026118 Bacteria 39560
232 Ga0207698_10013641 3300026142 Bacteria 5370
233 Ga0265326_10002838 3300028558 Bacteria 5782
234 Ga0307515_10000004 3300028794 Bacteria 846506
235 Ga0307515_10000026 3300028794 Bacteria 382411
236 Ga0307515_10035278 3300028794 Bacteria 8144
237 Ga0265331_10002582 3300031250 Bacteria 12175
238 Ga0307408_100000022 3300031548 Bacteria 310242
239 Ga0307408_100000964 3300031548 Bacteria 22306
240 Ga0307408_100001584 3300031548 Bacteria 16793
241 Ga0307408_100004400 3300031548 Bacteria 9562
242 Ga0307408_100007022 3300031548 Bacteria 7446
243 Ga0307508_10001070 3300031616 Bacteria 31688
244 Ga0307412_10000126 3300031911 Bacteria 56270
245 Ga0307414_10000270 3300032004 Bacteria 32016
246 Ga0373931_0000925 3300035691 Bacteria 12354
247 Ga0395900_0006364 3300037418 Bacteria 12310
248 Ga0395900_0052951 3300037418 Bacteria 4177
249 Ga0395898_0013893 3300037466 Bacteria 8275
250 Ga0395905_0013977 3300037471 Bacteria 7680
251 Ga0439461_0001555 3300041410 Bacteria 3560
252 Ga0451800_0972437 3300041459 Bacteria 17116
253 Ga0451806_498691 3300041462 Bacteria 4799
254 Ga0451807_2635666 3300041486 Bacteria 9989
255 Ga0439432_000490 3300042006 Bacteria 14764
256 Ga0439449_0000136 3300042007 Bacteria 24746
257 Ga0439449_0005325 3300042007 Bacteria 4928
258 Ga0439462_0000345 3300042015 Bacteria 8770
259 Ga0439458_0003719 3300042157 Bacteria 3539
260 Ga0451577_0010591 3300042876 Bacteria 8794
261 Ga0451577_0036398 3300042876 Bacteria 4430
262 Ga0466972_0000678 3300044658 Bacteria 16352
263 Ga0466965_0003484 3300044683 Bacteria 6905
264 Ga0466966_0003289 3300044684 Bacteria 10659
265 Ga0466961_0024527 3300044693 Bacteria 3879
266 Ga0466964_0000369 3300044706 Bacteria 13607
267 Ga0453684_0012388 3300044712 Bacteria 14076
268 Ga0451576_0000869 3300045051 Bacteria 58069
269 Ga0495627_001669 3300046453 Bacteria 12257
270 Ga0495638_0000294 3300046460 Bacteria 65635
271 Ga0495638_0000360 3300046460 Bacteria 56554
272 Ga0495650_0002387 3300046471 Bacteria 15378
273 Ga0495605_0000039 3300046474 Bacteria 196802
274 Ga0495639_0006254 3300046475 Bacteria 5116
275 Ga0495584_0000611 3300046491 Bacteria 23905
276 Ga0495584_0004954 3300046491 Bacteria 7099
277 Ga0495607_0001269 3300046501 Bacteria 22570
278 Ga0495607_0001918 3300046501 Bacteria 17580
279 Ga0495583_0000006 3300046506 Bacteria 436893
280 Ga0495606_0000059 3300046507 Bacteria 186886
281 Ga0495606_0012988 3300046507 Bacteria 6624
282 Ga0495610_0000091 3300046512 Bacteria 105916
283 Ga0495610_0002817 3300046512 Bacteria 14175
284 Ga0495610_0006775 3300046512 Bacteria 7773
285 Ga0495616_0000731 3300046513 Bacteria 24175
286 Ga0495616_0010686 3300046513 Bacteria 5301
287 Ga0495644_0001141 3300046523 Bacteria 10900
288 Ga0495648_0000263 3300046524 Bacteria 59213
289 Ga0495648_0010002 3300046524 Bacteria 7274
290 Ga0495663_0001405 3300046525 Bacteria 7594
291 Ga0495642_0001641 3300046528 Bacteria 9731
292 Ga0495609_0000019 3300046538 Bacteria 297777
293 Ga0495609_0000408 3300046538 Bacteria 35895
294 Ga0495597_0008096 3300046542 Bacteria 5288
295 Ga0495622_0000048 3300046557 Bacteria 108955
296 Ga0495633_0000024 3300046558 Bacteria 225077
297 Ga0495668_0001234 3300046616 Bacteria 25687
298 Ga0495625_0000043 3300046660 Bacteria 205715
299 Ga0495625_0000072 3300046660 Bacteria 166439
300 Ga0495625_0000519 3300046660 Bacteria 56854
301 Ga0495625_0001203 3300046660 Bacteria 32899
302 Ga0495625_0015917 3300046660 Bacteria 5934
303 Ga0495625_0018286 3300046660 Bacteria 5474
304 Ga0495659_0000185 3300046664 Bacteria 27168
305 Ga0495661_0000012 3300046665 Bacteria 276804
306 Ga0495661_0001409 3300046665 Bacteria 20155
307 Ga0495588_0000059 3300046674 Bacteria 263358
308 Ga0495588_0009381 3300046674 Bacteria 4521
309 Ga0495671_0000088 3300046692 Bacteria 87282
310 Ga0495649_0022092 3300046694 Bacteria 3562
311 Ga0495589_0000007 3300046794 Bacteria 276444
312 Ga0495589_0000047 3300046794 Bacteria 117810
313 Ga0495660_0000135 3300046810 Bacteria 80391
314 Ga0495672_0000262 3300047320 Bacteria 73028
315 Ga0495672_0001994 3300047320 Bacteria 19290
316 Ga0495687_000003 3300047443 Bacteria 859509
317 Ga0495687_000431 3300047443 Bacteria 51764
318 Ga0495687_000987 3300047443 Bacteria 28644
319 Ga0495687_002076 3300047443 Bacteria 16834
320 Ga0495677_0000150 3300047445 Bacteria 33321
321 Ga0495677_0012370 3300047445 Bacteria 3112
322 Ga0495673_0000025 3300047469 Bacteria 512352
323 Ga0495686_0000976 3300047472 Bacteria 35073
324 Ga0495626_0000047 3300048091 Bacteria 161939
325 Ga0496102_0000086 3300048905 Bacteria 132217
326 Ga0496103_0000055 3300048906 Bacteria 143870
327 Ga0496105_0000421 3300048908 Bacteria 27828
328 Ga0496107_0000033 3300048910 Bacteria 94532
329 Ga0496110_0010167 3300048913 Bacteria 7644
330 Ga0496111_0017866 3300048914 Bacteria 4905
331 Ga0496115_0000099 3300048918 Bacteria 82245
332 Ga0496116_0002282 3300048919 Bacteria 20338
333 Ga0496117_0000175 3300048920 Bacteria 132363
334 Ga0496118_0000325 3300048921 Bacteria 82266
335 Ga0496118_0004674 3300048921 Bacteria 16047
336 Ga0496118_0024252 3300048921 Bacteria 5244
337 Ga0496119_0005730 3300048922 Bacteria 11774
338 Ga0496120_0027005 3300048923 Bacteria 3538
339 Ga0496121_0000022 3300048924 Bacteria 472849
340 Ga0496121_0000259 3300048924 Bacteria 110676
341 Ga0496121_0000434 3300048924 Bacteria 82428
342 Ga0496121_0018321 3300048924 Bacteria 7068
343 Ga0496121_0018852 3300048924 Bacteria 6925
344 Ga0496122_0001697 3300048925 Bacteria 34173
345 Ga0496123_0001172 3300048926 Bacteria 38728
346 Ga0496123_0005237 3300048926 Bacteria 13174
347 Ga0496123_0030545 3300048926 Bacteria 3942
348 Ga0496124_0000367 3300048927 Bacteria 82348
349 Ga0496124_0006888 3300048927 Bacteria 12215
350 Ga0496124_0014393 3300048927 Bacteria 7648
351 Ga0496125_0008080 3300048928 Bacteria 11089
352 Ga0496125_0045027 3300048928 Bacteria 3720
353 Ga0496126_0000204 3300048929 Bacteria 132495
354 Ga0496126_0001931 3300048929 Bacteria 29568
355 Ga0495678_000483 3300049459 Bacteria 39595
356 Ga0501032_0009002 3300049569 Bacteria 7257
357 Ga0501033_0000047 3300049570 Bacteria 122884
358 Ga0501034_0010928 3300049571 Bacteria 9433
359 Ga0501038_0033705 3300049574 Bacteria 4508
360 Ga0501223_000116 3300049663 Bacteria 22926
361 Ga0501224_000011 3300049664 Bacteria 93275
362 Ga0501234_000263 3300049707 Bacteria 7656
363 Ga0501269_000459 3300049766 Bacteria 8929
364 Ga0501279_000104 3300049775 Bacteria 12890
365 Ga0501279_000571 3300049775 Bacteria 4810
366 Ga0501226_000024 3300049853 Bacteria 93123
367 nmdc:mga0k408_4722_c1 3300050493 Bacteria 7218
368 nmdc:mga0sz30_7848_c1 3300050516 Bacteria 4015
369 Ga0500578_0000043 3300053086 Bacteria 128295
370 Ga0500583_0001237 3300053092 Bacteria 7309
371 Ga0500556_0000186 3300053104 Bacteria 50723
372 Ga0500594_0000030 3300053118 Bacteria 47305
373 Ga0500608_000488 3300053122 Bacteria 14852
374 Ga0500642_0000192 3300053130 Bacteria 24971
375 Ga0500658_0000921 3300053134 Bacteria 12019
376 Ga0500577_0001773 3300053142 Bacteria 5515
377 Ga0500622_0002456 3300053156 Bacteria 13368
378 Ga0500622_0033357 3300053156 Bacteria 2699
379 Ga0500645_000149 3300053730 Bacteria 54622

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10000025 Ga0105240_10000025252 754
2 3300025913 Ga0207695_10000025 Ga0207695_10000025245 754
3 3300005339 Ga0070660_100002527 Ga0070660_1000025272 755
4 3300005366 Ga0070659_100000795 Ga0070659_1000007956 755
5 3300005530 Ga0070679_100007263 Ga0070679_1000072632 755
6 3300005539 Ga0068853_100000036 Ga0068853_1000000367 755
7 3300005578 Ga0068854_100000016 Ga0068854_1000000167 755
8 3300009093 Ga0105240_10008610 Ga0105240_100086104 755
9 3300013307 Ga0157372_10025027 Ga0157372_100250272 755
10 3300025261 Ga0209233_1007364 Ga0209233_10073642 755
11 3300025913 Ga0207695_10017885 Ga0207695_100178853 755
12 3300025919 Ga0207657_10002419 Ga0207657_1000241913 755
13 3300025921 Ga0207652_10001407 Ga0207652_100014077 755
14 3300025981 Ga0207640_10000001 Ga0207640_10000001400 755
15 3300026041 Ga0207639_10000058 Ga0207639_1000005890 755
16 3300026067 Ga0207678_10030842 Ga0207678_100308422 755
17 3300031250 Ga0265331_10002582 Ga0265331_100025823 755
18 3300025929 Ga0207664_10030391 Ga0207664_100303912 761
19 3300053156 Ga0500622_0033357 Ga0500622_0033357_274_2688 804
20 3300050516 nmdc:mga0sz30_7848_c1 nmdc:mga0sz30_7848_c1_1285_3996 868
21 3300049574 Ga0501038_0033705 Ga0501038_0033705_1799_4447 876
22 iso_pu_bacteria 2852684882 2852685857 892
23 3300046512 Ga0495610_0002817 Ga0495610_0002817_3131_5890 917
24 3300009176 Ga0105242_10009092 Ga0105242_100090924 923
25 3300025913 Ga0207695_10012282 Ga0207695_100122823 928
26 3300009545 Ga0105237_10000130 Ga0105237_1000013040 929
27 3300025914 Ga0207671_10001177 Ga0207671_1000117723 929
28 3300046507 Ga0495606_0012988 Ga0495606_0012988_3678_6575 932
29 3300047443 Ga0495687_002076 Ga0495687_002076_6632_9436 932
30 iso_pu_bacteria 2643221645 2644253118 932
31 3300009098 Ga0105245_10000078 Ga0105245_100000782 935
32 3300009148 Ga0105243_10000394 Ga0105243_1000039410 935
33 3300009176 Ga0105242_10000137 Ga0105242_1000013724 935
34 3300011119 Ga0105246_10008012 Ga0105246_100080124 935
35 3300013296 Ga0157374_10000087 Ga0157374_1000008764 935
36 3300013308 Ga0157375_10000503 Ga0157375_1000050319 935
37 3300014969 Ga0157376_10003058 Ga0157376_100030585 935
38 3300026078 Ga0207702_10002612 Ga0207702_100026122 935
39 3300002705 JGI25156J39149_1000026 JGI25156J39149_100002662 936
40 3300002738 JGI25154J39366_1002022 JGI25154J39366_10020223 936
41 3300002741 JGI25157J39369_1000008 JGI25157J39369_100000833 936
42 3300003752 Ga0055539_1000561 Ga0055539_10005614 936
43 3300005616 Ga0068852_100044171 Ga0068852_1000441712 936
44 3300025246 Ga0209646_1000039 Ga0209646_1000039222 936
45 3300025250 Ga0209026_1000006 Ga0209026_1000006379 936
46 3300025253 Ga0209677_100549 Ga0209677_1005498 936
47 3300025256 Ga0209759_1000020 Ga0209759_100002034 936
48 3300046501 Ga0495607_0001269 Ga0495607_0001269_6412_9309 937
49 3300046524 Ga0495648_0010002 Ga0495648_0010002_3350_6247 937
50 3300046491 Ga0495584_0000611 Ga0495584_0000611_17607_20594 938
51 3300047443 Ga0495687_000431 Ga0495687_000431_16858_19845 938
52 3300006177 Ga0075362_10007195 Ga0075362_100071952 940
53 3300006353 Ga0075370_10021119 Ga0075370_100211192 940
54 3300050493 nmdc:mga0k408_4722_c1 nmdc:mga0k408_4722_c1_2748_5699 940
55 3300028794 Ga0307515_10000004 Ga0307515_10000004673 941
56 3300047445 Ga0495677_0012370 Ga0495677_0012370_253_3090 942
57 3300049775 Ga0501279_000571 Ga0501279_000571_1443_4280 942
58 3300046674 Ga0495588_0000059 Ga0495588_0000059_96481_99393 943
59 3300042876 Ga0451577_0010591 Ga0451577_0010591_1273_4179 944
60 3300009177 Ga0105248_10001759 Ga0105248_100017597 947
61 3300049569 Ga0501032_0009002 Ga0501032_0009002_1096_4017 949
62 iso_pu_bacteria 2919138771 2919141824 949
63 3300003781 Ga0055536_1000979 Ga0055536_10009798 950
64 3300003791 Ga0055530_10001470 Ga0055530_100014706 950
65 3300003794 Ga0055531_10001121 Ga0055531_1000112111 950
66 3300025292 Ga0209676_1000468 Ga0209676_10004686 950
67 3300025298 Ga0209050_1000486 Ga0209050_100048610 950
68 3300025304 Ga0209257_1000520 Ga0209257_100052044 950
69 3300044693 Ga0466961_0024527 Ga0466961_0024527_13_2865 950
70 iso_pu_bacteria 2599185354 2600203234 952
71 iso_pu_bacteria 2751185897 2753766760 952
72 3300005563 Ga0068855_100019042 Ga0068855_1000190424 953
73 3300045051 Ga0451576_0000869 Ga0451576_0000869_24713_27598 953
74 3300025254 Ga0209148_1001058 Ga0209148_10010587 954
75 3300025272 Ga0209455_1000429 Ga0209455_100042912 954
76 3300046491 Ga0495584_0004954 Ga0495584_0004954_1064_3976 954
77 3300046513 Ga0495616_0000731 Ga0495616_0000731_18570_21482 954
78 3300046538 Ga0495609_0000019 Ga0495609_0000019_137836_140748 954
79 3300046665 Ga0495661_0000012 Ga0495661_0000012_12206_15118 954
80 3300046794 Ga0495589_0000007 Ga0495589_0000007_11823_14735 954
81 3300047443 Ga0495687_000003 Ga0495687_000003_137863_140775 954
82 3300047445 Ga0495677_0000150 Ga0495677_0000150_11823_14735 954
83 3300003374 JGI25161J50226_1000062 JGI25161J50226_100006257 955
84 3300004625 Ga0055543_1000413 Ga0055543_10004133 955
85 3300005262 Ga0065165_1000261 Ga0065165_100026126 955
86 3300005563 Ga0068855_100008887 Ga0068855_1000088875 955
87 3300009148 Ga0105243_10018075 Ga0105243_100180752 955
88 3300009176 Ga0105242_10002432 Ga0105242_100024322 955
89 3300025208 Ga0209436_100005 Ga0209436_100005105 955
90 3300025284 Ga0209130_1000055 Ga0209130_1000055155 955
91 3300025911 Ga0207654_10003662 Ga0207654_100036625 955
92 3300025919 Ga0207657_10032249 Ga0207657_100322493 955
93 3300025935 Ga0207709_10017749 Ga0207709_100177491 955
94 3300025949 Ga0207667_10005692 Ga0207667_100056921 955
95 3300037466 Ga0395898_0013893 Ga0395898_0013893_4749_7661 955
96 3300044658 Ga0466972_0000678 Ga0466972_0000678_12698_15610 955
97 3300042876 Ga0451577_0036398 Ga0451577_0036398_520_3450 956
98 3300046453 Ga0495627_001669 Ga0495627_001669_3255_6149 956
99 3300048924 Ga0496121_0018321 Ga0496121_0018321_116_3010 956
100 3300005262 Ga0065165_1001967 Ga0065165_10019676 957
101 3300025254 Ga0209148_1000650 Ga0209148_100065014 957
102 3300042007 Ga0439449_0000136 Ga0439449_0000136_19793_22672 957
103 3300048924 Ga0496121_0000022 Ga0496121_0000022_284389_287340 957
104 iso_pu_bacteria 2643221544 2643744577 957
105 iso_pu_bacteria 2786546940 2788436741 957
106 iso_pu_bacteria 2880518877 2880520973 957
107 iso_pu_bacteria 8047673197 8047676713 957
108 3300048910 Ga0496107_0000033 Ga0496107_0000033_24359_27244 958
109 3300048924 Ga0496121_0000259 Ga0496121_0000259_69350_72235 958
110 3300013104 Ga0157370_10000288 Ga0157370_1000028840 959
111 3300031548 Ga0307408_100004400 Ga0307408_1000044005 959
112 iso_pu_bacteria 2786546517 2787438995 959
113 iso_pu_bacteria 2928531327 2928531345 959
114 3300005327 Ga0070658_10037455 Ga0070658_100374552 960
115 3300015684 Ga0183365_10004 Ga0183365_10004249 960
116 3300025909 Ga0207705_10044287 Ga0207705_100442871 960
117 3300031548 Ga0307408_100000022 Ga0307408_10000002263 960
118 3300005339 Ga0070660_100000328 Ga0070660_10000032811 961
119 3300025298 Ga0209050_1000253 Ga0209050_100025351 961
120 3300028558 Ga0265326_10002838 Ga0265326_100028382 961
121 3300035691 Ga0373931_0000925 Ga0373931_0000925_5252_8161 961
122 3300046474 Ga0495605_0000039 Ga0495605_0000039_97833_100730 961
123 3300046665 Ga0495661_0001409 Ga0495661_0001409_3200_6097 961
124 3300046694 Ga0495649_0022092 Ga0495649_0022092_179_3076 961
125 3300046794 Ga0495589_0000047 Ga0495589_0000047_3596_6493 961
126 3300046810 Ga0495660_0000135 Ga0495660_0000135_61665_64562 961
127 3300047320 Ga0495672_0001994 Ga0495672_0001994_4567_7464 961
128 3300047443 Ga0495687_000987 Ga0495687_000987_19142_22039 961
129 3300048091 Ga0495626_0000047 Ga0495626_0000047_15302_18199 961
130 3300048924 Ga0496121_0018852 Ga0496121_0018852_2813_5731 961
131 3300048926 Ga0496123_0005237 Ga0496123_0005237_9493_12390 961
132 3300048927 Ga0496124_0006888 Ga0496124_0006888_4949_7867 961
133 iso_pu_bacteria 2821131069 2821135470 961
134 iso_pu_bacteria 2884960567 2884963299 961
135 3300009177 Ga0105248_10027048 Ga0105248_100270481 962
136 3300025941 Ga0207711_10003423 Ga0207711_100034239 962
137 3300028794 Ga0307515_10000026 Ga0307515_10000026228 962
138 3300044712 Ga0453684_0012388 Ga0453684_0012388_5973_8879 962
139 3300046660 Ga0495625_0018286 Ga0495625_0018286_2063_4987 962
140 3300049570 Ga0501033_0000047 Ga0501033_0000047_88266_91217 962
141 iso_pu_bacteria 2643221556 2643797011 962
142 iso_pu_bacteria 2643221639 2644219153 962
143 iso_pu_bacteria 2643221646 2644255669 962
144 iso_pu_bacteria 2643221664 2644355283 962
145 iso_pu_bacteria 2643221684 2644469885 962
146 iso_pu_bacteria 2842711865 2842712526 962
147 3300031616 Ga0307508_10001070 Ga0307508_1000107014 963
148 3300046616 Ga0495668_0001234 Ga0495668_0001234_12001_14958 963
149 3300046660 Ga0495625_0000043 Ga0495625_0000043_183222_186140 963
150 3300047469 Ga0495673_0000025 Ga0495673_0000025_286613_289531 963
151 iso_pu_bacteria 2808606401 2809063466 963
152 iso_pu_bacteria 2808606404 2809079563 963
153 iso_pu_bacteria 2808606405 2809083799 963
154 iso_pu_bacteria 8002869464 8002870036 963
155 3300025254 Ga0209148_1000061 Ga0209148_100006171 964
156 3300025292 Ga0209676_1000295 Ga0209676_100029516 964
157 3300025298 Ga0209050_1000362 Ga0209050_10003628 964
158 3300046507 Ga0495606_0000059 Ga0495606_0000059_21387_24302 964
159 iso_pu_bacteria 2904424332 2904425262 964
160 iso_pu_bacteria 2919709256 2919712286 964
161 3300003322 rootL2_10093835 rootL2_100938352 965
162 3300047472 Ga0495686_0000976 Ga0495686_0000976_17886_20795 965
163 3300053104 Ga0500556_0000186 Ga0500556_0000186_45328_48237 965
164 3300053142 Ga0500577_0001773 Ga0500577_0001773_750_3659 965
165 3300053156 Ga0500622_0002456 Ga0500622_0002456_983_3889 965
166 3300053730 Ga0500645_000149 Ga0500645_000149_22600_25509 965
167 3300005578 Ga0068854_100000092 Ga0068854_10000009224 966
168 3300006358 Ga0068871_100005824 Ga0068871_1000058243 966
169 3300025911 Ga0207654_10014844 Ga0207654_100148441 966
170 3300025981 Ga0207640_10000142 Ga0207640_1000014218 966
171 3300026041 Ga0207639_10005197 Ga0207639_100051974 966
172 3300026067 Ga0207678_10003654 Ga0207678_100036543 966
173 3300031548 Ga0307408_100000964 Ga0307408_1000009644 966
174 3300037418 Ga0395900_0006364 Ga0395900_0006364_767_3679 966
175 3300037418 Ga0395900_0052951 Ga0395900_0052951_485_3397 966
176 3300037471 Ga0395905_0013977 Ga0395905_0013977_1138_4074 966
177 3300042007 Ga0439449_0005325 Ga0439449_0005325_1160_4072 966
178 3300042157 Ga0439458_0003719 Ga0439458_0003719_129_3041 966
179 3300044683 Ga0466965_0003484 Ga0466965_0003484_1308_4220 966
180 3300044706 Ga0466964_0000369 Ga0466964_0000369_2811_5723 966
181 3300046460 Ga0495638_0000360 Ga0495638_0000360_26488_29400 966
182 3300046512 Ga0495610_0000091 Ga0495610_0000091_93664_96576 966
183 3300046523 Ga0495644_0001141 Ga0495644_0001141_1849_4761 966
184 3300046528 Ga0495642_0001641 Ga0495642_0001641_5672_8584 966
185 3300046660 Ga0495625_0000519 Ga0495625_0000519_28649_31561 966
186 3300046660 Ga0495625_0015917 Ga0495625_0015917_1046_3958 966
187 3300053134 Ga0500658_0000921 Ga0500658_0000921_4781_7693 966
188 iso_pu_bacteria 2643221554 2643791708 966
189 iso_pu_bacteria 2643221638 2644211339 966
190 iso_pu_bacteria 2738541280 2738741755 966
191 iso_pu_bacteria 2738541300 2738843925 966
192 iso_pu_bacteria 2738543018 2739274514 966
193 iso_pu_bacteria 2738543030 2739343558 966
194 3300002067 JGI24735J21928_10002943 JGI24735J21928_100029432 967
195 3300046512 Ga0495610_0006775 Ga0495610_0006775_2940_5858 967
196 3300003374 JGI25161J50226_1000758 JGI25161J50226_10007584 968
197 3300003771 Ga0055526_1000734 Ga0055526_10007349 968
198 3300003773 Ga0055537_1000569 Ga0055537_10005695 968
199 3300003775 Ga0055524_1000543 Ga0055524_10005434 968
200 3300003791 Ga0055530_10003310 Ga0055530_100033103 968
201 3300031548 Ga0307408_100001584 Ga0307408_1000015843 968
202 3300046542 Ga0495597_0008096 Ga0495597_0008096_1757_4678 968
203 3300046660 Ga0495625_0001203 Ga0495625_0001203_23694_26615 968
204 3300046664 Ga0495659_0000185 Ga0495659_0000185_15333_18254 968
205 3300046692 Ga0495671_0000088 Ga0495671_0000088_45516_48437 968
206 3300047320 Ga0495672_0000262 Ga0495672_0000262_68628_71549 968
207 3300049766 Ga0501269_000459 Ga0501269_000459_871_3795 968
208 3300049775 Ga0501279_000104 Ga0501279_000104_6205_9126 968
209 3300053122 Ga0500608_000488 Ga0500608_000488_8367_11282 968
210 3300002077 JGI24744J21845_10000760 JGI24744J21845_100007604 969
211 3300002773 JGI25152J39213_1000002 JGI25152J39213_100000248 969
212 3300002774 JGI25150J39212_1000038 JGI25150J39212_100003832 969
213 3300003215 JGI25153J46596_10007021 JGI25153J46596_100070214 969
214 3300003771 Ga0055526_1000229 Ga0055526_100022921 969
215 3300003771 Ga0055526_1002194 Ga0055526_10021944 969
216 3300003773 Ga0055537_1000516 Ga0055537_10005167 969
217 3300003775 Ga0055524_1000105 Ga0055524_100010517 969
218 3300003790 Ga0055528_1000296 Ga0055528_100029631 969
219 3300003791 Ga0055530_10000078 Ga0055530_1000007835 969
220 3300005327 Ga0070658_10062123 Ga0070658_100621231 969
221 3300005339 Ga0070660_100023355 Ga0070660_1000233553 969
222 3300005617 Ga0068859_100000074 Ga0068859_10000007471 969
223 3300005719 Ga0068861_100000017 Ga0068861_10000001765 969
224 3300006931 Ga0097620_100000074 Ga0097620_10000007471 969
225 3300025208 Ga0209436_100565 Ga0209436_1005654 969
226 3300025245 Ga0207425_1000001 Ga0207425_10000011233 969
227 3300025245 Ga0207425_1000119 Ga0207425_100011912 969
228 3300025258 Ga0209129_1000001 Ga0209129_1000001410 969
229 3300025258 Ga0209129_1004363 Ga0209129_10043631 969
230 3300025263 Ga0209565_1000397 Ga0209565_100039716 969
231 3300025263 Ga0209565_1000643 Ga0209565_10006437 969
232 3300025263 Ga0209565_1000672 Ga0209565_10006724 969
233 3300025263 Ga0209565_1001325 Ga0209565_10013254 969
234 3300025273 Ga0209673_1000007 Ga0209673_1000007574 969
235 3300025284 Ga0209130_1001525 Ga0209130_10015254 969
236 3300025291 Ga0209675_1000003 Ga0209675_100000331 969
237 3300025291 Ga0209675_1000234 Ga0209675_100023429 969
238 3300025291 Ga0209675_1000374 Ga0209675_100037417 969
239 3300025295 Ga0209564_1000124 Ga0209564_1000124109 969
240 3300025295 Ga0209564_1000203 Ga0209564_10002038 969
241 3300025295 Ga0209564_1000459 Ga0209564_100045945 969
242 3300025295 Ga0209564_1001715 Ga0209564_10017153 969
243 3300025297 Ga0209758_1000020 Ga0209758_100002043 969
244 3300025298 Ga0209050_1000293 Ga0209050_100029381 969
245 3300025298 Ga0209050_1000313 Ga0209050_100031335 969
246 3300025299 Ga0209256_1000028 Ga0209256_100002817 969
247 3300025299 Ga0209256_1000790 Ga0209256_100079019 969
248 3300025299 Ga0209256_1001184 Ga0209256_10011844 969
249 3300025299 Ga0209256_1001522 Ga0209256_10015227 969
250 3300025299 Ga0209256_1005370 Ga0209256_10053703 969
251 3300025304 Ga0209257_1000003 Ga0209257_1000003471 969
252 3300025919 Ga0207657_10050412 Ga0207657_100504122 969
253 3300025940 Ga0207691_10014508 Ga0207691_100145085 969
254 3300026118 Ga0207675_100000462 Ga0207675_10000046211 969
255 3300031548 Ga0307408_100007022 Ga0307408_1000070223 969
256 3300046471 Ga0495650_0002387 Ga0495650_0002387_6237_9173 969
257 3300046475 Ga0495639_0006254 Ga0495639_0006254_96_3032 969
258 3300046501 Ga0495607_0001918 Ga0495607_0001918_8287_11226 969
259 3300046506 Ga0495583_0000006 Ga0495583_0000006_213896_216832 969
260 3300046513 Ga0495616_0010686 Ga0495616_0010686_1741_4680 969
261 3300046538 Ga0495609_0000408 Ga0495609_0000408_24167_27106 969
262 3300046557 Ga0495622_0000048 Ga0495622_0000048_1024_3960 969
263 3300046674 Ga0495588_0009381 Ga0495588_0009381_632_3613 969
264 3300048921 Ga0496118_0024252 Ga0496118_0024252_1116_4058 969
265 3300001915 JGI24741J21665_1001663 JGI24741J21665_10016631 970
266 3300001979 JGI24740J21852_10009529 JGI24740J21852_100095292 970
267 3300002067 JGI24735J21928_10008643 JGI24735J21928_100086431 970
268 3300005327 Ga0070658_10000198 Ga0070658_1000019821 970
269 3300005339 Ga0070660_100002358 Ga0070660_1000023587 970
270 3300005339 Ga0070660_100017743 Ga0070660_1000177433 970
271 3300005614 Ga0068856_100053290 Ga0068856_1000532902 970
272 3300009174 Ga0105241_10000625 Ga0105241_100006254 970
273 3300009545 Ga0105237_10036831 Ga0105237_100368312 970
274 3300025304 Ga0209257_1000850 Ga0209257_100085013 970
275 3300025321 Ga0207656_10012799 Ga0207656_100127992 970
276 3300025909 Ga0207705_10000249 Ga0207705_1000024917 970
277 3300025919 Ga0207657_10001967 Ga0207657_100019673 970
278 3300025924 Ga0207694_10007016 Ga0207694_100070167 970
279 3300026041 Ga0207639_10001458 Ga0207639_100014582 970
280 3300026067 Ga0207678_10042503 Ga0207678_100425031 970
281 3300026078 Ga0207702_10003011 Ga0207702_100030118 970
282 3300026116 Ga0207674_10023489 Ga0207674_100234894 970
283 3300031911 Ga0307412_10000126 Ga0307412_100001262 970
284 3300032004 Ga0307414_10000270 Ga0307414_1000027018 970
285 3300046660 Ga0495625_0000072 Ga0495625_0000072_47384_50317 970
286 3300048921 Ga0496118_0004674 Ga0496118_0004674_5234_8161 970
287 3300049571 Ga0501034_0010928 Ga0501034_0010928_276_3206 970
288 3300049663 Ga0501223_000116 Ga0501223_000116_18183_21113 970
289 3300049664 Ga0501224_000011 Ga0501224_000011_14454_17384 970
290 3300049707 Ga0501234_000263 Ga0501234_000263_1738_4668 970
291 3300049853 Ga0501226_000024 Ga0501226_000024_75873_78803 970
292 3300053092 Ga0500583_0001237 Ga0500583_0001237_535_3492 970
293 3300003214 JGI25165J46597_1000082 JGI25165J46597_1000082154 971
294 3300005455 Ga0070663_100000576 Ga0070663_10000057614 971
295 3300005539 Ga0068853_100001281 Ga0068853_10000128113 971
296 3300009093 Ga0105240_10069202 Ga0105240_100692022 971
297 3300009174 Ga0105241_10012337 Ga0105241_100123372 971
298 3300010375 Ga0105239_10000605 Ga0105239_1000060511 971
299 3300013307 Ga0157372_10021230 Ga0157372_100212302 971
300 3300015684 Ga0183365_10006 Ga0183365_10006130 971
301 3300025231 Ga0207427_102137 Ga0207427_1021372 971
302 3300025261 Ga0209233_1000041 Ga0209233_1000041153 971
303 3300025913 Ga0207695_10005407 Ga0207695_1000540714 971
304 iso_pu_bacteria 2643221583 2643924853 971
305 3300005334 Ga0068869_100002615 Ga0068869_1000026156 972
306 3300005338 Ga0068868_100000025 Ga0068868_1000000252 972
307 3300005364 Ga0070673_100000016 Ga0070673_10000001663 972
308 3300005459 Ga0068867_100000962 Ga0068867_1000009624 972
309 3300006881 Ga0068865_100000026 Ga0068865_10000002645 972
310 3300025927 Ga0207687_10002419 Ga0207687_100024192 972
311 3300025934 Ga0207686_10002463 Ga0207686_100024635 972
312 3300025935 Ga0207709_10000187 Ga0207709_1000018726 972
313 3300025938 Ga0207704_10000006 Ga0207704_10000006106 972
314 3300025942 Ga0207689_10001911 Ga0207689_100019116 972
315 3300025960 Ga0207651_10000001 Ga0207651_10000001168 972
316 3300026023 Ga0207677_10000016 Ga0207677_10000016114 972
317 3300026089 Ga0207648_10000042 Ga0207648_1000004226 972
318 3300048928 Ga0496125_0008080 Ga0496125_0008080_6293_9256 972
319 3300048929 Ga0496126_0001931 Ga0496126_0001931_12262_15225 972
320 3300003215 JGI25153J46596_10000005 JGI25153J46596_10000005365 973
321 3300005563 Ga0068855_100000007 Ga0068855_100000007180 973
322 3300025297 Ga0209758_1000001 Ga0209758_1000001366 973
323 3300025299 Ga0209256_1000097 Ga0209256_100009720 973
324 3300025949 Ga0207667_10000038 Ga0207667_10000038176 973
325 3300003773 Ga0055537_1001433 Ga0055537_10014333 974
326 3300003775 Ga0055524_1000095 Ga0055524_10000952 974
327 3300003794 Ga0055531_10001916 Ga0055531_100019169 974
328 3300005327 Ga0070658_10000997 Ga0070658_1000099711 974
329 3300005842 Ga0068858_100000608 Ga0068858_10000060823 974
330 3300009098 Ga0105245_10001409 Ga0105245_100014097 974
331 3300013307 Ga0157372_10039265 Ga0157372_100392653 974
332 3300025263 Ga0209565_1000008 Ga0209565_100000879 974
333 3300025273 Ga0209673_1001402 Ga0209673_10014028 974
334 3300025299 Ga0209256_1000009 Ga0209256_1000009792 974
335 3300025299 Ga0209256_1000010 Ga0209256_1000010716 974
336 3300025304 Ga0209257_1003579 Ga0209257_10035792 974
337 3300025904 Ga0207647_10004083 Ga0207647_100040832 974
338 3300025909 Ga0207705_10000049 Ga0207705_10000049130 974
339 3300026035 Ga0207703_10000123 Ga0207703_1000012385 974
340 3300044684 Ga0466966_0003289 Ga0466966_0003289_4624_7629 974
341 3300048925 Ga0496122_0001697 Ga0496122_0001697_24179_27124 974
342 3300048926 Ga0496123_0001172 Ga0496123_0001172_7275_10220 974
343 3300048927 Ga0496124_0014393 Ga0496124_0014393_2576_5521 974
344 3300003781 Ga0055536_1000614 Ga0055536_10006148 975
345 3300003791 Ga0055530_10001919 Ga0055530_100019192 975
346 3300025295 Ga0209564_1000444 Ga0209564_100044452 975
347 3300025303 Ga0209051_1009013 Ga0209051_10090132 975
348 3300025304 Ga0209257_1006121 Ga0209257_10061213 975
349 3300028794 Ga0307515_10035278 Ga0307515_100352783 975
350 3300041410 Ga0439461_0001555 Ga0439461_0001555_202_3195 975
351 3300041459 Ga0451800_0972437 Ga0451800_0972437_989_3937 975
352 3300041486 Ga0451807_2635666 Ga0451807_2635666_6013_8961 975
353 3300042006 Ga0439432_000490 Ga0439432_000490_720_3713 975
354 3300042015 Ga0439462_0000345 Ga0439462_0000345_5389_8382 975
355 3300046460 Ga0495638_0000294 Ga0495638_0000294_6589_9564 975
356 3300049459 Ga0495678_000483 Ga0495678_000483_12126_15101 975
357 3300053086 Ga0500578_0000043 Ga0500578_0000043_21307_24282 975
358 3300053118 Ga0500594_0000030 Ga0500594_0000030_23326_26301 975
359 3300001915 JGI24741J21665_1000426 JGI24741J21665_10004263 976
360 3300001979 JGI24740J21852_10006425 JGI24740J21852_100064253 976
361 3300003322 rootL2_10017473 rootL2_100174739 976
362 3300005327 Ga0070658_10001963 Ga0070658_1000196312 976
363 3300005339 Ga0070660_100007482 Ga0070660_1000074822 976
364 3300005344 Ga0070661_100004712 Ga0070661_1000047128 976
365 3300005456 Ga0070678_100000008 Ga0070678_10000000822 976
366 3300005834 Ga0068851_10004689 Ga0068851_100046893 976
367 3300009148 Ga0105243_10000475 Ga0105243_100004754 976
368 3300009174 Ga0105241_10018109 Ga0105241_100181092 976
369 3300013102 Ga0157371_10000094 Ga0157371_1000009458 976
370 3300025321 Ga0207656_10003715 Ga0207656_100037152 976
371 3300025901 Ga0207688_10015724 Ga0207688_100157241 976
372 3300025904 Ga0207647_10004207 Ga0207647_100042072 976
373 3300025909 Ga0207705_10007510 Ga0207705_100075103 976
374 3300025911 Ga0207654_10000020 Ga0207654_1000002020 976
375 3300025914 Ga0207671_10023603 Ga0207671_100236032 976
376 3300025919 Ga0207657_10008244 Ga0207657_100082449 976
377 3300025920 Ga0207649_10009836 Ga0207649_100098364 976
378 3300025924 Ga0207694_10041828 Ga0207694_100418282 976
379 3300025932 Ga0207690_10004189 Ga0207690_100041893 976
380 3300025933 Ga0207706_10005052 Ga0207706_100050529 976
381 3300025935 Ga0207709_10000139 Ga0207709_1000013922 976
382 3300025937 Ga0207669_10001661 Ga0207669_100016617 976
383 3300025949 Ga0207667_10000006 Ga0207667_1000000670 976
384 3300025949 Ga0207667_10010760 Ga0207667_100107609 976
385 3300025981 Ga0207640_10004700 Ga0207640_100047004 976
386 3300026041 Ga0207639_10002766 Ga0207639_100027662 976
387 3300026067 Ga0207678_10004134 Ga0207678_1000413411 976
388 3300026078 Ga0207702_10002032 Ga0207702_1000203216 976
389 3300026116 Ga0207674_10010322 Ga0207674_100103229 976
390 3300026142 Ga0207698_10013641 Ga0207698_100136414 976
391 3300041462 Ga0451806_498691 Ga0451806_498691_1537_4488 976
392 3300046524 Ga0495648_0000263 Ga0495648_0000263_9496_12426 976
393 3300046525 Ga0495663_0001405 Ga0495663_0001405_1493_4483 976
394 3300046558 Ga0495633_0000024 Ga0495633_0000024_130527_133490 976
395 3300048905 Ga0496102_0000086 Ga0496102_0000086_57536_60466 976
396 3300048906 Ga0496103_0000055 Ga0496103_0000055_21789_24719 976
397 3300048908 Ga0496105_0000421 Ga0496105_0000421_12808_15738 976
398 3300048913 Ga0496110_0010167 Ga0496110_0010167_2467_5397 976
399 3300048914 Ga0496111_0017866 Ga0496111_0017866_1494_4424 976
400 3300048918 Ga0496115_0000099 Ga0496115_0000099_21813_24743 976
401 3300048919 Ga0496116_0002282 Ga0496116_0002282_1511_4441 976
402 3300048920 Ga0496117_0000175 Ga0496117_0000175_71868_74798 976
403 3300048921 Ga0496118_0000325 Ga0496118_0000325_57549_60479 976
404 3300048922 Ga0496119_0005730 Ga0496119_0005730_1153_4083 976
405 3300048923 Ga0496120_0027005 Ga0496120_0027005_277_3207 976
406 3300048924 Ga0496121_0000434 Ga0496121_0000434_21785_24715 976
407 3300048926 Ga0496123_0030545 Ga0496123_0030545_641_3571 976
408 3300048927 Ga0496124_0000367 Ga0496124_0000367_21819_24749 976
409 3300048928 Ga0496125_0045027 Ga0496125_0045027_372_3302 976
410 3300048929 Ga0496126_0000204 Ga0496126_0000204_72046_74976 976
411 3300053130 Ga0500642_0000192 Ga0500642_0000192_15341_18271 976

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17137

DUF5110

Domain of unknown function (DUF5110)

926

995

0.96

PF21365

Glyco_hydro_31_3rd

Glycosyl hydrolase family 31 C-terminal domain

661

708

0.93

PF21365

Glyco_hydro_31_3rd

Glycosyl hydrolase family 31 C-terminal domain

854

910

0.92

PF01055

Glyco_hydro_31_2nd

Glycosyl hydrolases family 31 TIM-barrel domain

317

653

0.89

PF07691

PA14

PA14 domain

721

858

0.87

PF13802

Gal_mutarotas_2

Glycosyl hydrolase 31 N-terminal galactose mutarotase-like domain

114

275

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b9y-assembly1.cif.gz_A crystal structure of apo agd31b, alpha-transglucosylase in glycoside hydrolase family 31 0.8892 50 947
5i24-assembly1.cif.gz_A crystal structure of agd31b, alpha-transglucosylase in glycoside hydrolase family 31, in complex with cyclophellitol aziridine probe cf021 0.8872 50 947
5npd-assembly1.cif.gz_A crystal structure of d412n nucleophile mutant cjagd31b (alpha-transglucosylase from glycoside hydrolase family 31) in complex with alpha cyclophellitol aziridine probe cf021 0.8872 50 947
4ba0-assembly1.cif.gz_A-2 crystal structure of agd31b, alpha-transglucosylase, complexed with 5f-alpha-glcf 0.887 50 947
5zn7-assembly2.cif.gz_E crystal structure of gh31 alpha-xylosidase from a soil metagenome complexed with xylose 0.8782 52 860
ID Description Score Start End Superfamily
5npeA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9143 255 647 3.20.20.80
2xvkA03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9125 273 617 3.20.20.80
5npeA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9119 255 647 3.20.20.80
5jouA01 Mainly Beta;Sandwich;Immunoglobulin-like;glycosyl hydrolase (family 31) 0.9089 44 269 2.60.40.1760
2xvlA05 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8998 861 975 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A353GKB2-F1-model_v4 Glycoside hydrolase 0.9789 22 667 GO:0004553
GO:0005975
GO:0030246
AF-A0A520HWM5-F1-model_v4 DUF5110 domain-containing protein 0.9627 254 919 GO:0004553
GO:0005975
AF-A0A353GKB2-F1-model_v4 Glycoside hydrolase 0.9568 22 667 GO:0004553
GO:0005975
GO:0030246
AF-A0A662I7F6-F1-model_v4 Alpha-xylosidase 0.9546 91 976 GO:0004553
GO:0005975
GO:0030246
AF-A7LRS4-F1-model_v4 deleted 0.9545 820 976

Feature Viewer

pLDDT pTM Quality
91.26 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map