F437460
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 411 | 254 | 379 | 967 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100000576|Ga0070663_10000057614 |
| Length | 1023 |
| Sequence | MKERLVFHNSATLQTALQNGVDATTQTKYRGANAQMHLRSYGGTPVVRTDIALAACILGLASVASAAKPALEAXXXXASELDANGHPRALLPGDGEFRFTRLPDGVQFRVKGITKTILFYGADTVRVNANLGENYWTARSLVVTAKPGGVSFSVTESPATLLIATQKLRIIADKQTGALRFTDAGGKLFTEERQADPEMLKRVTISGAPSYEAQNTLKLQRDEAIYGFGFTADDHSNRRGTDLLLVQTNMGIIIPVMMSSRRYGVMWDTYSQMRFKDDANGASLWAESAPGGVDYYFMAGNTPDDVVRAYRDLTGAAPMYPKQAFGLFMSKERYKTQEQLLDVASSFRKEGFPLDYIVQDWQYWGSDKDGSWSGMTWDPTRYPDPEGMIKALHDMHLKLMMSIWPSIGNDTALAHELDAHNLRFAPLHWISKHARVYDAYSPLGRQIYFKHIKAGLLDKGVDALWMDGTEVEVSSAMWNAADNIRDTKALGSNALGDFTRYLNPYSLLTTQGTYDGERATANKRVFTLTRSAWAGAQRTAAASWSGDIFASWKTLKQQIAGGVDVTVTGNPYWTQDTGGFFVSEFPGGEQNPAWRELYARWLQFATFNPLMRIHGTDVEREPYRFKSLDPQVYDSLLKSVQLRYRLLPYIYPLSWKVTSAGYTLMRPLMMDFPDDRATDTIDDSFMFGPSLLVHPVTRAMYHILPPPPATVPGEYLRTPDGKPGLAGQYFEGRFGVPKGEFVDAKIDHTWPDPPLADIPGGLTSLNDFSVRWQGTLTAPEDGTYELGLDGDDGYRLILDGKTVVSSWQNGAARYKGTEQTLRKGQVVNVTIEYFQGDGNRSLRFGWRRPSELQEARNAVHALDTSVATYLPKGAGWFDFWTNQRFAGGQRVTRQVPLDILPLYVRAGSIVPMGPKVQYATQAPGAPYELRIYPGADARFTIYEDDNETYDYEKGRYASYDLVWNDRTHSLIIGPRHGRFTGMIPTRRLNIAVMSERNATGLGAAPPSKSILYRGKPVTVSFAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 2 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 3 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 4 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 5 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 6 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 7 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 8 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 9 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 10 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 11 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 12 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 13 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 14 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 15 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 16 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 17 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 18 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 19 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 20 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 21 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 22 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 23 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 24 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 25 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 26 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 27 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 28 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 29 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 30 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 31 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 32 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 33 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 34 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 35 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 36 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 37 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 38 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 39 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 40 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 41 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 42 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 43 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 44 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 47 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 49 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 50 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 54 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 56 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 57 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 95 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 158 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 163 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 166 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 167 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 168 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 169 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 170 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 171 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 172 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 173 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 174 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 175 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 176 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 217 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 220 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 221 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 222 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 223 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 224 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 225 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 226 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 227 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 228 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 229 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 230 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 239 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 240 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 241 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 242 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 243 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 244 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 245 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 246 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 247 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 248 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 249 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 250 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 251 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 252 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 253 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 254 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.21 |
| Metatranscriptomes | 0 |
| Isolates | 7.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.84 |
| Nodule | 0 |
| Rhizoplane | 2.92 |
| Rhizosphere | 59.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000426 | 3300001915 | Bacteria | 12780 |
| 2 | JGI24741J21665_1001663 | 3300001915 | Bacteria | 6175 |
| 3 | JGI24740J21852_10006425 | 3300001979 | Bacteria | 4869 |
| 4 | JGI24740J21852_10009529 | 3300001979 | Bacteria | 3796 |
| 5 | JGI24735J21928_10002943 | 3300002067 | Bacteria | 5854 |
| 6 | JGI24735J21928_10008643 | 3300002067 | Bacteria | 3287 |
| 7 | JGI24744J21845_10000760 | 3300002077 | Bacteria | 6018 |
| 8 | JGI25156J39149_1000026 | 3300002705 | Bacteria | 132099 |
| 9 | JGI25154J39366_1002022 | 3300002738 | Bacteria | 5858 |
| 10 | JGI25157J39369_1000008 | 3300002741 | Bacteria | 211083 |
| 11 | JGI25152J39213_1000002 | 3300002773 | Bacteria | 219237 |
| 12 | JGI25150J39212_1000038 | 3300002774 | Bacteria | 88070 |
| 13 | JGI25165J46597_1000082 | 3300003214 | Bacteria | 174736 |
| 14 | JGI25153J46596_10000005 | 3300003215 | Bacteria | 492839 |
| 15 | JGI25153J46596_10007021 | 3300003215 | Bacteria | 5608 |
| 16 | rootL2_10017473 | 3300003322 | Bacteria | 12107 |
| 17 | rootL2_10093835 | 3300003322 | Bacteria | 3625 |
| 18 | JGI25161J50226_1000062 | 3300003374 | Bacteria | 99783 |
| 19 | JGI25161J50226_1000758 | 3300003374 | Bacteria | 12367 |
| 20 | Ga0055539_1000561 | 3300003752 | Bacteria | 10746 |
| 21 | Ga0055526_1000229 | 3300003771 | Bacteria | 47279 |
| 22 | Ga0055526_1000734 | 3300003771 | Bacteria | 24710 |
| 23 | Ga0055526_1002194 | 3300003771 | Bacteria | 13377 |
| 24 | Ga0055537_1000516 | 3300003773 | Bacteria | 22835 |
| 25 | Ga0055537_1000569 | 3300003773 | Bacteria | 20727 |
| 26 | Ga0055537_1001433 | 3300003773 | Bacteria | 9319 |
| 27 | Ga0055524_1000095 | 3300003775 | Bacteria | 109223 |
| 28 | Ga0055524_1000105 | 3300003775 | Bacteria | 104121 |
| 29 | Ga0055524_1000543 | 3300003775 | Bacteria | 28542 |
| 30 | Ga0055536_1000614 | 3300003781 | Bacteria | 24285 |
| 31 | Ga0055536_1000979 | 3300003781 | Bacteria | 18138 |
| 32 | Ga0055528_1000296 | 3300003790 | Bacteria | 42288 |
| 33 | Ga0055530_10000078 | 3300003791 | Bacteria | 83740 |
| 34 | Ga0055530_10001470 | 3300003791 | Bacteria | 17163 |
| 35 | Ga0055530_10001919 | 3300003791 | Bacteria | 14197 |
| 36 | Ga0055530_10003310 | 3300003791 | Bacteria | 9312 |
| 37 | Ga0055531_10001121 | 3300003794 | Bacteria | 20738 |
| 38 | Ga0055531_10001916 | 3300003794 | Bacteria | 14551 |
| 39 | Ga0055543_1000413 | 3300004625 | Bacteria | 26934 |
| 40 | Ga0065165_1000261 | 3300005262 | Bacteria | 90816 |
| 41 | Ga0065165_1001967 | 3300005262 | Bacteria | 19463 |
| 42 | Ga0070658_10000198 | 3300005327 | Bacteria | 53037 |
| 43 | Ga0070658_10000997 | 3300005327 | Bacteria | 24288 |
| 44 | Ga0070658_10001963 | 3300005327 | Bacteria | 17312 |
| 45 | Ga0070658_10037455 | 3300005327 | Bacteria | 3910 |
| 46 | Ga0070658_10062123 | 3300005327 | Bacteria | 3044 |
| 47 | Ga0068869_100002615 | 3300005334 | Bacteria | 10866 |
| 48 | Ga0068868_100000025 | 3300005338 | Bacteria | 82086 |
| 49 | Ga0070660_100000328 | 3300005339 | Bacteria | 31334 |
| 50 | Ga0070660_100002358 | 3300005339 | Bacteria | 12979 |
| 51 | Ga0070660_100002527 | 3300005339 | Bacteria | 12533 |
| 52 | Ga0070660_100007482 | 3300005339 | Bacteria | 7614 |
| 53 | Ga0070660_100017743 | 3300005339 | Bacteria | 5191 |
| 54 | Ga0070660_100023355 | 3300005339 | Bacteria | 4581 |
| 55 | Ga0070661_100004712 | 3300005344 | Bacteria | 9384 |
| 56 | Ga0070673_100000016 | 3300005364 | Bacteria | 114927 |
| 57 | Ga0070659_100000795 | 3300005366 | Bacteria | 22991 |
| 58 | Ga0070663_100000576 | 3300005455 | Bacteria | 19619 |
| 59 | Ga0070678_100000008 | 3300005456 | Bacteria | 64802 |
| 60 | Ga0068867_100000962 | 3300005459 | Bacteria | 19626 |
| 61 | Ga0070679_100007263 | 3300005530 | Bacteria | 10344 |
| 62 | Ga0068853_100000036 | 3300005539 | Bacteria | 108488 |
| 63 | Ga0068853_100001281 | 3300005539 | Bacteria | 18024 |
| 64 | Ga0068855_100000007 | 3300005563 | Bacteria | 273676 |
| 65 | Ga0068855_100008887 | 3300005563 | Bacteria | 12145 |
| 66 | Ga0068855_100019042 | 3300005563 | Bacteria | 8252 |
| 67 | Ga0068854_100000016 | 3300005578 | Bacteria | 145396 |
| 68 | Ga0068854_100000092 | 3300005578 | Bacteria | 63516 |
| 69 | Ga0068856_100053290 | 3300005614 | Bacteria | 3988 |
| 70 | Ga0068852_100044171 | 3300005616 | Bacteria | 3782 |
| 71 | Ga0068859_100000074 | 3300005617 | Bacteria | 92064 |
| 72 | Ga0068861_100000017 | 3300005719 | Bacteria | 78362 |
| 73 | Ga0068851_10004689 | 3300005834 | Bacteria | 6179 |
| 74 | Ga0068858_100000608 | 3300005842 | Bacteria | 37381 |
| 75 | Ga0075362_10007195 | 3300006177 | Bacteria | 4200 |
| 76 | Ga0075370_10021119 | 3300006353 | Bacteria | 3566 |
| 77 | Ga0068871_100005824 | 3300006358 | Bacteria | 8661 |
| 78 | Ga0068865_100000026 | 3300006881 | Bacteria | 93349 |
| 79 | Ga0097620_100000074 | 3300006931 | Bacteria | 92064 |
| 80 | Ga0105240_10000025 | 3300009093 | Bacteria | 367124 |
| 81 | Ga0105240_10008610 | 3300009093 | Bacteria | 14579 |
| 82 | Ga0105240_10069202 | 3300009093 | Bacteria | 4370 |
| 83 | Ga0105245_10000078 | 3300009098 | Bacteria | 100583 |
| 84 | Ga0105245_10001409 | 3300009098 | Bacteria | 21801 |
| 85 | Ga0105243_10000394 | 3300009148 | Bacteria | 46074 |
| 86 | Ga0105243_10000475 | 3300009148 | Bacteria | 41145 |
| 87 | Ga0105243_10018075 | 3300009148 | Bacteria | 5335 |
| 88 | Ga0105241_10000625 | 3300009174 | Bacteria | 26580 |
| 89 | Ga0105241_10012337 | 3300009174 | Bacteria | 6267 |
| 90 | Ga0105241_10018109 | 3300009174 | Bacteria | 5179 |
| 91 | Ga0105242_10000137 | 3300009176 | Bacteria | 53136 |
| 92 | Ga0105242_10002432 | 3300009176 | Bacteria | 14627 |
| 93 | Ga0105242_10009092 | 3300009176 | Bacteria | 7632 |
| 94 | Ga0105248_10001759 | 3300009177 | Bacteria | 24104 |
| 95 | Ga0105248_10027048 | 3300009177 | Bacteria | 6381 |
| 96 | Ga0105237_10000130 | 3300009545 | Bacteria | 105282 |
| 97 | Ga0105237_10036831 | 3300009545 | Bacteria | 4949 |
| 98 | Ga0105239_10000605 | 3300010375 | Bacteria | 51086 |
| 99 | Ga0105246_10008012 | 3300011119 | Bacteria | 6485 |
| 100 | Ga0157371_10000094 | 3300013102 | Bacteria | 139074 |
| 101 | Ga0157370_10000288 | 3300013104 | Bacteria | 63948 |
| 102 | Ga0157374_10000087 | 3300013296 | Bacteria | 91263 |
| 103 | Ga0157372_10021230 | 3300013307 | Bacteria | 7015 |
| 104 | Ga0157372_10025027 | 3300013307 | Bacteria | 6486 |
| 105 | Ga0157372_10039265 | 3300013307 | Bacteria | 5224 |
| 106 | Ga0157375_10000503 | 3300013308 | Bacteria | 35295 |
| 107 | Ga0157376_10003058 | 3300014969 | Bacteria | 11466 |
| 108 | Ga0183365_10004 | 3300015684 | Bacteria | 333304 |
| 109 | Ga0183365_10006 | 3300015684 | Bacteria | 225936 |
| 110 | Ga0209436_100005 | 3300025208 | Bacteria | 151087 |
| 111 | Ga0209436_100565 | 3300025208 | Bacteria | 15949 |
| 112 | Ga0207427_102137 | 3300025231 | Bacteria | 5711 |
| 113 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 114 | Ga0207425_1000119 | 3300025245 | Bacteria | 74008 |
| 115 | Ga0209646_1000039 | 3300025246 | Bacteria | 349637 |
| 116 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 117 | Ga0209677_100549 | 3300025253 | Bacteria | 20845 |
| 118 | Ga0209148_1000061 | 3300025254 | Bacteria | 349575 |
| 119 | Ga0209148_1000650 | 3300025254 | Bacteria | 30019 |
| 120 | Ga0209148_1001058 | 3300025254 | Bacteria | 16945 |
| 121 | Ga0209759_1000020 | 3300025256 | Bacteria | 344904 |
| 122 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 123 | Ga0209129_1004363 | 3300025258 | Bacteria | 5564 |
| 124 | Ga0209233_1000041 | 3300025261 | Bacteria | 515463 |
| 125 | Ga0209233_1007364 | 3300025261 | Bacteria | 3491 |
| 126 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 127 | Ga0209565_1000397 | 3300025263 | Bacteria | 36695 |
| 128 | Ga0209565_1000643 | 3300025263 | Bacteria | 22611 |
| 129 | Ga0209565_1000672 | 3300025263 | Bacteria | 21620 |
| 130 | Ga0209565_1001325 | 3300025263 | Bacteria | 11340 |
| 131 | Ga0209455_1000429 | 3300025272 | Bacteria | 32869 |
| 132 | Ga0209673_1000007 | 3300025273 | Bacteria | 634477 |
| 133 | Ga0209673_1001402 | 3300025273 | Bacteria | 23466 |
| 134 | Ga0209130_1000055 | 3300025284 | Bacteria | 211696 |
| 135 | Ga0209130_1001525 | 3300025284 | Bacteria | 14857 |
| 136 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 137 | Ga0209675_1000234 | 3300025291 | Bacteria | 55443 |
| 138 | Ga0209675_1000374 | 3300025291 | Bacteria | 37975 |
| 139 | Ga0209676_1000295 | 3300025292 | Bacteria | 100711 |
| 140 | Ga0209676_1000468 | 3300025292 | Bacteria | 67646 |
| 141 | Ga0209564_1000124 | 3300025295 | Bacteria | 202046 |
| 142 | Ga0209564_1000203 | 3300025295 | Bacteria | 136358 |
| 143 | Ga0209564_1000444 | 3300025295 | Bacteria | 71274 |
| 144 | Ga0209564_1000459 | 3300025295 | Bacteria | 68564 |
| 145 | Ga0209564_1001715 | 3300025295 | Bacteria | 20596 |
| 146 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 147 | Ga0209758_1000020 | 3300025297 | Bacteria | 734220 |
| 148 | Ga0209050_1000253 | 3300025298 | Bacteria | 114525 |
| 149 | Ga0209050_1000293 | 3300025298 | Bacteria | 106097 |
| 150 | Ga0209050_1000313 | 3300025298 | Bacteria | 98580 |
| 151 | Ga0209050_1000362 | 3300025298 | Bacteria | 87030 |
| 152 | Ga0209050_1000486 | 3300025298 | Bacteria | 69279 |
| 153 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 154 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 155 | Ga0209256_1000028 | 3300025299 | Bacteria | 420213 |
| 156 | Ga0209256_1000097 | 3300025299 | Bacteria | 204513 |
| 157 | Ga0209256_1000790 | 3300025299 | Bacteria | 40844 |
| 158 | Ga0209256_1001184 | 3300025299 | Bacteria | 29313 |
| 159 | Ga0209256_1001522 | 3300025299 | Bacteria | 23395 |
| 160 | Ga0209256_1005370 | 3300025299 | Bacteria | 7418 |
| 161 | Ga0209051_1009013 | 3300025303 | Bacteria | 5196 |
| 162 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 163 | Ga0209257_1000520 | 3300025304 | Bacteria | 66890 |
| 164 | Ga0209257_1000850 | 3300025304 | Bacteria | 43660 |
| 165 | Ga0209257_1003579 | 3300025304 | Bacteria | 13165 |
| 166 | Ga0209257_1006121 | 3300025304 | Bacteria | 7978 |
| 167 | Ga0207656_10003715 | 3300025321 | Bacteria | 5284 |
| 168 | Ga0207656_10012799 | 3300025321 | Bacteria | 3193 |
| 169 | Ga0207688_10015724 | 3300025901 | Bacteria | 4105 |
| 170 | Ga0207647_10004083 | 3300025904 | Bacteria | 10848 |
| 171 | Ga0207647_10004207 | 3300025904 | Bacteria | 10674 |
| 172 | Ga0207705_10000049 | 3300025909 | Bacteria | 170616 |
| 173 | Ga0207705_10000249 | 3300025909 | Bacteria | 53095 |
| 174 | Ga0207705_10007510 | 3300025909 | Bacteria | 8010 |
| 175 | Ga0207705_10044287 | 3300025909 | Unclassified | 3198 |
| 176 | Ga0207654_10000020 | 3300025911 | Bacteria | 167053 |
| 177 | Ga0207654_10003662 | 3300025911 | Bacteria | 7751 |
| 178 | Ga0207654_10014844 | 3300025911 | Bacteria | 4032 |
| 179 | Ga0207695_10000025 | 3300025913 | Bacteria | 627211 |
| 180 | Ga0207695_10005407 | 3300025913 | Bacteria | 16946 |
| 181 | Ga0207695_10012282 | 3300025913 | Bacteria | 10287 |
| 182 | Ga0207695_10017885 | 3300025913 | Bacteria | 8213 |
| 183 | Ga0207671_10001177 | 3300025914 | Bacteria | 31119 |
| 184 | Ga0207671_10023603 | 3300025914 | Bacteria | 4637 |
| 185 | Ga0207657_10001967 | 3300025919 | Bacteria | 22194 |
| 186 | Ga0207657_10002419 | 3300025919 | Bacteria | 20168 |
| 187 | Ga0207657_10008244 | 3300025919 | Bacteria | 10606 |
| 188 | Ga0207657_10032249 | 3300025919 | Bacteria | 4736 |
| 189 | Ga0207657_10050412 | 3300025919 | Bacteria | 3623 |
| 190 | Ga0207649_10009836 | 3300025920 | Bacteria | 5241 |
| 191 | Ga0207652_10001407 | 3300025921 | Bacteria | 21349 |
| 192 | Ga0207694_10007016 | 3300025924 | Bacteria | 8552 |
| 193 | Ga0207694_10041828 | 3300025924 | Bacteria | 3532 |
| 194 | Ga0207687_10002419 | 3300025927 | Bacteria | 12664 |
| 195 | Ga0207664_10030391 | 3300025929 | Unclassified | 4125 |
| 196 | Ga0207690_10004189 | 3300025932 | Bacteria | 8522 |
| 197 | Ga0207706_10005052 | 3300025933 | Bacteria | 12318 |
| 198 | Ga0207686_10002463 | 3300025934 | Bacteria | 10052 |
| 199 | Ga0207709_10000139 | 3300025935 | Bacteria | 102200 |
| 200 | Ga0207709_10000187 | 3300025935 | Bacteria | 82937 |
| 201 | Ga0207709_10017749 | 3300025935 | Bacteria | 3977 |
| 202 | Ga0207669_10001661 | 3300025937 | Bacteria | 9467 |
| 203 | Ga0207704_10000006 | 3300025938 | Bacteria | 220005 |
| 204 | Ga0207691_10014508 | 3300025940 | Bacteria | 7514 |
| 205 | Ga0207711_10003423 | 3300025941 | Bacteria | 13728 |
| 206 | Ga0207689_10001911 | 3300025942 | Bacteria | 19691 |
| 207 | Ga0207667_10000006 | 3300025949 | Bacteria | 679876 |
| 208 | Ga0207667_10000038 | 3300025949 | Bacteria | 280720 |
| 209 | Ga0207667_10005692 | 3300025949 | Bacteria | 15198 |
| 210 | Ga0207667_10010760 | 3300025949 | Bacteria | 10671 |
| 211 | Ga0207651_10000001 | 3300025960 | Bacteria | 516823 |
| 212 | Ga0207640_10000001 | 3300025981 | Bacteria | 628778 |
| 213 | Ga0207640_10000142 | 3300025981 | Bacteria | 52324 |
| 214 | Ga0207640_10004700 | 3300025981 | Bacteria | 7415 |
| 215 | Ga0207677_10000016 | 3300026023 | Bacteria | 153771 |
| 216 | Ga0207703_10000123 | 3300026035 | Bacteria | 92590 |
| 217 | Ga0207639_10000058 | 3300026041 | Bacteria | 108456 |
| 218 | Ga0207639_10001458 | 3300026041 | Bacteria | 15924 |
| 219 | Ga0207639_10002766 | 3300026041 | Bacteria | 11786 |
| 220 | Ga0207639_10005197 | 3300026041 | Bacteria | 8780 |
| 221 | Ga0207678_10003654 | 3300026067 | Bacteria | 13821 |
| 222 | Ga0207678_10004134 | 3300026067 | Bacteria | 13040 |
| 223 | Ga0207678_10030842 | 3300026067 | Unclassified | 4681 |
| 224 | Ga0207678_10042503 | 3300026067 | Bacteria | 3937 |
| 225 | Ga0207702_10002032 | 3300026078 | Bacteria | 19607 |
| 226 | Ga0207702_10002612 | 3300026078 | Bacteria | 16920 |
| 227 | Ga0207702_10003011 | 3300026078 | Bacteria | 15666 |
| 228 | Ga0207648_10000042 | 3300026089 | Bacteria | 114885 |
| 229 | Ga0207674_10010322 | 3300026116 | Bacteria | 10588 |
| 230 | Ga0207674_10023489 | 3300026116 | Bacteria | 6603 |
| 231 | Ga0207675_100000462 | 3300026118 | Bacteria | 39560 |
| 232 | Ga0207698_10013641 | 3300026142 | Bacteria | 5370 |
| 233 | Ga0265326_10002838 | 3300028558 | Bacteria | 5782 |
| 234 | Ga0307515_10000004 | 3300028794 | Bacteria | 846506 |
| 235 | Ga0307515_10000026 | 3300028794 | Bacteria | 382411 |
| 236 | Ga0307515_10035278 | 3300028794 | Bacteria | 8144 |
| 237 | Ga0265331_10002582 | 3300031250 | Bacteria | 12175 |
| 238 | Ga0307408_100000022 | 3300031548 | Bacteria | 310242 |
| 239 | Ga0307408_100000964 | 3300031548 | Bacteria | 22306 |
| 240 | Ga0307408_100001584 | 3300031548 | Bacteria | 16793 |
| 241 | Ga0307408_100004400 | 3300031548 | Bacteria | 9562 |
| 242 | Ga0307408_100007022 | 3300031548 | Bacteria | 7446 |
| 243 | Ga0307508_10001070 | 3300031616 | Bacteria | 31688 |
| 244 | Ga0307412_10000126 | 3300031911 | Bacteria | 56270 |
| 245 | Ga0307414_10000270 | 3300032004 | Bacteria | 32016 |
| 246 | Ga0373931_0000925 | 3300035691 | Bacteria | 12354 |
| 247 | Ga0395900_0006364 | 3300037418 | Bacteria | 12310 |
| 248 | Ga0395900_0052951 | 3300037418 | Bacteria | 4177 |
| 249 | Ga0395898_0013893 | 3300037466 | Bacteria | 8275 |
| 250 | Ga0395905_0013977 | 3300037471 | Bacteria | 7680 |
| 251 | Ga0439461_0001555 | 3300041410 | Bacteria | 3560 |
| 252 | Ga0451800_0972437 | 3300041459 | Bacteria | 17116 |
| 253 | Ga0451806_498691 | 3300041462 | Bacteria | 4799 |
| 254 | Ga0451807_2635666 | 3300041486 | Bacteria | 9989 |
| 255 | Ga0439432_000490 | 3300042006 | Bacteria | 14764 |
| 256 | Ga0439449_0000136 | 3300042007 | Bacteria | 24746 |
| 257 | Ga0439449_0005325 | 3300042007 | Bacteria | 4928 |
| 258 | Ga0439462_0000345 | 3300042015 | Bacteria | 8770 |
| 259 | Ga0439458_0003719 | 3300042157 | Bacteria | 3539 |
| 260 | Ga0451577_0010591 | 3300042876 | Bacteria | 8794 |
| 261 | Ga0451577_0036398 | 3300042876 | Bacteria | 4430 |
| 262 | Ga0466972_0000678 | 3300044658 | Bacteria | 16352 |
| 263 | Ga0466965_0003484 | 3300044683 | Bacteria | 6905 |
| 264 | Ga0466966_0003289 | 3300044684 | Bacteria | 10659 |
| 265 | Ga0466961_0024527 | 3300044693 | Bacteria | 3879 |
| 266 | Ga0466964_0000369 | 3300044706 | Bacteria | 13607 |
| 267 | Ga0453684_0012388 | 3300044712 | Bacteria | 14076 |
| 268 | Ga0451576_0000869 | 3300045051 | Bacteria | 58069 |
| 269 | Ga0495627_001669 | 3300046453 | Bacteria | 12257 |
| 270 | Ga0495638_0000294 | 3300046460 | Bacteria | 65635 |
| 271 | Ga0495638_0000360 | 3300046460 | Bacteria | 56554 |
| 272 | Ga0495650_0002387 | 3300046471 | Bacteria | 15378 |
| 273 | Ga0495605_0000039 | 3300046474 | Bacteria | 196802 |
| 274 | Ga0495639_0006254 | 3300046475 | Bacteria | 5116 |
| 275 | Ga0495584_0000611 | 3300046491 | Bacteria | 23905 |
| 276 | Ga0495584_0004954 | 3300046491 | Bacteria | 7099 |
| 277 | Ga0495607_0001269 | 3300046501 | Bacteria | 22570 |
| 278 | Ga0495607_0001918 | 3300046501 | Bacteria | 17580 |
| 279 | Ga0495583_0000006 | 3300046506 | Bacteria | 436893 |
| 280 | Ga0495606_0000059 | 3300046507 | Bacteria | 186886 |
| 281 | Ga0495606_0012988 | 3300046507 | Bacteria | 6624 |
| 282 | Ga0495610_0000091 | 3300046512 | Bacteria | 105916 |
| 283 | Ga0495610_0002817 | 3300046512 | Bacteria | 14175 |
| 284 | Ga0495610_0006775 | 3300046512 | Bacteria | 7773 |
| 285 | Ga0495616_0000731 | 3300046513 | Bacteria | 24175 |
| 286 | Ga0495616_0010686 | 3300046513 | Bacteria | 5301 |
| 287 | Ga0495644_0001141 | 3300046523 | Bacteria | 10900 |
| 288 | Ga0495648_0000263 | 3300046524 | Bacteria | 59213 |
| 289 | Ga0495648_0010002 | 3300046524 | Bacteria | 7274 |
| 290 | Ga0495663_0001405 | 3300046525 | Bacteria | 7594 |
| 291 | Ga0495642_0001641 | 3300046528 | Bacteria | 9731 |
| 292 | Ga0495609_0000019 | 3300046538 | Bacteria | 297777 |
| 293 | Ga0495609_0000408 | 3300046538 | Bacteria | 35895 |
| 294 | Ga0495597_0008096 | 3300046542 | Bacteria | 5288 |
| 295 | Ga0495622_0000048 | 3300046557 | Bacteria | 108955 |
| 296 | Ga0495633_0000024 | 3300046558 | Bacteria | 225077 |
| 297 | Ga0495668_0001234 | 3300046616 | Bacteria | 25687 |
| 298 | Ga0495625_0000043 | 3300046660 | Bacteria | 205715 |
| 299 | Ga0495625_0000072 | 3300046660 | Bacteria | 166439 |
| 300 | Ga0495625_0000519 | 3300046660 | Bacteria | 56854 |
| 301 | Ga0495625_0001203 | 3300046660 | Bacteria | 32899 |
| 302 | Ga0495625_0015917 | 3300046660 | Bacteria | 5934 |
| 303 | Ga0495625_0018286 | 3300046660 | Bacteria | 5474 |
| 304 | Ga0495659_0000185 | 3300046664 | Bacteria | 27168 |
| 305 | Ga0495661_0000012 | 3300046665 | Bacteria | 276804 |
| 306 | Ga0495661_0001409 | 3300046665 | Bacteria | 20155 |
| 307 | Ga0495588_0000059 | 3300046674 | Bacteria | 263358 |
| 308 | Ga0495588_0009381 | 3300046674 | Bacteria | 4521 |
| 309 | Ga0495671_0000088 | 3300046692 | Bacteria | 87282 |
| 310 | Ga0495649_0022092 | 3300046694 | Bacteria | 3562 |
| 311 | Ga0495589_0000007 | 3300046794 | Bacteria | 276444 |
| 312 | Ga0495589_0000047 | 3300046794 | Bacteria | 117810 |
| 313 | Ga0495660_0000135 | 3300046810 | Bacteria | 80391 |
| 314 | Ga0495672_0000262 | 3300047320 | Bacteria | 73028 |
| 315 | Ga0495672_0001994 | 3300047320 | Bacteria | 19290 |
| 316 | Ga0495687_000003 | 3300047443 | Bacteria | 859509 |
| 317 | Ga0495687_000431 | 3300047443 | Bacteria | 51764 |
| 318 | Ga0495687_000987 | 3300047443 | Bacteria | 28644 |
| 319 | Ga0495687_002076 | 3300047443 | Bacteria | 16834 |
| 320 | Ga0495677_0000150 | 3300047445 | Bacteria | 33321 |
| 321 | Ga0495677_0012370 | 3300047445 | Bacteria | 3112 |
| 322 | Ga0495673_0000025 | 3300047469 | Bacteria | 512352 |
| 323 | Ga0495686_0000976 | 3300047472 | Bacteria | 35073 |
| 324 | Ga0495626_0000047 | 3300048091 | Bacteria | 161939 |
| 325 | Ga0496102_0000086 | 3300048905 | Bacteria | 132217 |
| 326 | Ga0496103_0000055 | 3300048906 | Bacteria | 143870 |
| 327 | Ga0496105_0000421 | 3300048908 | Bacteria | 27828 |
| 328 | Ga0496107_0000033 | 3300048910 | Bacteria | 94532 |
| 329 | Ga0496110_0010167 | 3300048913 | Bacteria | 7644 |
| 330 | Ga0496111_0017866 | 3300048914 | Bacteria | 4905 |
| 331 | Ga0496115_0000099 | 3300048918 | Bacteria | 82245 |
| 332 | Ga0496116_0002282 | 3300048919 | Bacteria | 20338 |
| 333 | Ga0496117_0000175 | 3300048920 | Bacteria | 132363 |
| 334 | Ga0496118_0000325 | 3300048921 | Bacteria | 82266 |
| 335 | Ga0496118_0004674 | 3300048921 | Bacteria | 16047 |
| 336 | Ga0496118_0024252 | 3300048921 | Bacteria | 5244 |
| 337 | Ga0496119_0005730 | 3300048922 | Bacteria | 11774 |
| 338 | Ga0496120_0027005 | 3300048923 | Bacteria | 3538 |
| 339 | Ga0496121_0000022 | 3300048924 | Bacteria | 472849 |
| 340 | Ga0496121_0000259 | 3300048924 | Bacteria | 110676 |
| 341 | Ga0496121_0000434 | 3300048924 | Bacteria | 82428 |
| 342 | Ga0496121_0018321 | 3300048924 | Bacteria | 7068 |
| 343 | Ga0496121_0018852 | 3300048924 | Bacteria | 6925 |
| 344 | Ga0496122_0001697 | 3300048925 | Bacteria | 34173 |
| 345 | Ga0496123_0001172 | 3300048926 | Bacteria | 38728 |
| 346 | Ga0496123_0005237 | 3300048926 | Bacteria | 13174 |
| 347 | Ga0496123_0030545 | 3300048926 | Bacteria | 3942 |
| 348 | Ga0496124_0000367 | 3300048927 | Bacteria | 82348 |
| 349 | Ga0496124_0006888 | 3300048927 | Bacteria | 12215 |
| 350 | Ga0496124_0014393 | 3300048927 | Bacteria | 7648 |
| 351 | Ga0496125_0008080 | 3300048928 | Bacteria | 11089 |
| 352 | Ga0496125_0045027 | 3300048928 | Bacteria | 3720 |
| 353 | Ga0496126_0000204 | 3300048929 | Bacteria | 132495 |
| 354 | Ga0496126_0001931 | 3300048929 | Bacteria | 29568 |
| 355 | Ga0495678_000483 | 3300049459 | Bacteria | 39595 |
| 356 | Ga0501032_0009002 | 3300049569 | Bacteria | 7257 |
| 357 | Ga0501033_0000047 | 3300049570 | Bacteria | 122884 |
| 358 | Ga0501034_0010928 | 3300049571 | Bacteria | 9433 |
| 359 | Ga0501038_0033705 | 3300049574 | Bacteria | 4508 |
| 360 | Ga0501223_000116 | 3300049663 | Bacteria | 22926 |
| 361 | Ga0501224_000011 | 3300049664 | Bacteria | 93275 |
| 362 | Ga0501234_000263 | 3300049707 | Bacteria | 7656 |
| 363 | Ga0501269_000459 | 3300049766 | Bacteria | 8929 |
| 364 | Ga0501279_000104 | 3300049775 | Bacteria | 12890 |
| 365 | Ga0501279_000571 | 3300049775 | Bacteria | 4810 |
| 366 | Ga0501226_000024 | 3300049853 | Bacteria | 93123 |
| 367 | nmdc:mga0k408_4722_c1 | 3300050493 | Bacteria | 7218 |
| 368 | nmdc:mga0sz30_7848_c1 | 3300050516 | Bacteria | 4015 |
| 369 | Ga0500578_0000043 | 3300053086 | Bacteria | 128295 |
| 370 | Ga0500583_0001237 | 3300053092 | Bacteria | 7309 |
| 371 | Ga0500556_0000186 | 3300053104 | Bacteria | 50723 |
| 372 | Ga0500594_0000030 | 3300053118 | Bacteria | 47305 |
| 373 | Ga0500608_000488 | 3300053122 | Bacteria | 14852 |
| 374 | Ga0500642_0000192 | 3300053130 | Bacteria | 24971 |
| 375 | Ga0500658_0000921 | 3300053134 | Bacteria | 12019 |
| 376 | Ga0500577_0001773 | 3300053142 | Bacteria | 5515 |
| 377 | Ga0500622_0002456 | 3300053156 | Bacteria | 13368 |
| 378 | Ga0500622_0033357 | 3300053156 | Bacteria | 2699 |
| 379 | Ga0500645_000149 | 3300053730 | Bacteria | 54622 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10000025 | Ga0105240_10000025252 | 754 |
| 2 | 3300025913 | Ga0207695_10000025 | Ga0207695_10000025245 | 754 |
| 3 | 3300005339 | Ga0070660_100002527 | Ga0070660_1000025272 | 755 |
| 4 | 3300005366 | Ga0070659_100000795 | Ga0070659_1000007956 | 755 |
| 5 | 3300005530 | Ga0070679_100007263 | Ga0070679_1000072632 | 755 |
| 6 | 3300005539 | Ga0068853_100000036 | Ga0068853_1000000367 | 755 |
| 7 | 3300005578 | Ga0068854_100000016 | Ga0068854_1000000167 | 755 |
| 8 | 3300009093 | Ga0105240_10008610 | Ga0105240_100086104 | 755 |
| 9 | 3300013307 | Ga0157372_10025027 | Ga0157372_100250272 | 755 |
| 10 | 3300025261 | Ga0209233_1007364 | Ga0209233_10073642 | 755 |
| 11 | 3300025913 | Ga0207695_10017885 | Ga0207695_100178853 | 755 |
| 12 | 3300025919 | Ga0207657_10002419 | Ga0207657_1000241913 | 755 |
| 13 | 3300025921 | Ga0207652_10001407 | Ga0207652_100014077 | 755 |
| 14 | 3300025981 | Ga0207640_10000001 | Ga0207640_10000001400 | 755 |
| 15 | 3300026041 | Ga0207639_10000058 | Ga0207639_1000005890 | 755 |
| 16 | 3300026067 | Ga0207678_10030842 | Ga0207678_100308422 | 755 |
| 17 | 3300031250 | Ga0265331_10002582 | Ga0265331_100025823 | 755 |
| 18 | 3300025929 | Ga0207664_10030391 | Ga0207664_100303912 | 761 |
| 19 | 3300053156 | Ga0500622_0033357 | Ga0500622_0033357_274_2688 | 804 |
| 20 | 3300050516 | nmdc:mga0sz30_7848_c1 | nmdc:mga0sz30_7848_c1_1285_3996 | 868 |
| 21 | 3300049574 | Ga0501038_0033705 | Ga0501038_0033705_1799_4447 | 876 |
| 22 | iso_pu_bacteria | 2852684882 | 2852685857 | 892 |
| 23 | 3300046512 | Ga0495610_0002817 | Ga0495610_0002817_3131_5890 | 917 |
| 24 | 3300009176 | Ga0105242_10009092 | Ga0105242_100090924 | 923 |
| 25 | 3300025913 | Ga0207695_10012282 | Ga0207695_100122823 | 928 |
| 26 | 3300009545 | Ga0105237_10000130 | Ga0105237_1000013040 | 929 |
| 27 | 3300025914 | Ga0207671_10001177 | Ga0207671_1000117723 | 929 |
| 28 | 3300046507 | Ga0495606_0012988 | Ga0495606_0012988_3678_6575 | 932 |
| 29 | 3300047443 | Ga0495687_002076 | Ga0495687_002076_6632_9436 | 932 |
| 30 | iso_pu_bacteria | 2643221645 | 2644253118 | 932 |
| 31 | 3300009098 | Ga0105245_10000078 | Ga0105245_100000782 | 935 |
| 32 | 3300009148 | Ga0105243_10000394 | Ga0105243_1000039410 | 935 |
| 33 | 3300009176 | Ga0105242_10000137 | Ga0105242_1000013724 | 935 |
| 34 | 3300011119 | Ga0105246_10008012 | Ga0105246_100080124 | 935 |
| 35 | 3300013296 | Ga0157374_10000087 | Ga0157374_1000008764 | 935 |
| 36 | 3300013308 | Ga0157375_10000503 | Ga0157375_1000050319 | 935 |
| 37 | 3300014969 | Ga0157376_10003058 | Ga0157376_100030585 | 935 |
| 38 | 3300026078 | Ga0207702_10002612 | Ga0207702_100026122 | 935 |
| 39 | 3300002705 | JGI25156J39149_1000026 | JGI25156J39149_100002662 | 936 |
| 40 | 3300002738 | JGI25154J39366_1002022 | JGI25154J39366_10020223 | 936 |
| 41 | 3300002741 | JGI25157J39369_1000008 | JGI25157J39369_100000833 | 936 |
| 42 | 3300003752 | Ga0055539_1000561 | Ga0055539_10005614 | 936 |
| 43 | 3300005616 | Ga0068852_100044171 | Ga0068852_1000441712 | 936 |
| 44 | 3300025246 | Ga0209646_1000039 | Ga0209646_1000039222 | 936 |
| 45 | 3300025250 | Ga0209026_1000006 | Ga0209026_1000006379 | 936 |
| 46 | 3300025253 | Ga0209677_100549 | Ga0209677_1005498 | 936 |
| 47 | 3300025256 | Ga0209759_1000020 | Ga0209759_100002034 | 936 |
| 48 | 3300046501 | Ga0495607_0001269 | Ga0495607_0001269_6412_9309 | 937 |
| 49 | 3300046524 | Ga0495648_0010002 | Ga0495648_0010002_3350_6247 | 937 |
| 50 | 3300046491 | Ga0495584_0000611 | Ga0495584_0000611_17607_20594 | 938 |
| 51 | 3300047443 | Ga0495687_000431 | Ga0495687_000431_16858_19845 | 938 |
| 52 | 3300006177 | Ga0075362_10007195 | Ga0075362_100071952 | 940 |
| 53 | 3300006353 | Ga0075370_10021119 | Ga0075370_100211192 | 940 |
| 54 | 3300050493 | nmdc:mga0k408_4722_c1 | nmdc:mga0k408_4722_c1_2748_5699 | 940 |
| 55 | 3300028794 | Ga0307515_10000004 | Ga0307515_10000004673 | 941 |
| 56 | 3300047445 | Ga0495677_0012370 | Ga0495677_0012370_253_3090 | 942 |
| 57 | 3300049775 | Ga0501279_000571 | Ga0501279_000571_1443_4280 | 942 |
| 58 | 3300046674 | Ga0495588_0000059 | Ga0495588_0000059_96481_99393 | 943 |
| 59 | 3300042876 | Ga0451577_0010591 | Ga0451577_0010591_1273_4179 | 944 |
| 60 | 3300009177 | Ga0105248_10001759 | Ga0105248_100017597 | 947 |
| 61 | 3300049569 | Ga0501032_0009002 | Ga0501032_0009002_1096_4017 | 949 |
| 62 | iso_pu_bacteria | 2919138771 | 2919141824 | 949 |
| 63 | 3300003781 | Ga0055536_1000979 | Ga0055536_10009798 | 950 |
| 64 | 3300003791 | Ga0055530_10001470 | Ga0055530_100014706 | 950 |
| 65 | 3300003794 | Ga0055531_10001121 | Ga0055531_1000112111 | 950 |
| 66 | 3300025292 | Ga0209676_1000468 | Ga0209676_10004686 | 950 |
| 67 | 3300025298 | Ga0209050_1000486 | Ga0209050_100048610 | 950 |
| 68 | 3300025304 | Ga0209257_1000520 | Ga0209257_100052044 | 950 |
| 69 | 3300044693 | Ga0466961_0024527 | Ga0466961_0024527_13_2865 | 950 |
| 70 | iso_pu_bacteria | 2599185354 | 2600203234 | 952 |
| 71 | iso_pu_bacteria | 2751185897 | 2753766760 | 952 |
| 72 | 3300005563 | Ga0068855_100019042 | Ga0068855_1000190424 | 953 |
| 73 | 3300045051 | Ga0451576_0000869 | Ga0451576_0000869_24713_27598 | 953 |
| 74 | 3300025254 | Ga0209148_1001058 | Ga0209148_10010587 | 954 |
| 75 | 3300025272 | Ga0209455_1000429 | Ga0209455_100042912 | 954 |
| 76 | 3300046491 | Ga0495584_0004954 | Ga0495584_0004954_1064_3976 | 954 |
| 77 | 3300046513 | Ga0495616_0000731 | Ga0495616_0000731_18570_21482 | 954 |
| 78 | 3300046538 | Ga0495609_0000019 | Ga0495609_0000019_137836_140748 | 954 |
| 79 | 3300046665 | Ga0495661_0000012 | Ga0495661_0000012_12206_15118 | 954 |
| 80 | 3300046794 | Ga0495589_0000007 | Ga0495589_0000007_11823_14735 | 954 |
| 81 | 3300047443 | Ga0495687_000003 | Ga0495687_000003_137863_140775 | 954 |
| 82 | 3300047445 | Ga0495677_0000150 | Ga0495677_0000150_11823_14735 | 954 |
| 83 | 3300003374 | JGI25161J50226_1000062 | JGI25161J50226_100006257 | 955 |
| 84 | 3300004625 | Ga0055543_1000413 | Ga0055543_10004133 | 955 |
| 85 | 3300005262 | Ga0065165_1000261 | Ga0065165_100026126 | 955 |
| 86 | 3300005563 | Ga0068855_100008887 | Ga0068855_1000088875 | 955 |
| 87 | 3300009148 | Ga0105243_10018075 | Ga0105243_100180752 | 955 |
| 88 | 3300009176 | Ga0105242_10002432 | Ga0105242_100024322 | 955 |
| 89 | 3300025208 | Ga0209436_100005 | Ga0209436_100005105 | 955 |
| 90 | 3300025284 | Ga0209130_1000055 | Ga0209130_1000055155 | 955 |
| 91 | 3300025911 | Ga0207654_10003662 | Ga0207654_100036625 | 955 |
| 92 | 3300025919 | Ga0207657_10032249 | Ga0207657_100322493 | 955 |
| 93 | 3300025935 | Ga0207709_10017749 | Ga0207709_100177491 | 955 |
| 94 | 3300025949 | Ga0207667_10005692 | Ga0207667_100056921 | 955 |
| 95 | 3300037466 | Ga0395898_0013893 | Ga0395898_0013893_4749_7661 | 955 |
| 96 | 3300044658 | Ga0466972_0000678 | Ga0466972_0000678_12698_15610 | 955 |
| 97 | 3300042876 | Ga0451577_0036398 | Ga0451577_0036398_520_3450 | 956 |
| 98 | 3300046453 | Ga0495627_001669 | Ga0495627_001669_3255_6149 | 956 |
| 99 | 3300048924 | Ga0496121_0018321 | Ga0496121_0018321_116_3010 | 956 |
| 100 | 3300005262 | Ga0065165_1001967 | Ga0065165_10019676 | 957 |
| 101 | 3300025254 | Ga0209148_1000650 | Ga0209148_100065014 | 957 |
| 102 | 3300042007 | Ga0439449_0000136 | Ga0439449_0000136_19793_22672 | 957 |
| 103 | 3300048924 | Ga0496121_0000022 | Ga0496121_0000022_284389_287340 | 957 |
| 104 | iso_pu_bacteria | 2643221544 | 2643744577 | 957 |
| 105 | iso_pu_bacteria | 2786546940 | 2788436741 | 957 |
| 106 | iso_pu_bacteria | 2880518877 | 2880520973 | 957 |
| 107 | iso_pu_bacteria | 8047673197 | 8047676713 | 957 |
| 108 | 3300048910 | Ga0496107_0000033 | Ga0496107_0000033_24359_27244 | 958 |
| 109 | 3300048924 | Ga0496121_0000259 | Ga0496121_0000259_69350_72235 | 958 |
| 110 | 3300013104 | Ga0157370_10000288 | Ga0157370_1000028840 | 959 |
| 111 | 3300031548 | Ga0307408_100004400 | Ga0307408_1000044005 | 959 |
| 112 | iso_pu_bacteria | 2786546517 | 2787438995 | 959 |
| 113 | iso_pu_bacteria | 2928531327 | 2928531345 | 959 |
| 114 | 3300005327 | Ga0070658_10037455 | Ga0070658_100374552 | 960 |
| 115 | 3300015684 | Ga0183365_10004 | Ga0183365_10004249 | 960 |
| 116 | 3300025909 | Ga0207705_10044287 | Ga0207705_100442871 | 960 |
| 117 | 3300031548 | Ga0307408_100000022 | Ga0307408_10000002263 | 960 |
| 118 | 3300005339 | Ga0070660_100000328 | Ga0070660_10000032811 | 961 |
| 119 | 3300025298 | Ga0209050_1000253 | Ga0209050_100025351 | 961 |
| 120 | 3300028558 | Ga0265326_10002838 | Ga0265326_100028382 | 961 |
| 121 | 3300035691 | Ga0373931_0000925 | Ga0373931_0000925_5252_8161 | 961 |
| 122 | 3300046474 | Ga0495605_0000039 | Ga0495605_0000039_97833_100730 | 961 |
| 123 | 3300046665 | Ga0495661_0001409 | Ga0495661_0001409_3200_6097 | 961 |
| 124 | 3300046694 | Ga0495649_0022092 | Ga0495649_0022092_179_3076 | 961 |
| 125 | 3300046794 | Ga0495589_0000047 | Ga0495589_0000047_3596_6493 | 961 |
| 126 | 3300046810 | Ga0495660_0000135 | Ga0495660_0000135_61665_64562 | 961 |
| 127 | 3300047320 | Ga0495672_0001994 | Ga0495672_0001994_4567_7464 | 961 |
| 128 | 3300047443 | Ga0495687_000987 | Ga0495687_000987_19142_22039 | 961 |
| 129 | 3300048091 | Ga0495626_0000047 | Ga0495626_0000047_15302_18199 | 961 |
| 130 | 3300048924 | Ga0496121_0018852 | Ga0496121_0018852_2813_5731 | 961 |
| 131 | 3300048926 | Ga0496123_0005237 | Ga0496123_0005237_9493_12390 | 961 |
| 132 | 3300048927 | Ga0496124_0006888 | Ga0496124_0006888_4949_7867 | 961 |
| 133 | iso_pu_bacteria | 2821131069 | 2821135470 | 961 |
| 134 | iso_pu_bacteria | 2884960567 | 2884963299 | 961 |
| 135 | 3300009177 | Ga0105248_10027048 | Ga0105248_100270481 | 962 |
| 136 | 3300025941 | Ga0207711_10003423 | Ga0207711_100034239 | 962 |
| 137 | 3300028794 | Ga0307515_10000026 | Ga0307515_10000026228 | 962 |
| 138 | 3300044712 | Ga0453684_0012388 | Ga0453684_0012388_5973_8879 | 962 |
| 139 | 3300046660 | Ga0495625_0018286 | Ga0495625_0018286_2063_4987 | 962 |
| 140 | 3300049570 | Ga0501033_0000047 | Ga0501033_0000047_88266_91217 | 962 |
| 141 | iso_pu_bacteria | 2643221556 | 2643797011 | 962 |
| 142 | iso_pu_bacteria | 2643221639 | 2644219153 | 962 |
| 143 | iso_pu_bacteria | 2643221646 | 2644255669 | 962 |
| 144 | iso_pu_bacteria | 2643221664 | 2644355283 | 962 |
| 145 | iso_pu_bacteria | 2643221684 | 2644469885 | 962 |
| 146 | iso_pu_bacteria | 2842711865 | 2842712526 | 962 |
| 147 | 3300031616 | Ga0307508_10001070 | Ga0307508_1000107014 | 963 |
| 148 | 3300046616 | Ga0495668_0001234 | Ga0495668_0001234_12001_14958 | 963 |
| 149 | 3300046660 | Ga0495625_0000043 | Ga0495625_0000043_183222_186140 | 963 |
| 150 | 3300047469 | Ga0495673_0000025 | Ga0495673_0000025_286613_289531 | 963 |
| 151 | iso_pu_bacteria | 2808606401 | 2809063466 | 963 |
| 152 | iso_pu_bacteria | 2808606404 | 2809079563 | 963 |
| 153 | iso_pu_bacteria | 2808606405 | 2809083799 | 963 |
| 154 | iso_pu_bacteria | 8002869464 | 8002870036 | 963 |
| 155 | 3300025254 | Ga0209148_1000061 | Ga0209148_100006171 | 964 |
| 156 | 3300025292 | Ga0209676_1000295 | Ga0209676_100029516 | 964 |
| 157 | 3300025298 | Ga0209050_1000362 | Ga0209050_10003628 | 964 |
| 158 | 3300046507 | Ga0495606_0000059 | Ga0495606_0000059_21387_24302 | 964 |
| 159 | iso_pu_bacteria | 2904424332 | 2904425262 | 964 |
| 160 | iso_pu_bacteria | 2919709256 | 2919712286 | 964 |
| 161 | 3300003322 | rootL2_10093835 | rootL2_100938352 | 965 |
| 162 | 3300047472 | Ga0495686_0000976 | Ga0495686_0000976_17886_20795 | 965 |
| 163 | 3300053104 | Ga0500556_0000186 | Ga0500556_0000186_45328_48237 | 965 |
| 164 | 3300053142 | Ga0500577_0001773 | Ga0500577_0001773_750_3659 | 965 |
| 165 | 3300053156 | Ga0500622_0002456 | Ga0500622_0002456_983_3889 | 965 |
| 166 | 3300053730 | Ga0500645_000149 | Ga0500645_000149_22600_25509 | 965 |
| 167 | 3300005578 | Ga0068854_100000092 | Ga0068854_10000009224 | 966 |
| 168 | 3300006358 | Ga0068871_100005824 | Ga0068871_1000058243 | 966 |
| 169 | 3300025911 | Ga0207654_10014844 | Ga0207654_100148441 | 966 |
| 170 | 3300025981 | Ga0207640_10000142 | Ga0207640_1000014218 | 966 |
| 171 | 3300026041 | Ga0207639_10005197 | Ga0207639_100051974 | 966 |
| 172 | 3300026067 | Ga0207678_10003654 | Ga0207678_100036543 | 966 |
| 173 | 3300031548 | Ga0307408_100000964 | Ga0307408_1000009644 | 966 |
| 174 | 3300037418 | Ga0395900_0006364 | Ga0395900_0006364_767_3679 | 966 |
| 175 | 3300037418 | Ga0395900_0052951 | Ga0395900_0052951_485_3397 | 966 |
| 176 | 3300037471 | Ga0395905_0013977 | Ga0395905_0013977_1138_4074 | 966 |
| 177 | 3300042007 | Ga0439449_0005325 | Ga0439449_0005325_1160_4072 | 966 |
| 178 | 3300042157 | Ga0439458_0003719 | Ga0439458_0003719_129_3041 | 966 |
| 179 | 3300044683 | Ga0466965_0003484 | Ga0466965_0003484_1308_4220 | 966 |
| 180 | 3300044706 | Ga0466964_0000369 | Ga0466964_0000369_2811_5723 | 966 |
| 181 | 3300046460 | Ga0495638_0000360 | Ga0495638_0000360_26488_29400 | 966 |
| 182 | 3300046512 | Ga0495610_0000091 | Ga0495610_0000091_93664_96576 | 966 |
| 183 | 3300046523 | Ga0495644_0001141 | Ga0495644_0001141_1849_4761 | 966 |
| 184 | 3300046528 | Ga0495642_0001641 | Ga0495642_0001641_5672_8584 | 966 |
| 185 | 3300046660 | Ga0495625_0000519 | Ga0495625_0000519_28649_31561 | 966 |
| 186 | 3300046660 | Ga0495625_0015917 | Ga0495625_0015917_1046_3958 | 966 |
| 187 | 3300053134 | Ga0500658_0000921 | Ga0500658_0000921_4781_7693 | 966 |
| 188 | iso_pu_bacteria | 2643221554 | 2643791708 | 966 |
| 189 | iso_pu_bacteria | 2643221638 | 2644211339 | 966 |
| 190 | iso_pu_bacteria | 2738541280 | 2738741755 | 966 |
| 191 | iso_pu_bacteria | 2738541300 | 2738843925 | 966 |
| 192 | iso_pu_bacteria | 2738543018 | 2739274514 | 966 |
| 193 | iso_pu_bacteria | 2738543030 | 2739343558 | 966 |
| 194 | 3300002067 | JGI24735J21928_10002943 | JGI24735J21928_100029432 | 967 |
| 195 | 3300046512 | Ga0495610_0006775 | Ga0495610_0006775_2940_5858 | 967 |
| 196 | 3300003374 | JGI25161J50226_1000758 | JGI25161J50226_10007584 | 968 |
| 197 | 3300003771 | Ga0055526_1000734 | Ga0055526_10007349 | 968 |
| 198 | 3300003773 | Ga0055537_1000569 | Ga0055537_10005695 | 968 |
| 199 | 3300003775 | Ga0055524_1000543 | Ga0055524_10005434 | 968 |
| 200 | 3300003791 | Ga0055530_10003310 | Ga0055530_100033103 | 968 |
| 201 | 3300031548 | Ga0307408_100001584 | Ga0307408_1000015843 | 968 |
| 202 | 3300046542 | Ga0495597_0008096 | Ga0495597_0008096_1757_4678 | 968 |
| 203 | 3300046660 | Ga0495625_0001203 | Ga0495625_0001203_23694_26615 | 968 |
| 204 | 3300046664 | Ga0495659_0000185 | Ga0495659_0000185_15333_18254 | 968 |
| 205 | 3300046692 | Ga0495671_0000088 | Ga0495671_0000088_45516_48437 | 968 |
| 206 | 3300047320 | Ga0495672_0000262 | Ga0495672_0000262_68628_71549 | 968 |
| 207 | 3300049766 | Ga0501269_000459 | Ga0501269_000459_871_3795 | 968 |
| 208 | 3300049775 | Ga0501279_000104 | Ga0501279_000104_6205_9126 | 968 |
| 209 | 3300053122 | Ga0500608_000488 | Ga0500608_000488_8367_11282 | 968 |
| 210 | 3300002077 | JGI24744J21845_10000760 | JGI24744J21845_100007604 | 969 |
| 211 | 3300002773 | JGI25152J39213_1000002 | JGI25152J39213_100000248 | 969 |
| 212 | 3300002774 | JGI25150J39212_1000038 | JGI25150J39212_100003832 | 969 |
| 213 | 3300003215 | JGI25153J46596_10007021 | JGI25153J46596_100070214 | 969 |
| 214 | 3300003771 | Ga0055526_1000229 | Ga0055526_100022921 | 969 |
| 215 | 3300003771 | Ga0055526_1002194 | Ga0055526_10021944 | 969 |
| 216 | 3300003773 | Ga0055537_1000516 | Ga0055537_10005167 | 969 |
| 217 | 3300003775 | Ga0055524_1000105 | Ga0055524_100010517 | 969 |
| 218 | 3300003790 | Ga0055528_1000296 | Ga0055528_100029631 | 969 |
| 219 | 3300003791 | Ga0055530_10000078 | Ga0055530_1000007835 | 969 |
| 220 | 3300005327 | Ga0070658_10062123 | Ga0070658_100621231 | 969 |
| 221 | 3300005339 | Ga0070660_100023355 | Ga0070660_1000233553 | 969 |
| 222 | 3300005617 | Ga0068859_100000074 | Ga0068859_10000007471 | 969 |
| 223 | 3300005719 | Ga0068861_100000017 | Ga0068861_10000001765 | 969 |
| 224 | 3300006931 | Ga0097620_100000074 | Ga0097620_10000007471 | 969 |
| 225 | 3300025208 | Ga0209436_100565 | Ga0209436_1005654 | 969 |
| 226 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011233 | 969 |
| 227 | 3300025245 | Ga0207425_1000119 | Ga0207425_100011912 | 969 |
| 228 | 3300025258 | Ga0209129_1000001 | Ga0209129_1000001410 | 969 |
| 229 | 3300025258 | Ga0209129_1004363 | Ga0209129_10043631 | 969 |
| 230 | 3300025263 | Ga0209565_1000397 | Ga0209565_100039716 | 969 |
| 231 | 3300025263 | Ga0209565_1000643 | Ga0209565_10006437 | 969 |
| 232 | 3300025263 | Ga0209565_1000672 | Ga0209565_10006724 | 969 |
| 233 | 3300025263 | Ga0209565_1001325 | Ga0209565_10013254 | 969 |
| 234 | 3300025273 | Ga0209673_1000007 | Ga0209673_1000007574 | 969 |
| 235 | 3300025284 | Ga0209130_1001525 | Ga0209130_10015254 | 969 |
| 236 | 3300025291 | Ga0209675_1000003 | Ga0209675_100000331 | 969 |
| 237 | 3300025291 | Ga0209675_1000234 | Ga0209675_100023429 | 969 |
| 238 | 3300025291 | Ga0209675_1000374 | Ga0209675_100037417 | 969 |
| 239 | 3300025295 | Ga0209564_1000124 | Ga0209564_1000124109 | 969 |
| 240 | 3300025295 | Ga0209564_1000203 | Ga0209564_10002038 | 969 |
| 241 | 3300025295 | Ga0209564_1000459 | Ga0209564_100045945 | 969 |
| 242 | 3300025295 | Ga0209564_1001715 | Ga0209564_10017153 | 969 |
| 243 | 3300025297 | Ga0209758_1000020 | Ga0209758_100002043 | 969 |
| 244 | 3300025298 | Ga0209050_1000293 | Ga0209050_100029381 | 969 |
| 245 | 3300025298 | Ga0209050_1000313 | Ga0209050_100031335 | 969 |
| 246 | 3300025299 | Ga0209256_1000028 | Ga0209256_100002817 | 969 |
| 247 | 3300025299 | Ga0209256_1000790 | Ga0209256_100079019 | 969 |
| 248 | 3300025299 | Ga0209256_1001184 | Ga0209256_10011844 | 969 |
| 249 | 3300025299 | Ga0209256_1001522 | Ga0209256_10015227 | 969 |
| 250 | 3300025299 | Ga0209256_1005370 | Ga0209256_10053703 | 969 |
| 251 | 3300025304 | Ga0209257_1000003 | Ga0209257_1000003471 | 969 |
| 252 | 3300025919 | Ga0207657_10050412 | Ga0207657_100504122 | 969 |
| 253 | 3300025940 | Ga0207691_10014508 | Ga0207691_100145085 | 969 |
| 254 | 3300026118 | Ga0207675_100000462 | Ga0207675_10000046211 | 969 |
| 255 | 3300031548 | Ga0307408_100007022 | Ga0307408_1000070223 | 969 |
| 256 | 3300046471 | Ga0495650_0002387 | Ga0495650_0002387_6237_9173 | 969 |
| 257 | 3300046475 | Ga0495639_0006254 | Ga0495639_0006254_96_3032 | 969 |
| 258 | 3300046501 | Ga0495607_0001918 | Ga0495607_0001918_8287_11226 | 969 |
| 259 | 3300046506 | Ga0495583_0000006 | Ga0495583_0000006_213896_216832 | 969 |
| 260 | 3300046513 | Ga0495616_0010686 | Ga0495616_0010686_1741_4680 | 969 |
| 261 | 3300046538 | Ga0495609_0000408 | Ga0495609_0000408_24167_27106 | 969 |
| 262 | 3300046557 | Ga0495622_0000048 | Ga0495622_0000048_1024_3960 | 969 |
| 263 | 3300046674 | Ga0495588_0009381 | Ga0495588_0009381_632_3613 | 969 |
| 264 | 3300048921 | Ga0496118_0024252 | Ga0496118_0024252_1116_4058 | 969 |
| 265 | 3300001915 | JGI24741J21665_1001663 | JGI24741J21665_10016631 | 970 |
| 266 | 3300001979 | JGI24740J21852_10009529 | JGI24740J21852_100095292 | 970 |
| 267 | 3300002067 | JGI24735J21928_10008643 | JGI24735J21928_100086431 | 970 |
| 268 | 3300005327 | Ga0070658_10000198 | Ga0070658_1000019821 | 970 |
| 269 | 3300005339 | Ga0070660_100002358 | Ga0070660_1000023587 | 970 |
| 270 | 3300005339 | Ga0070660_100017743 | Ga0070660_1000177433 | 970 |
| 271 | 3300005614 | Ga0068856_100053290 | Ga0068856_1000532902 | 970 |
| 272 | 3300009174 | Ga0105241_10000625 | Ga0105241_100006254 | 970 |
| 273 | 3300009545 | Ga0105237_10036831 | Ga0105237_100368312 | 970 |
| 274 | 3300025304 | Ga0209257_1000850 | Ga0209257_100085013 | 970 |
| 275 | 3300025321 | Ga0207656_10012799 | Ga0207656_100127992 | 970 |
| 276 | 3300025909 | Ga0207705_10000249 | Ga0207705_1000024917 | 970 |
| 277 | 3300025919 | Ga0207657_10001967 | Ga0207657_100019673 | 970 |
| 278 | 3300025924 | Ga0207694_10007016 | Ga0207694_100070167 | 970 |
| 279 | 3300026041 | Ga0207639_10001458 | Ga0207639_100014582 | 970 |
| 280 | 3300026067 | Ga0207678_10042503 | Ga0207678_100425031 | 970 |
| 281 | 3300026078 | Ga0207702_10003011 | Ga0207702_100030118 | 970 |
| 282 | 3300026116 | Ga0207674_10023489 | Ga0207674_100234894 | 970 |
| 283 | 3300031911 | Ga0307412_10000126 | Ga0307412_100001262 | 970 |
| 284 | 3300032004 | Ga0307414_10000270 | Ga0307414_1000027018 | 970 |
| 285 | 3300046660 | Ga0495625_0000072 | Ga0495625_0000072_47384_50317 | 970 |
| 286 | 3300048921 | Ga0496118_0004674 | Ga0496118_0004674_5234_8161 | 970 |
| 287 | 3300049571 | Ga0501034_0010928 | Ga0501034_0010928_276_3206 | 970 |
| 288 | 3300049663 | Ga0501223_000116 | Ga0501223_000116_18183_21113 | 970 |
| 289 | 3300049664 | Ga0501224_000011 | Ga0501224_000011_14454_17384 | 970 |
| 290 | 3300049707 | Ga0501234_000263 | Ga0501234_000263_1738_4668 | 970 |
| 291 | 3300049853 | Ga0501226_000024 | Ga0501226_000024_75873_78803 | 970 |
| 292 | 3300053092 | Ga0500583_0001237 | Ga0500583_0001237_535_3492 | 970 |
| 293 | 3300003214 | JGI25165J46597_1000082 | JGI25165J46597_1000082154 | 971 |
| 294 | 3300005455 | Ga0070663_100000576 | Ga0070663_10000057614 | 971 |
| 295 | 3300005539 | Ga0068853_100001281 | Ga0068853_10000128113 | 971 |
| 296 | 3300009093 | Ga0105240_10069202 | Ga0105240_100692022 | 971 |
| 297 | 3300009174 | Ga0105241_10012337 | Ga0105241_100123372 | 971 |
| 298 | 3300010375 | Ga0105239_10000605 | Ga0105239_1000060511 | 971 |
| 299 | 3300013307 | Ga0157372_10021230 | Ga0157372_100212302 | 971 |
| 300 | 3300015684 | Ga0183365_10006 | Ga0183365_10006130 | 971 |
| 301 | 3300025231 | Ga0207427_102137 | Ga0207427_1021372 | 971 |
| 302 | 3300025261 | Ga0209233_1000041 | Ga0209233_1000041153 | 971 |
| 303 | 3300025913 | Ga0207695_10005407 | Ga0207695_1000540714 | 971 |
| 304 | iso_pu_bacteria | 2643221583 | 2643924853 | 971 |
| 305 | 3300005334 | Ga0068869_100002615 | Ga0068869_1000026156 | 972 |
| 306 | 3300005338 | Ga0068868_100000025 | Ga0068868_1000000252 | 972 |
| 307 | 3300005364 | Ga0070673_100000016 | Ga0070673_10000001663 | 972 |
| 308 | 3300005459 | Ga0068867_100000962 | Ga0068867_1000009624 | 972 |
| 309 | 3300006881 | Ga0068865_100000026 | Ga0068865_10000002645 | 972 |
| 310 | 3300025927 | Ga0207687_10002419 | Ga0207687_100024192 | 972 |
| 311 | 3300025934 | Ga0207686_10002463 | Ga0207686_100024635 | 972 |
| 312 | 3300025935 | Ga0207709_10000187 | Ga0207709_1000018726 | 972 |
| 313 | 3300025938 | Ga0207704_10000006 | Ga0207704_10000006106 | 972 |
| 314 | 3300025942 | Ga0207689_10001911 | Ga0207689_100019116 | 972 |
| 315 | 3300025960 | Ga0207651_10000001 | Ga0207651_10000001168 | 972 |
| 316 | 3300026023 | Ga0207677_10000016 | Ga0207677_10000016114 | 972 |
| 317 | 3300026089 | Ga0207648_10000042 | Ga0207648_1000004226 | 972 |
| 318 | 3300048928 | Ga0496125_0008080 | Ga0496125_0008080_6293_9256 | 972 |
| 319 | 3300048929 | Ga0496126_0001931 | Ga0496126_0001931_12262_15225 | 972 |
| 320 | 3300003215 | JGI25153J46596_10000005 | JGI25153J46596_10000005365 | 973 |
| 321 | 3300005563 | Ga0068855_100000007 | Ga0068855_100000007180 | 973 |
| 322 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001366 | 973 |
| 323 | 3300025299 | Ga0209256_1000097 | Ga0209256_100009720 | 973 |
| 324 | 3300025949 | Ga0207667_10000038 | Ga0207667_10000038176 | 973 |
| 325 | 3300003773 | Ga0055537_1001433 | Ga0055537_10014333 | 974 |
| 326 | 3300003775 | Ga0055524_1000095 | Ga0055524_10000952 | 974 |
| 327 | 3300003794 | Ga0055531_10001916 | Ga0055531_100019169 | 974 |
| 328 | 3300005327 | Ga0070658_10000997 | Ga0070658_1000099711 | 974 |
| 329 | 3300005842 | Ga0068858_100000608 | Ga0068858_10000060823 | 974 |
| 330 | 3300009098 | Ga0105245_10001409 | Ga0105245_100014097 | 974 |
| 331 | 3300013307 | Ga0157372_10039265 | Ga0157372_100392653 | 974 |
| 332 | 3300025263 | Ga0209565_1000008 | Ga0209565_100000879 | 974 |
| 333 | 3300025273 | Ga0209673_1001402 | Ga0209673_10014028 | 974 |
| 334 | 3300025299 | Ga0209256_1000009 | Ga0209256_1000009792 | 974 |
| 335 | 3300025299 | Ga0209256_1000010 | Ga0209256_1000010716 | 974 |
| 336 | 3300025304 | Ga0209257_1003579 | Ga0209257_10035792 | 974 |
| 337 | 3300025904 | Ga0207647_10004083 | Ga0207647_100040832 | 974 |
| 338 | 3300025909 | Ga0207705_10000049 | Ga0207705_10000049130 | 974 |
| 339 | 3300026035 | Ga0207703_10000123 | Ga0207703_1000012385 | 974 |
| 340 | 3300044684 | Ga0466966_0003289 | Ga0466966_0003289_4624_7629 | 974 |
| 341 | 3300048925 | Ga0496122_0001697 | Ga0496122_0001697_24179_27124 | 974 |
| 342 | 3300048926 | Ga0496123_0001172 | Ga0496123_0001172_7275_10220 | 974 |
| 343 | 3300048927 | Ga0496124_0014393 | Ga0496124_0014393_2576_5521 | 974 |
| 344 | 3300003781 | Ga0055536_1000614 | Ga0055536_10006148 | 975 |
| 345 | 3300003791 | Ga0055530_10001919 | Ga0055530_100019192 | 975 |
| 346 | 3300025295 | Ga0209564_1000444 | Ga0209564_100044452 | 975 |
| 347 | 3300025303 | Ga0209051_1009013 | Ga0209051_10090132 | 975 |
| 348 | 3300025304 | Ga0209257_1006121 | Ga0209257_10061213 | 975 |
| 349 | 3300028794 | Ga0307515_10035278 | Ga0307515_100352783 | 975 |
| 350 | 3300041410 | Ga0439461_0001555 | Ga0439461_0001555_202_3195 | 975 |
| 351 | 3300041459 | Ga0451800_0972437 | Ga0451800_0972437_989_3937 | 975 |
| 352 | 3300041486 | Ga0451807_2635666 | Ga0451807_2635666_6013_8961 | 975 |
| 353 | 3300042006 | Ga0439432_000490 | Ga0439432_000490_720_3713 | 975 |
| 354 | 3300042015 | Ga0439462_0000345 | Ga0439462_0000345_5389_8382 | 975 |
| 355 | 3300046460 | Ga0495638_0000294 | Ga0495638_0000294_6589_9564 | 975 |
| 356 | 3300049459 | Ga0495678_000483 | Ga0495678_000483_12126_15101 | 975 |
| 357 | 3300053086 | Ga0500578_0000043 | Ga0500578_0000043_21307_24282 | 975 |
| 358 | 3300053118 | Ga0500594_0000030 | Ga0500594_0000030_23326_26301 | 975 |
| 359 | 3300001915 | JGI24741J21665_1000426 | JGI24741J21665_10004263 | 976 |
| 360 | 3300001979 | JGI24740J21852_10006425 | JGI24740J21852_100064253 | 976 |
| 361 | 3300003322 | rootL2_10017473 | rootL2_100174739 | 976 |
| 362 | 3300005327 | Ga0070658_10001963 | Ga0070658_1000196312 | 976 |
| 363 | 3300005339 | Ga0070660_100007482 | Ga0070660_1000074822 | 976 |
| 364 | 3300005344 | Ga0070661_100004712 | Ga0070661_1000047128 | 976 |
| 365 | 3300005456 | Ga0070678_100000008 | Ga0070678_10000000822 | 976 |
| 366 | 3300005834 | Ga0068851_10004689 | Ga0068851_100046893 | 976 |
| 367 | 3300009148 | Ga0105243_10000475 | Ga0105243_100004754 | 976 |
| 368 | 3300009174 | Ga0105241_10018109 | Ga0105241_100181092 | 976 |
| 369 | 3300013102 | Ga0157371_10000094 | Ga0157371_1000009458 | 976 |
| 370 | 3300025321 | Ga0207656_10003715 | Ga0207656_100037152 | 976 |
| 371 | 3300025901 | Ga0207688_10015724 | Ga0207688_100157241 | 976 |
| 372 | 3300025904 | Ga0207647_10004207 | Ga0207647_100042072 | 976 |
| 373 | 3300025909 | Ga0207705_10007510 | Ga0207705_100075103 | 976 |
| 374 | 3300025911 | Ga0207654_10000020 | Ga0207654_1000002020 | 976 |
| 375 | 3300025914 | Ga0207671_10023603 | Ga0207671_100236032 | 976 |
| 376 | 3300025919 | Ga0207657_10008244 | Ga0207657_100082449 | 976 |
| 377 | 3300025920 | Ga0207649_10009836 | Ga0207649_100098364 | 976 |
| 378 | 3300025924 | Ga0207694_10041828 | Ga0207694_100418282 | 976 |
| 379 | 3300025932 | Ga0207690_10004189 | Ga0207690_100041893 | 976 |
| 380 | 3300025933 | Ga0207706_10005052 | Ga0207706_100050529 | 976 |
| 381 | 3300025935 | Ga0207709_10000139 | Ga0207709_1000013922 | 976 |
| 382 | 3300025937 | Ga0207669_10001661 | Ga0207669_100016617 | 976 |
| 383 | 3300025949 | Ga0207667_10000006 | Ga0207667_1000000670 | 976 |
| 384 | 3300025949 | Ga0207667_10010760 | Ga0207667_100107609 | 976 |
| 385 | 3300025981 | Ga0207640_10004700 | Ga0207640_100047004 | 976 |
| 386 | 3300026041 | Ga0207639_10002766 | Ga0207639_100027662 | 976 |
| 387 | 3300026067 | Ga0207678_10004134 | Ga0207678_1000413411 | 976 |
| 388 | 3300026078 | Ga0207702_10002032 | Ga0207702_1000203216 | 976 |
| 389 | 3300026116 | Ga0207674_10010322 | Ga0207674_100103229 | 976 |
| 390 | 3300026142 | Ga0207698_10013641 | Ga0207698_100136414 | 976 |
| 391 | 3300041462 | Ga0451806_498691 | Ga0451806_498691_1537_4488 | 976 |
| 392 | 3300046524 | Ga0495648_0000263 | Ga0495648_0000263_9496_12426 | 976 |
| 393 | 3300046525 | Ga0495663_0001405 | Ga0495663_0001405_1493_4483 | 976 |
| 394 | 3300046558 | Ga0495633_0000024 | Ga0495633_0000024_130527_133490 | 976 |
| 395 | 3300048905 | Ga0496102_0000086 | Ga0496102_0000086_57536_60466 | 976 |
| 396 | 3300048906 | Ga0496103_0000055 | Ga0496103_0000055_21789_24719 | 976 |
| 397 | 3300048908 | Ga0496105_0000421 | Ga0496105_0000421_12808_15738 | 976 |
| 398 | 3300048913 | Ga0496110_0010167 | Ga0496110_0010167_2467_5397 | 976 |
| 399 | 3300048914 | Ga0496111_0017866 | Ga0496111_0017866_1494_4424 | 976 |
| 400 | 3300048918 | Ga0496115_0000099 | Ga0496115_0000099_21813_24743 | 976 |
| 401 | 3300048919 | Ga0496116_0002282 | Ga0496116_0002282_1511_4441 | 976 |
| 402 | 3300048920 | Ga0496117_0000175 | Ga0496117_0000175_71868_74798 | 976 |
| 403 | 3300048921 | Ga0496118_0000325 | Ga0496118_0000325_57549_60479 | 976 |
| 404 | 3300048922 | Ga0496119_0005730 | Ga0496119_0005730_1153_4083 | 976 |
| 405 | 3300048923 | Ga0496120_0027005 | Ga0496120_0027005_277_3207 | 976 |
| 406 | 3300048924 | Ga0496121_0000434 | Ga0496121_0000434_21785_24715 | 976 |
| 407 | 3300048926 | Ga0496123_0030545 | Ga0496123_0030545_641_3571 | 976 |
| 408 | 3300048927 | Ga0496124_0000367 | Ga0496124_0000367_21819_24749 | 976 |
| 409 | 3300048928 | Ga0496125_0045027 | Ga0496125_0045027_372_3302 | 976 |
| 410 | 3300048929 | Ga0496126_0000204 | Ga0496126_0000204_72046_74976 | 976 |
| 411 | 3300053130 | Ga0500642_0000192 | Ga0500642_0000192_15341_18271 | 976 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF13802
Gal_mutarotas_2
Glycosyl hydrolase 31 N-terminal galactose mutarotase-like domain
114
275
0.81
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b9y-assembly1.cif.gz_A | crystal structure of apo agd31b, alpha-transglucosylase in glycoside hydrolase family 31 | 0.8892 | 50 | 947 |
| 5i24-assembly1.cif.gz_A | crystal structure of agd31b, alpha-transglucosylase in glycoside hydrolase family 31, in complex with cyclophellitol aziridine probe cf021 | 0.8872 | 50 | 947 |
| 5npd-assembly1.cif.gz_A | crystal structure of d412n nucleophile mutant cjagd31b (alpha-transglucosylase from glycoside hydrolase family 31) in complex with alpha cyclophellitol aziridine probe cf021 | 0.8872 | 50 | 947 |
| 4ba0-assembly1.cif.gz_A-2 | crystal structure of agd31b, alpha-transglucosylase, complexed with 5f-alpha-glcf | 0.887 | 50 | 947 |
| 5zn7-assembly2.cif.gz_E | crystal structure of gh31 alpha-xylosidase from a soil metagenome complexed with xylose | 0.8782 | 52 | 860 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5npeA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9143 | 255 | 647 | 3.20.20.80 |
| 2xvkA03 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9125 | 273 | 617 | 3.20.20.80 |
| 5npeA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9119 | 255 | 647 | 3.20.20.80 |
| 5jouA01 | Mainly Beta;Sandwich;Immunoglobulin-like;glycosyl hydrolase (family 31) | 0.9089 | 44 | 269 | 2.60.40.1760 |
| 2xvlA05 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.8998 | 861 | 975 | 2.60.40.1180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353GKB2-F1-model_v4 | Glycoside hydrolase | 0.9789 | 22 | 667 |
GO:0004553
GO:0005975 GO:0030246 |
| AF-A0A520HWM5-F1-model_v4 | DUF5110 domain-containing protein | 0.9627 | 254 | 919 |
GO:0004553
GO:0005975 |
| AF-A0A353GKB2-F1-model_v4 | Glycoside hydrolase | 0.9568 | 22 | 667 |
GO:0004553
GO:0005975 GO:0030246 |
| AF-A0A662I7F6-F1-model_v4 | Alpha-xylosidase | 0.9546 | 91 | 976 |
GO:0004553
GO:0005975 GO:0030246 |
| AF-A7LRS4-F1-model_v4 | deleted | 0.9545 | 820 | 976 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar