F437387

General Info

Members Datasets Scaffolds Average Seq Length
410 209 820 375

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_20623_c1|nmdc:mga08x19_20623_c1_2786_4045
Length 419
Sequence VRPAFNAGPLGDDPFCSSDKGVSSGIDRERRSKSNLAGRVGQTRENMRRALVTGGAGLIGSHVADLLRVEKWKVRILDNLEPQTHRRGRPSWIGSDLEFIEGDLRDRKTMVAALEGVDVVFHQAAYGGYMPEIAKYVDVNSLGTAQMLEVIREEKLPIRKVIVASSQAVYSEGAGHCPEHGCVFPPVRPVEQLRQGDWQVHCPLCGAITTSVPTPESAPIGGETVYGLTKVDQEKLVLLWGKQIGIPTVALRYSCTYGPRQSIFNPYTGVIAIFCTRLLNNLPPVLYEDGKQTRDFSFVEDIARANLLAAETNQLDGLPVNVGSGKGVPIREVAEIISEALGIRIPPEMRGEFRPGEMRHLTSDNSRIGAAGYAPQVDLPAGISRYLEWIRKQTSVRDYFTEAAEILRHKGIIHPVEAK

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.83
Rhizosphere 91.46
Stem 0
Stem Tuber 0
Unclassified 22.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_20623_c1 3300050514 Bacteria 4058
2 CNAas_1000507 3300000532 Unclassified 3808
3 JGI25406J46586_10000296 3300003203 Bacteria 22317
4 rootH2_10110872 3300003320 Bacteria 2760
5 rootL2_10145840 3300003322 Bacteria 3896
6 JGI25405J52794_10000460 3300003911 Bacteria 5787
7 JGI25405J52794_10006012 3300003911 Unclassified 2209
8 Ga0065703_1020128 3300005272 Bacteria 2042
9 Ga0065704_10006255 3300005289 Bacteria 2607
10 Ga0065704_10117793 3300005289 Bacteria 1828
11 Ga0065712_10001105 3300005290 Bacteria 7079
12 Ga0065712_10138025 3300005290 Unclassified 1477
13 Ga0065715_10089669 3300005293 Bacteria 8998
14 Ga0065715_10095459 3300005293 Bacteria 4073
15 Ga0065715_10126683 3300005293 Bacteria 2089
16 Ga0065715_10157125 3300005293 Bacteria 1665
17 Ga0065707_10099401 3300005295 Bacteria 3009
18 Ga0070676_10001414 3300005328 Bacteria 12108
19 Ga0070676_10036807 3300005328 Unclassified 2820
20 Ga0070683_100008595 3300005329 Bacteria 8677
21 Ga0070690_100025069 3300005330 Unclassified 3671
22 Ga0068869_100105944 3300005334 Unclassified 2133
23 Ga0070666_10044606 3300005335 Bacteria 2970
24 Ga0068868_100035927 3300005338 Unclassified 3832
25 Ga0070660_100081102 3300005339 Bacteria 2547
26 Ga0070689_100002276 3300005340 Bacteria 12482
27 Ga0070689_100104077 3300005340 Bacteria 2250
28 Ga0070687_100011506 3300005343 Unclassified 3873
29 Ga0070668_100004349 3300005347 Bacteria 10507
30 Ga0070668_100024926 3300005347 Bacteria 4535
31 Ga0070669_100002218 3300005353 Bacteria 14061
32 Ga0070675_100003255 3300005354 Bacteria 12304
33 Ga0070675_100064583 3300005354 Bacteria 3026
34 Ga0070675_100233893 3300005354 Unclassified 1604
35 Ga0070675_100246758 3300005354 Unclassified 1561
36 Ga0070671_100060977 3300005355 Bacteria 3141
37 Ga0070671_100093456 3300005355 Bacteria 2520
38 Ga0070671_100096885 3300005355 Bacteria 2474
39 Ga0070671_100178573 3300005355 Bacteria 1797
40 Ga0070674_100096734 3300005356 Unclassified 2143
41 Ga0070673_100225281 3300005364 Bacteria 1625
42 Ga0070688_100052280 3300005365 Bacteria 2551
43 Ga0070688_100065000 3300005365 Bacteria 2317
44 Ga0070688_100114683 3300005365 Bacteria 1797
45 Ga0070659_100009156 3300005366 Bacteria 7264
46 Ga0070667_100008086 3300005367 Bacteria 8723
47 Ga0070667_100153190 3300005367 Bacteria 2026
48 Ga0070667_100157901 3300005367 Bacteria 1996
49 Ga0070709_10142800 3300005434 Bacteria 1646
50 Ga0070709_10187271 3300005434 Bacteria 1457
51 Ga0070714_100000139 3300005435 Bacteria 57645
52 Ga0070714_100050276 3300005435 Unclassified 3550
53 Ga0070713_100000323 3300005436 Bacteria 31221
54 Ga0070713_100010563 3300005436 Bacteria 6676
55 Ga0070713_100018693 3300005436 Bacteria 5270
56 Ga0070713_100028519 3300005436 Unclassified 4408
57 Ga0070713_100161974 3300005436 Unclassified 1998
58 Ga0070710_10042268 3300005437 Bacteria 2519
59 Ga0070711_100000273 3300005439 Bacteria 26748
60 Ga0070711_100066276 3300005439 Bacteria 2529
61 Ga0070705_100027782 3300005440 Unclassified 3092
62 Ga0070708_100003012 3300005445 Bacteria 13081
63 Ga0070708_100007184 3300005445 Bacteria 8896
64 Ga0070708_100094637 3300005445 Bacteria 2725
65 Ga0070708_100157082 3300005445 Bacteria 2118
66 Ga0070708_100280024 3300005445 Unclassified 1570
67 Ga0070663_100274361 3300005455 Bacteria 1342
68 Ga0070678_100037114 3300005456 Bacteria 3418
69 Ga0070678_100058442 3300005456 Bacteria 2830
70 Ga0070678_100109719 3300005456 Bacteria 2156
71 Ga0070662_100003072 3300005457 Bacteria 10365
72 Ga0070662_100210529 3300005457 Bacteria 1547
73 Ga0070685_10010551 3300005466 Bacteria 4803
74 Ga0070706_100001176 3300005467 Bacteria 28152
75 Ga0070706_100001265 3300005467 Bacteria 27038
76 Ga0070706_100002419 3300005467 Bacteria 18808
77 Ga0070706_100025363 3300005467 Bacteria 5454
78 Ga0070706_100042161 3300005467 Bacteria 4214
79 Ga0070706_100063793 3300005467 Unclassified 3404
80 Ga0070706_100164230 3300005467 Bacteria 2073
81 Ga0070706_100384630 3300005467 Bacteria 1307
82 Ga0070707_100000404 3300005468 Bacteria 42569
83 Ga0070707_100006630 3300005468 Bacteria 10735
84 Ga0070707_100012041 3300005468 Bacteria 8074
85 Ga0070707_100099626 3300005468 Bacteria 2815
86 Ga0070707_100138847 3300005468 Bacteria 2365
87 Ga0070707_100203473 3300005468 Bacteria 1930
88 Ga0070698_100000476 3300005471 Bacteria 42469
89 Ga0070698_100002315 3300005471 Bacteria 21073
90 Ga0070698_100009586 3300005471 Bacteria 10364
91 Ga0070698_100063201 3300005471 Unclassified 3733
92 Ga0070698_100065160 3300005471 Unclassified 3669
93 Ga0070698_100140306 3300005471 Unclassified 2368
94 Ga0070699_100021168 3300005518 Bacteria 5607
95 Ga0070699_100031157 3300005518 Bacteria 4605
96 Ga0070699_100034982 3300005518 Bacteria 4341
97 Ga0070699_100035468 3300005518 Bacteria 4311
98 Ga0070699_100156897 3300005518 Unclassified 2014
99 Ga0070699_100170420 3300005518 Unclassified 1929
100 Ga0070684_100003663 3300005535 Bacteria 11593
101 Ga0070684_100057853 3300005535 Bacteria 3386
102 Ga0070697_100000154 3300005536 Bacteria 55469
103 Ga0070697_100006985 3300005536 Bacteria 8778
104 Ga0070697_100010180 3300005536 Bacteria 7338
105 Ga0070697_100011414 3300005536 Bacteria 6944
106 Ga0070697_100013646 3300005536 Bacteria 6373
107 Ga0070697_100019680 3300005536 Bacteria 5332
108 Ga0070697_100028964 3300005536 Bacteria 4438
109 Ga0070697_100064573 3300005536 Bacteria 2990
110 Ga0070697_100070154 3300005536 Bacteria 2872
111 Ga0070697_100079171 3300005536 Unclassified 2705
112 Ga0070697_100283978 3300005536 Bacteria 1420
113 Ga0070672_100058570 3300005543 Unclassified 3028
114 Ga0070695_100062068 3300005545 Unclassified 2426
115 Ga0070665_100023357 3300005548 Bacteria 6224
116 Ga0070665_100069176 3300005548 Bacteria 3538
117 Ga0070665_100347860 3300005548 Unclassified 1487
118 Ga0070704_100026244 3300005549 Bacteria 3847
119 Ga0070664_100048822 3300005564 Bacteria 3578
120 Ga0070664_100200789 3300005564 Bacteria 1779
121 Ga0068856_100051566 3300005614 Bacteria 4056
122 Ga0068856_100080319 3300005614 Bacteria 3234
123 Ga0068856_100148631 3300005614 Bacteria 2351
124 Ga0068856_100251033 3300005614 Bacteria 1784
125 Ga0070702_100019428 3300005615 Unclassified 3544
126 Ga0068852_100102514 3300005616 Bacteria 2586
127 Ga0068863_100395722 3300005841 Unclassified 1351
128 Ga0068860_100006160 3300005843 Bacteria 12065
129 Ga0068862_100016584 3300005844 Bacteria 6135
130 Ga0081455_10000783 3300005937 Bacteria 40885
131 Ga0081455_10001671 3300005937 Bacteria 26899
132 Ga0081455_10011107 3300005937 Bacteria 9065
133 Ga0081455_10030973 3300005937 Unclassified 4848
134 Ga0081455_10107976 3300005937 Bacteria 2218
135 Ga0081538_10040416 3300005981 Bacteria 2975
136 Ga0081540_1000274 3300005983 Bacteria 53893
137 Ga0081539_10000153 3300005985 Bacteria 159919
138 Ga0070717_10002525 3300006028 Bacteria 12888
139 Ga0070717_10003970 3300006028 Bacteria 10649
140 Ga0070717_10022041 3300006028 Bacteria 5028
141 Ga0070717_10023763 3300006028 Bacteria 4861
142 Ga0070712_100001622 3300006175 Bacteria 13770
143 Ga0070712_100002036 3300006175 Bacteria 12392
144 Ga0070712_100158376 3300006175 Unclassified 1746
145 Ga0068871_100039476 3300006358 Bacteria 3777
146 Ga0075428_100056274 3300006844 Bacteria 4308
147 Ga0075430_100043341 3300006846 Bacteria 3802
148 Ga0075431_100128307 3300006847 Bacteria 2617
149 Ga0075431_100150740 3300006847 Bacteria 2394
150 Ga0075433_10050390 3300006852 Bacteria 3625
151 Ga0075434_100088288 3300006871 Bacteria 3102
152 Ga0075429_100052492 3300006880 Bacteria 3548
153 Ga0075436_100058538 3300006914 Bacteria 2661
154 Ga0075436_100077408 3300006914 Bacteria 2304
155 Ga0099794_10000338 3300007265 Bacteria 16048
156 Ga0099794_10009877 3300007265 Bacteria 4034
157 Ga0099794_10153787 3300007265 Bacteria 1168
158 Ga0105240_10432867 3300009093 Unclassified 1476
159 Ga0105245_10024444 3300009098 Bacteria 5305
160 Ga0105245_10059862 3300009098 Bacteria 3430
161 Ga0114129_10014885 3300009147 Bacteria 11081
162 Ga0114129_10063492 3300009147 Bacteria 5157
163 Ga0114129_10650023 3300009147 Unclassified 1361
164 Ga0105242_10062615 3300009176 Bacteria 3062
165 Ga0105242_10157455 3300009176 Unclassified 1985
166 Ga0105248_10380962 3300009177 Bacteria 1588
167 Ga0105238_10273810 3300009551 Bacteria 1669
168 Ga0105249_10001429 3300009553 Bacteria 20930
169 Ga0099796_10004228 3300010159 Unclassified 3447
170 Ga0105239_10002076 3300010375 Bacteria 25962
171 Ga0157373_10115413 3300013100 Bacteria 1888
172 Ga0157369_10003280 3300013105 Bacteria 19268
173 Ga0157374_10021207 3300013296 Bacteria 5776
174 Ga0157374_10077348 3300013296 Unclassified 3149
175 Ga0157374_10082627 3300013296 Bacteria 3050
176 Ga0157374_10082831 3300013296 Unclassified 3046
177 Ga0157374_10085080 3300013296 Bacteria 3006
178 Ga0157378_10017580 3300013297 Bacteria 6278
179 Ga0157378_10063008 3300013297 Bacteria 3312
180 Ga0157378_10070581 3300013297 Bacteria 3137
181 Ga0157378_10080675 3300013297 Bacteria 2940
182 Ga0157378_10113805 3300013297 Bacteria 2485
183 Ga0157378_10252612 3300013297 Unclassified 1688
184 Ga0163162_10003165 3300013306 Bacteria 15731
185 Ga0163162_10048864 3300013306 Unclassified 4239
186 Ga0163162_10281726 3300013306 Bacteria 1794
187 Ga0157372_10037437 3300013307 Bacteria 5352
188 Ga0157372_10203255 3300013307 Bacteria 2295
189 Ga0157375_10023510 3300013308 Bacteria 5688
190 Ga0157375_10041994 3300013308 Unclassified 4422
191 Ga0157375_10462913 3300013308 Unclassified 1433
192 Ga0182008_10051450 3300014497 Bacteria 2043
193 Ga0157379_10047956 3300014968 Bacteria 3813
194 Ga0157376_10009272 3300014969 Bacteria 7145
195 Ga0157376_10078696 3300014969 Bacteria 2824
196 Ga0157376_10316148 3300014969 Unclassified 1483
197 Ga0182005_1008636 3300015265 Bacteria 2994
198 Ga0163161_10011880 3300017792 Bacteria 6041
199 Ga0213876_10050200 3300021384 Bacteria 2204
200 Ga0207666_1000272 3300025271 Bacteria 7395
201 Ga0207697_10000377 3300025315 Bacteria 24951
202 Ga0207697_10000601 3300025315 Bacteria 20500
203 Ga0207697_10004084 3300025315 Bacteria 7059
204 Ga0207697_10004868 3300025315 Bacteria 6340
205 Ga0207697_10010490 3300025315 Unclassified 3958
206 Ga0207653_10025624 3300025885 Bacteria 1886
207 Ga0207688_10001637 3300025901 Bacteria 11824
208 Ga0207680_10028633 3300025903 Bacteria 3119
209 Ga0207699_10032332 3300025906 Unclassified 2947
210 Ga0207699_10046627 3300025906 Unclassified 2536
211 Ga0207699_10186619 3300025906 Bacteria 1397
212 Ga0207645_10000970 3300025907 Bacteria 23742
213 Ga0207645_10001686 3300025907 Bacteria 17955
214 Ga0207645_10051035 3300025907 Bacteria 2642
215 Ga0207684_10000616 3300025910 Bacteria 42382
216 Ga0207684_10000906 3300025910 Bacteria 33714
217 Ga0207684_10002514 3300025910 Bacteria 18442
218 Ga0207684_10006606 3300025910 Bacteria 10551
219 Ga0207684_10043619 3300025910 Unclassified 3803
220 Ga0207684_10070234 3300025910 Unclassified 2976
221 Ga0207684_10141380 3300025910 Bacteria 2069
222 Ga0207684_10172347 3300025910 Bacteria 1865
223 Ga0207684_10187199 3300025910 Unclassified 1785
224 Ga0207695_10331249 3300025913 Unclassified 1411
225 Ga0207693_10000894 3300025915 Bacteria 26741
226 Ga0207693_10009580 3300025915 Bacteria 7887
227 Ga0207693_10073669 3300025915 Unclassified 2673
228 Ga0207693_10121012 3300025915 Bacteria 2056
229 Ga0207693_10251812 3300025915 Unclassified 1386
230 Ga0207663_10005573 3300025916 Bacteria 6355
231 Ga0207663_10119280 3300025916 Bacteria 1803
232 Ga0207662_10000497 3300025918 Bacteria 17604
233 Ga0207662_10097563 3300025918 Bacteria 1817
234 Ga0207657_10118049 3300025919 Bacteria 2184
235 Ga0207649_10021390 3300025920 Bacteria 3723
236 Ga0207652_10052288 3300025921 Bacteria 3505
237 Ga0207646_10001759 3300025922 Bacteria 26257
238 Ga0207646_10002817 3300025922 Bacteria 20240
239 Ga0207646_10005571 3300025922 Bacteria 13221
240 Ga0207646_10031177 3300025922 Bacteria 4828
241 Ga0207646_10036546 3300025922 Unclassified 4433
242 Ga0207646_10039083 3300025922 Bacteria 4269
243 Ga0207646_10042138 3300025922 Unclassified 4102
244 Ga0207646_10045990 3300025922 Bacteria 3917
245 Ga0207646_10048165 3300025922 Unclassified 3821
246 Ga0207646_10053226 3300025922 Unclassified 3621
247 Ga0207646_10104002 3300025922 Unclassified 2547
248 Ga0207646_10124302 3300025922 Bacteria 2319
249 Ga0207646_10126486 3300025922 Bacteria 2298
250 Ga0207646_10191451 3300025922 Bacteria 1847
251 Ga0207646_10382549 3300025922 Bacteria 1271
252 Ga0207681_10001007 3300025923 Bacteria 18378
253 Ga0207659_10003627 3300025926 Bacteria 9298
254 Ga0207659_10021792 3300025926 Bacteria 4260
255 Ga0207659_10087758 3300025926 Bacteria 2316
256 Ga0207659_10089413 3300025926 Bacteria 2296
257 Ga0207687_10155956 3300025927 Bacteria 1747
258 Ga0207700_10000867 3300025928 Bacteria 17417
259 Ga0207700_10013978 3300025928 Bacteria 5247
260 Ga0207700_10022990 3300025928 Bacteria 4288
261 Ga0207700_10048852 3300025928 Unclassified 3144
262 Ga0207664_10000194 3300025929 Bacteria 45418
263 Ga0207664_10160215 3300025929 Bacteria 1919
264 Ga0207690_10018785 3300025932 Bacteria 4244
265 Ga0207706_10001348 3300025933 Bacteria 24536
266 Ga0207706_10020954 3300025933 Bacteria 5871
267 Ga0207706_10064702 3300025933 Bacteria 3220
268 Ga0207670_10008391 3300025936 Bacteria 5830
269 Ga0207670_10011867 3300025936 Bacteria 5074
270 Ga0207665_10044834 3300025939 Unclassified 2959
271 Ga0207665_10095603 3300025939 Bacteria 2065
272 Ga0207665_10126343 3300025939 Bacteria 1811
273 Ga0207691_10000134 3300025940 Bacteria 67672
274 Ga0207691_10009141 3300025940 Bacteria 9510
275 Ga0207689_10121472 3300025942 Unclassified 2148
276 Ga0207661_10020422 3300025944 Bacteria 4951
277 Ga0207661_10048492 3300025944 Unclassified 3376
278 Ga0207679_10150931 3300025945 Bacteria 1891
279 Ga0207651_10009663 3300025960 Bacteria 5299
280 Ga0207651_10095673 3300025960 Bacteria 2188
281 Ga0207712_10011298 3300025961 Bacteria 5684
282 Ga0207658_10006964 3300025986 Bacteria 7697
283 Ga0207677_10017343 3300026023 Bacteria 4290
284 Ga0207678_10277552 3300026067 Bacteria 1438
285 Ga0207702_10065533 3300026078 Bacteria 3111
286 Ga0207702_10359695 3300026078 Bacteria 1395
287 Ga0207676_10096650 3300026095 Unclassified 2439
288 Ga0207675_100378775 3300026118 Unclassified 1391
289 Ga0207683_10098115 3300026121 Bacteria 2614
290 Ga0209588_1000068 3300027671 Bacteria 35839
291 Ga0209588_1012782 3300027671 Bacteria 2553
292 Ga0268266_10036732 3300028379 Bacteria 4172
293 Ga0268266_10079455 3300028379 Unclassified 2856
294 Ga0268266_10312452 3300028379 Bacteria 1469
295 Ga0268264_10325366 3300028381 Unclassified 1455
296 Ga0265770_1001286 3300030878 Bacteria 3464
297 Ga0265760_10040468 3300031090 Bacteria 1388
298 Ga0307513_10009508 3300031456 Bacteria 12295
299 Ga0307513_10104790 3300031456 Bacteria 2840
300 Ga0307410_10072422 3300031852 Bacteria 2393
301 Ga0373923_0016536 3300035111 Bacteria 2805
302 Ga0373936_0005393 3300035113 Unclassified 4818
303 Ga0373945_0001366 3300035116 Bacteria 7420
304 Ga0373954_0025977 3300035118 Unclassified 2681
305 Ga0373943_0000003 3300035170 Bacteria 100827
306 Ga0373943_0012273 3300035170 Bacteria 3855
307 Ga0373943_0036649 3300035170 Bacteria 2350
308 Ga0373946_0002666 3300035171 Bacteria 6301
309 Ga0373955_0062164 3300035172 Unclassified 2064
310 Ga0373955_0068099 3300035172 Bacteria 1983
311 Ga0373935_0015664 3300035692 Bacteria 4585
312 Ga0373927_0000154 3300035695 Bacteria 53862
313 Ga0373927_0129866 3300035695 Bacteria 1646
314 Ga0373933_0056547 3300035724 Bacteria 2355
315 Ga0373947_0000762 3300035725 Bacteria 19292
316 Ga0373947_0008478 3300035725 Bacteria 5920
317 Ga0373947_0030170 3300035725 Bacteria 3185
318 Ga0373947_0030601 3300035725 Unclassified 3164
319 Ga0373947_0035371 3300035725 Bacteria 2957
320 Ga0373947_0076967 3300035725 Bacteria 2057
321 Ga0373937_0040033 3300036401 Bacteria 4272
322 Ga0373937_0076490 3300036401 Bacteria 3091
323 Ga0373937_0081619 3300036401 Unclassified 2991
324 Ga0373937_0188835 3300036401 Bacteria 1936
325 Ga0373925_0296845 3300037068 Unclassified 1304
326 Ga0395900_0001386 3300037418 Bacteria 29085
327 Ga0395900_0129123 3300037418 Bacteria 2591
328 Ga0395900_0166876 3300037418 Unclassified 2243
329 Ga0395898_0187779 3300037466 Bacteria 1975
330 Ga0395898_0263279 3300037466 Bacteria 1645
331 Ga0395905_0018086 3300037471 Bacteria 6691
332 Ga0436364_0264508 3300037853 Bacteria 4978
333 Ga0395901_0001064 3300038443 Bacteria 29476
334 Ga0395901_0060637 3300038443 Unclassified 3937
335 Ga0395901_0126292 3300038443 Bacteria 2688
336 Ga0395901_0140523 3300038443 Bacteria 2538
337 Ga0436365_0046803 3300039437 Bacteria 2192
338 Ga0436360_0539474 3300039438 Unclassified 2378
339 Ga0436360_0770276 3300039438 Bacteria 2437
340 Ga0436361_0287987 3300039447 Bacteria 15039
341 Ga0436361_1040208 3300039447 Bacteria 4069
342 Ga0436362_0279506 3300039453 Unclassified 3375
343 Ga0436362_0992154 3300039453 Bacteria 3784
344 Ga0439455_0000672 3300042012 Bacteria 5031
345 Ga0439458_0023743 3300042157 Bacteria 1431
346 Ga0451576_0035168 3300045051 Bacteria 5316
347 Ga0466967_0013292 3300045976 Bacteria 6354
348 Ga0495592_0027426 3300046454 Bacteria 4318
349 Ga0495651_0090896 3300046462 Bacteria 2289
350 Ga0495653_0194771 3300046463 Bacteria 1380
351 Ga0495580_0154617 3300046472 Bacteria 1589
352 Ga0495664_0068445 3300046477 Bacteria 2118
353 Ga0495584_0072569 3300046491 Bacteria 1730
354 Ga0495585_0147885 3300046492 Bacteria 1227
355 Ga0495628_0043064 3300046516 Unclassified 3598
356 Ga0495630_0060672 3300046517 Unclassified 2839
357 Ga0495586_0015915 3300046535 Unclassified 4002
358 Ga0495598_0006906 3300046537 Bacteria 2580
359 Ga0495623_0016637 3300046679 Bacteria 4749
360 Ga0495646_0081112 3300046680 Bacteria 1891
361 Ga0495658_0133366 3300046683 Bacteria 1514
362 Ga0495624_0047171 3300046690 Bacteria 2737
363 Ga0495600_0231747 3300046809 Unclassified 1179
364 Ga0495674_0003841 3300047319 Bacteria 14590
365 Ga0495674_0178716 3300047319 Unclassified 1768
366 Ga0495672_0012321 3300047320 Bacteria 5975
367 Ga0495675_0120641 3300047444 Unclassified 1633
368 Ga0495684_0008555 3300047471 Bacteria 7924
369 Ga0495686_0019939 3300047472 Bacteria 4475
370 Ga0495602_0200266 3300048088 Bacteria 1524
371 Ga0496100_0036181 3300048903 Unclassified 3111
372 Ga0496101_0014648 3300048904 Bacteria 5273
373 Ga0496101_0060733 3300048904 Bacteria 2744
374 Ga0496104_0127706 3300048907 Bacteria 2441
375 Ga0496104_0182696 3300048907 Bacteria 2008
376 Ga0496105_0015477 3300048908 Bacteria 6081
377 Ga0496105_0039512 3300048908 Bacteria 3889
378 Ga0496105_0139604 3300048908 Bacteria 1995
379 Ga0496106_0100349 3300048909 Unclassified 2245
380 Ga0496107_0035931 3300048910 Unclassified 3553
381 Ga0496108_0061686 3300048911 Unclassified 3156
382 Ga0496108_0133722 3300048911 Bacteria 2132
383 Ga0496109_0020767 3300048912 Bacteria 5801
384 Ga0496109_0037748 3300048912 Unclassified 4365
385 Ga0496109_0099737 3300048912 Unclassified 2694
386 Ga0496109_0125983 3300048912 Bacteria 2388
387 Ga0496109_0362142 3300048912 Bacteria 1370
388 Ga0496110_0120633 3300048913 Unclassified 2362
389 Ga0496112_0023749 3300048915 Bacteria 5865
390 Ga0496112_0033624 3300048915 Bacteria 4985
391 Ga0496112_0072036 3300048915 Unclassified 3415
392 Ga0496112_0079738 3300048915 Bacteria 3238
393 Ga0496112_0185763 3300048915 Bacteria 2042
394 Ga0496112_0291013 3300048915 Bacteria 1579
395 Ga0496113_0036854 3300048916 Unclassified 3585
396 Ga0496114_0147342 3300048917 Bacteria 2041
397 Ga0496115_0021751 3300048918 Unclassified 4958
398 Ga0496115_0076400 3300048918 Unclassified 2722
399 Ga0501046_0108761 3300049580 Bacteria 2120
400 Ga0501075_0125093 3300049591 Bacteria 1957
401 nmdc:mga05p37_183429_c1 3300050507 Bacteria 2545
402 nmdc:mga05p37_28612_c1 3300050507 Bacteria 6797
403 nmdc:mga05p37_90190_c1 3300050507 Bacteria 3778
404 nmdc:mga0qj67_2529_c1 3300050509 Bacteria 13059
405 nmdc:mga06r32_25156_c1 3300050510 Bacteria 5534
406 nmdc:mga06r32_5121_c1 3300050510 Bacteria 11789
407 nmdc:mga08y16_492704_c1 3300050511 Unclassified 1246
408 nmdc:mga0a205_41716_c1 3300050515 Bacteria 4420
409 Ga0495601_0074211 3300053077 Bacteria 2176
410 Ga0495619_0165408 3300053085 Bacteria 1529
411 nmdc:mga08x19_20623_c1
412 CNAas_1000507
413 JGI25406J46586_10000296
414 rootH2_10110872
415 rootL2_10145840
416 JGI25405J52794_10000460
417 JGI25405J52794_10006012
418 Ga0065703_1020128
419 Ga0065704_10006255
420 Ga0065704_10117793
421 Ga0065712_10001105
422 Ga0065712_10138025
423 Ga0065715_10089669
424 Ga0065715_10095459
425 Ga0065715_10126683
426 Ga0065715_10157125
427 Ga0065707_10099401
428 Ga0070676_10001414
429 Ga0070676_10036807
430 Ga0070683_100008595
431 Ga0070690_100025069
432 Ga0068869_100105944
433 Ga0070666_10044606
434 Ga0068868_100035927
435 Ga0070660_100081102
436 Ga0070689_100002276
437 Ga0070689_100104077
438 Ga0070687_100011506
439 Ga0070668_100004349
440 Ga0070668_100024926
441 Ga0070669_100002218
442 Ga0070675_100003255
443 Ga0070675_100064583
444 Ga0070675_100233893
445 Ga0070675_100246758
446 Ga0070671_100060977
447 Ga0070671_100093456
448 Ga0070671_100096885
449 Ga0070671_100178573
450 Ga0070674_100096734
451 Ga0070673_100225281
452 Ga0070688_100052280
453 Ga0070688_100065000
454 Ga0070688_100114683
455 Ga0070659_100009156
456 Ga0070667_100008086
457 Ga0070667_100153190
458 Ga0070667_100157901
459 Ga0070709_10142800
460 Ga0070709_10187271
461 Ga0070714_100000139
462 Ga0070714_100050276
463 Ga0070713_100000323
464 Ga0070713_100010563
465 Ga0070713_100018693
466 Ga0070713_100028519
467 Ga0070713_100161974
468 Ga0070710_10042268
469 Ga0070711_100000273
470 Ga0070711_100066276
471 Ga0070705_100027782
472 Ga0070708_100003012
473 Ga0070708_100007184
474 Ga0070708_100094637
475 Ga0070708_100157082
476 Ga0070708_100280024
477 Ga0070663_100274361
478 Ga0070678_100037114
479 Ga0070678_100058442
480 Ga0070678_100109719
481 Ga0070662_100003072
482 Ga0070662_100210529
483 Ga0070685_10010551
484 Ga0070706_100001176
485 Ga0070706_100001265
486 Ga0070706_100002419
487 Ga0070706_100025363
488 Ga0070706_100042161
489 Ga0070706_100063793
490 Ga0070706_100164230
491 Ga0070706_100384630
492 Ga0070707_100000404
493 Ga0070707_100006630
494 Ga0070707_100012041
495 Ga0070707_100099626
496 Ga0070707_100138847
497 Ga0070707_100203473
498 Ga0070698_100000476
499 Ga0070698_100002315
500 Ga0070698_100009586
501 Ga0070698_100063201
502 Ga0070698_100065160
503 Ga0070698_100140306
504 Ga0070699_100021168
505 Ga0070699_100031157
506 Ga0070699_100034982
507 Ga0070699_100035468
508 Ga0070699_100156897
509 Ga0070699_100170420
510 Ga0070684_100003663
511 Ga0070684_100057853
512 Ga0070697_100000154
513 Ga0070697_100006985
514 Ga0070697_100010180
515 Ga0070697_100011414
516 Ga0070697_100013646
517 Ga0070697_100019680
518 Ga0070697_100028964
519 Ga0070697_100064573
520 Ga0070697_100070154
521 Ga0070697_100079171
522 Ga0070697_100283978
523 Ga0070672_100058570
524 Ga0070695_100062068
525 Ga0070665_100023357
526 Ga0070665_100069176
527 Ga0070665_100347860
528 Ga0070704_100026244
529 Ga0070664_100048822
530 Ga0070664_100200789
531 Ga0068856_100051566
532 Ga0068856_100080319
533 Ga0068856_100148631
534 Ga0068856_100251033
535 Ga0070702_100019428
536 Ga0068852_100102514
537 Ga0068863_100395722
538 Ga0068860_100006160
539 Ga0068862_100016584
540 Ga0081455_10000783
541 Ga0081455_10001671
542 Ga0081455_10011107
543 Ga0081455_10030973
544 Ga0081455_10107976
545 Ga0081538_10040416
546 Ga0081540_1000274
547 Ga0081539_10000153
548 Ga0070717_10002525
549 Ga0070717_10003970
550 Ga0070717_10022041
551 Ga0070717_10023763
552 Ga0070712_100001622
553 Ga0070712_100002036
554 Ga0070712_100158376
555 Ga0068871_100039476
556 Ga0075428_100056274
557 Ga0075430_100043341
558 Ga0075431_100128307
559 Ga0075431_100150740
560 Ga0075433_10050390
561 Ga0075434_100088288
562 Ga0075429_100052492
563 Ga0075436_100058538
564 Ga0075436_100077408
565 Ga0099794_10000338
566 Ga0099794_10009877
567 Ga0099794_10153787
568 Ga0105240_10432867
569 Ga0105245_10024444
570 Ga0105245_10059862
571 Ga0114129_10014885
572 Ga0114129_10063492
573 Ga0114129_10650023
574 Ga0105242_10062615
575 Ga0105242_10157455
576 Ga0105248_10380962
577 Ga0105238_10273810
578 Ga0105249_10001429
579 Ga0099796_10004228
580 Ga0105239_10002076
581 Ga0157373_10115413
582 Ga0157369_10003280
583 Ga0157374_10021207
584 Ga0157374_10077348
585 Ga0157374_10082627
586 Ga0157374_10082831
587 Ga0157374_10085080
588 Ga0157378_10017580
589 Ga0157378_10063008
590 Ga0157378_10070581
591 Ga0157378_10080675
592 Ga0157378_10113805
593 Ga0157378_10252612
594 Ga0163162_10003165
595 Ga0163162_10048864
596 Ga0163162_10281726
597 Ga0157372_10037437
598 Ga0157372_10203255
599 Ga0157375_10023510
600 Ga0157375_10041994
601 Ga0157375_10462913
602 Ga0182008_10051450
603 Ga0157379_10047956
604 Ga0157376_10009272
605 Ga0157376_10078696
606 Ga0157376_10316148
607 Ga0182005_1008636
608 Ga0163161_10011880
609 Ga0213876_10050200
610 Ga0207666_1000272
611 Ga0207697_10000377
612 Ga0207697_10000601
613 Ga0207697_10004084
614 Ga0207697_10004868
615 Ga0207697_10010490
616 Ga0207653_10025624
617 Ga0207688_10001637
618 Ga0207680_10028633
619 Ga0207699_10032332
620 Ga0207699_10046627
621 Ga0207699_10186619
622 Ga0207645_10000970
623 Ga0207645_10001686
624 Ga0207645_10051035
625 Ga0207684_10000616
626 Ga0207684_10000906
627 Ga0207684_10002514
628 Ga0207684_10006606
629 Ga0207684_10043619
630 Ga0207684_10070234
631 Ga0207684_10141380
632 Ga0207684_10172347
633 Ga0207684_10187199
634 Ga0207695_10331249
635 Ga0207693_10000894
636 Ga0207693_10009580
637 Ga0207693_10073669
638 Ga0207693_10121012
639 Ga0207693_10251812
640 Ga0207663_10005573
641 Ga0207663_10119280
642 Ga0207662_10000497
643 Ga0207662_10097563
644 Ga0207657_10118049
645 Ga0207649_10021390
646 Ga0207652_10052288
647 Ga0207646_10001759
648 Ga0207646_10002817
649 Ga0207646_10005571
650 Ga0207646_10031177
651 Ga0207646_10036546
652 Ga0207646_10039083
653 Ga0207646_10042138
654 Ga0207646_10045990
655 Ga0207646_10048165
656 Ga0207646_10053226
657 Ga0207646_10104002
658 Ga0207646_10124302
659 Ga0207646_10126486
660 Ga0207646_10191451
661 Ga0207646_10382549
662 Ga0207681_10001007
663 Ga0207659_10003627
664 Ga0207659_10021792
665 Ga0207659_10087758
666 Ga0207659_10089413
667 Ga0207687_10155956
668 Ga0207700_10000867
669 Ga0207700_10013978
670 Ga0207700_10022990
671 Ga0207700_10048852
672 Ga0207664_10000194
673 Ga0207664_10160215
674 Ga0207690_10018785
675 Ga0207706_10001348
676 Ga0207706_10020954
677 Ga0207706_10064702
678 Ga0207670_10008391
679 Ga0207670_10011867
680 Ga0207665_10044834
681 Ga0207665_10095603
682 Ga0207665_10126343
683 Ga0207691_10000134
684 Ga0207691_10009141
685 Ga0207689_10121472
686 Ga0207661_10020422
687 Ga0207661_10048492
688 Ga0207679_10150931
689 Ga0207651_10009663
690 Ga0207651_10095673
691 Ga0207712_10011298
692 Ga0207658_10006964
693 Ga0207677_10017343
694 Ga0207678_10277552
695 Ga0207702_10065533
696 Ga0207702_10359695
697 Ga0207676_10096650
698 Ga0207675_100378775
699 Ga0207683_10098115
700 Ga0209588_1000068
701 Ga0209588_1012782
702 Ga0268266_10036732
703 Ga0268266_10079455
704 Ga0268266_10312452
705 Ga0268264_10325366
706 Ga0265770_1001286
707 Ga0265760_10040468
708 Ga0307513_10009508
709 Ga0307513_10104790
710 Ga0307410_10072422
711 Ga0373923_0016536
712 Ga0373936_0005393
713 Ga0373945_0001366
714 Ga0373954_0025977
715 Ga0373943_0000003
716 Ga0373943_0012273
717 Ga0373943_0036649
718 Ga0373946_0002666
719 Ga0373955_0062164
720 Ga0373955_0068099
721 Ga0373935_0015664
722 Ga0373927_0000154
723 Ga0373927_0129866
724 Ga0373933_0056547
725 Ga0373947_0000762
726 Ga0373947_0008478
727 Ga0373947_0030170
728 Ga0373947_0030601
729 Ga0373947_0035371
730 Ga0373947_0076967
731 Ga0373937_0040033
732 Ga0373937_0076490
733 Ga0373937_0081619
734 Ga0373937_0188835
735 Ga0373925_0296845
736 Ga0395900_0001386
737 Ga0395900_0129123
738 Ga0395900_0166876
739 Ga0395898_0187779
740 Ga0395898_0263279
741 Ga0395905_0018086
742 Ga0436364_0264508
743 Ga0395901_0001064
744 Ga0395901_0060637
745 Ga0395901_0126292
746 Ga0395901_0140523
747 Ga0436365_0046803
748 Ga0436360_0539474
749 Ga0436360_0770276
750 Ga0436361_0287987
751 Ga0436361_1040208
752 Ga0436362_0279506
753 Ga0436362_0992154
754 Ga0439455_0000672
755 Ga0439458_0023743
756 Ga0451576_0035168
757 Ga0466967_0013292
758 Ga0495592_0027426
759 Ga0495651_0090896
760 Ga0495653_0194771
761 Ga0495580_0154617
762 Ga0495664_0068445
763 Ga0495584_0072569
764 Ga0495585_0147885
765 Ga0495628_0043064
766 Ga0495630_0060672
767 Ga0495586_0015915
768 Ga0495598_0006906
769 Ga0495623_0016637
770 Ga0495646_0081112
771 Ga0495658_0133366
772 Ga0495624_0047171
773 Ga0495600_0231747
774 Ga0495674_0003841
775 Ga0495674_0178716
776 Ga0495672_0012321
777 Ga0495675_0120641
778 Ga0495684_0008555
779 Ga0495686_0019939
780 Ga0495602_0200266
781 Ga0496100_0036181
782 Ga0496101_0014648
783 Ga0496101_0060733
784 Ga0496104_0127706
785 Ga0496104_0182696
786 Ga0496105_0015477
787 Ga0496105_0039512
788 Ga0496105_0139604
789 Ga0496106_0100349
790 Ga0496107_0035931
791 Ga0496108_0061686
792 Ga0496108_0133722
793 Ga0496109_0020767
794 Ga0496109_0037748
795 Ga0496109_0099737
796 Ga0496109_0125983
797 Ga0496109_0362142
798 Ga0496110_0120633
799 Ga0496112_0023749
800 Ga0496112_0033624
801 Ga0496112_0072036
802 Ga0496112_0079738
803 Ga0496112_0185763
804 Ga0496112_0291013
805 Ga0496113_0036854
806 Ga0496114_0147342
807 Ga0496115_0021751
808 Ga0496115_0076400
809 Ga0501046_0108761
810 Ga0501075_0125093
811 nmdc:mga05p37_183429_c1
812 nmdc:mga05p37_28612_c1
813 nmdc:mga05p37_90190_c1
814 nmdc:mga0qj67_2529_c1
815 nmdc:mga06r32_25156_c1
816 nmdc:mga06r32_5121_c1
817 nmdc:mga08y16_492704_c1
818 nmdc:mga0a205_41716_c1
819 Ga0495601_0074211
820 Ga0495619_0165408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

204

323

0.88

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

51

182

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

50

192

0.84

PF05368

NmrA

NmrA-like family

50

138

0.83

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

51

176

0.82

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

50

173

0.8

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

206

386

0.79

PF07993

NAD_binding_4

Male sterility protein

52

294

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kvc-assembly1.cif.gz_A-2 moee5 in complex with udp-glucose and nad 0.9122 1 344
6kv9-assembly1.cif.gz_A-2 moee5 in complex with udp-glucuronic acid and nad 0.9057 1 344
6zla-assembly2.cif.gz_C crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with nad 0.9055 1 344
6kvc-assembly1.cif.gz_A-2 moee5 in complex with udp-glucose and nad 0.8976 1 344
6wjb-assembly1.cif.gz_A udp-glcnac c4-epimerase from pseudomonas protegens in complex with nad and udp-glcnac 0.8972 1 341
ID Description Score Start End Superfamily
af_L7N670_2_342_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9197 1 340 3.40.50.720
af_L7N670_2_342_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9145 1 340 3.40.50.720
af_P72050_1_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9094 1 348 3.40.50.720
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9069 2 345 3.40.50.720
af_P72050_1_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9012 1 348 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V5PH15-F1-model_v4 Epimerase 0.996 2 371
AF-A0A2V6H013-F1-model_v4 Epimerase 0.9855 226 371
AF-A0A2V5PH15-F1-model_v4 Epimerase 0.9854 2 371
AF-A0A3D2Z152-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9805 2 371
AF-A0A842TIC4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9803 2 343

Map