F437245

General Info

Members Datasets Scaffolds Average Seq Length
410 246 820 130

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10869688|Ga0157370_108696881
Length 140
Sequence VLELAMFDQTPEDGGHGRLPSLNVLGGPLLPCSAVPLTGFYRDGCCNTGREDAGLHTVCAVMTAEFLDFSKARGNDLSTPMPAYGFAGLKPGDRWCLCAARWKEAFEAGSAPQVVLEATHAVTLQIVSLDDLKRHAVRLQ

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
72 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
229 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
230 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
236 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
237 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
238 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
239 2643221584 Caulobacter sp. Root656 Isolate Unclassified
240 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
241 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
242 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
243 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
244 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
245 2818991435 Caulobacter henricii 536 Isolate Unclassified
246 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 0.24
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 6.1
Rhizosphere 87.07
Stem 0
Stem Tuber 0
Unclassified 1.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10869688 3300013104 Bacteria 819
2 Ga0065715_10919298 3300005293 Bacteria 569
3 Ga0070658_10063306 3300005327 Bacteria 3015
4 Ga0070676_10330085 3300005328 Unclassified 1043
5 Ga0070690_100875579 3300005330 Bacteria 701
6 Ga0070666_10122346 3300005335 Bacteria 1805
7 Ga0070666_10185027 3300005335 Bacteria 1462
8 Ga0070680_100019671 3300005336 Bacteria 5355
9 Ga0068868_101122391 3300005338 Bacteria 724
10 Ga0070689_100406608 3300005340 Bacteria 1152
11 Ga0070689_100553158 3300005340 Bacteria 992
12 Ga0070691_10015786 3300005341 Bacteria 3471
13 Ga0070691_10584883 3300005341 Bacteria 657
14 Ga0070687_100404425 3300005343 Bacteria 896
15 Ga0070692_10140788 3300005345 Bacteria 1365
16 Ga0070668_101107302 3300005347 Unclassified 715
17 Ga0070675_100526987 3300005354 Bacteria 1067
18 Ga0070675_100597163 3300005354 Bacteria 1001
19 Ga0070671_100033564 3300005355 Bacteria 4246
20 Ga0070671_100046683 3300005355 Bacteria 3602
21 Ga0070671_100290593 3300005355 Bacteria 1391
22 Ga0070671_100294386 3300005355 Bacteria 1381
23 Ga0070674_100139836 3300005356 Bacteria 1816
24 Ga0070673_100095234 3300005364 Bacteria 2442
25 Ga0070673_100581820 3300005364 Bacteria 1020
26 Ga0070673_102415362 3300005364 Bacteria 500
27 Ga0070659_100207554 3300005366 Bacteria 1614
28 Ga0070667_100000115 3300005367 Bacteria 102912
29 Ga0070667_100562671 3300005367 Bacteria 1049
30 Ga0070667_100759526 3300005367 Bacteria 899
31 Ga0070701_10371563 3300005438 Bacteria 899
32 Ga0070701_10450743 3300005438 Bacteria 826
33 Ga0070701_10606382 3300005438 Bacteria 726
34 Ga0070711_100109316 3300005439 Bacteria 2026
35 Ga0070705_100140475 3300005440 Bacteria 1589
36 Ga0070700_100158234 3300005441 Bacteria 1557
37 Ga0070700_100427770 3300005441 Bacteria 1002
38 Ga0070700_101292924 3300005441 Bacteria 613
39 Ga0070694_100035816 3300005444 Bacteria 3284
40 Ga0070708_100800051 3300005445 Bacteria 886
41 Ga0070663_100346197 3300005455 Bacteria 1202
42 Ga0070678_100067192 3300005456 Bacteria 2667
43 Ga0070678_100561250 3300005456 Bacteria 1015
44 Ga0070678_100834166 3300005456 Bacteria 839
45 Ga0070662_100029607 3300005457 Bacteria 3823
46 Ga0070662_100048328 3300005457 Bacteria 3065
47 Ga0070681_10011836 3300005458 Bacteria 8649
48 Ga0068867_100352183 3300005459 Bacteria 1229
49 Ga0068867_100959439 3300005459 Bacteria 773
50 Ga0070679_100008662 3300005530 Bacteria 9586
51 Ga0070679_100599294 3300005530 Bacteria 1045
52 Ga0068853_100361218 3300005539 Bacteria 1353
53 Ga0068853_101346910 3300005539 Bacteria 690
54 Ga0070672_100086569 3300005543 Bacteria 2520
55 Ga0070695_100069440 3300005545 Bacteria 2303
56 Ga0070696_100088638 3300005546 Bacteria 2199
57 Ga0070665_100058611 3300005548 Bacteria 3860
58 Ga0070665_100060881 3300005548 Bacteria 3784
59 Ga0068855_100009168 3300005563 Bacteria 11950
60 Ga0068855_100576275 3300005563 Bacteria 1216
61 Ga0070664_100717514 3300005564 Bacteria 932
62 Ga0068857_100155311 3300005577 Bacteria 2075
63 Ga0068854_100218379 3300005578 Bacteria 1507
64 Ga0068854_100602707 3300005578 Bacteria 938
65 Ga0068854_100820909 3300005578 Bacteria 812
66 Ga0068856_100143336 3300005614 Bacteria 2397
67 Ga0068856_100254821 3300005614 Bacteria 1770
68 Ga0070702_100218912 3300005615 Bacteria 1272
69 Ga0070702_100652265 3300005615 Bacteria 796
70 Ga0068852_101580779 3300005616 Bacteria 678
71 Ga0068859_100102439 3300005617 Bacteria 2920
72 Ga0068859_100222071 3300005617 Bacteria 1977
73 Ga0068859_102569138 3300005617 Bacteria 560
74 Ga0068864_100005795 3300005618 Bacteria 10135
75 Ga0068864_100416554 3300005618 Unclassified 1279
76 Ga0068866_11352620 3300005718 Bacteria 519
77 Ga0068861_100072619 3300005719 Bacteria 2670
78 Ga0068861_100615236 3300005719 Bacteria 999
79 Ga0068863_100661197 3300005841 Bacteria 1037
80 Ga0068863_100748877 3300005841 Bacteria 973
81 Ga0068863_100824183 3300005841 Bacteria 926
82 Ga0068858_100744127 3300005842 Bacteria 955
83 Ga0068860_100019837 3300005843 Bacteria 6519
84 Ga0068862_100182033 3300005844 Bacteria 1886
85 Ga0081455_10001698 3300005937 Bacteria 26658
86 Ga0075362_10107458 3300006177 Bacteria 1311
87 Ga0075366_10012744 3300006195 Bacteria 4776
88 Ga0097621_101892625 3300006237 Bacteria 569
89 Ga0068865_100698475 3300006881 Bacteria 867
90 Ga0068865_101393792 3300006881 Bacteria 626
91 Ga0097620_100102437 3300006931 Bacteria 2920
92 Ga0097620_100222060 3300006931 Bacteria 1977
93 Ga0097620_102569012 3300006931 Bacteria 560
94 Ga0105250_10144374 3300009092 Bacteria 988
95 Ga0105240_10003020 3300009093 Bacteria 26469
96 Ga0105240_10006208 3300009093 Bacteria 17574
97 Ga0111539_10068471 3300009094 Bacteria 4191
98 Ga0111539_10569031 3300009094 Bacteria 1320
99 Ga0105245_10040371 3300009098 Bacteria 4157
100 Ga0105247_10006836 3300009101 Bacteria 7030
101 Ga0114129_10098589 3300009147 Bacteria 4045
102 Ga0114129_10228144 3300009147 Bacteria 2509
103 Ga0105243_10137779 3300009148 Bacteria 2078
104 Ga0105243_10238489 3300009148 Bacteria 1617
105 Ga0105243_10383259 3300009148 Bacteria 1301
106 Ga0105248_10857120 3300009177 Bacteria 1026
107 Ga0105237_10153651 3300009545 Bacteria 2298
108 Ga0105237_11872428 3300009545 Bacteria 608
109 Ga0105238_10862550 3300009551 Bacteria 923
110 Ga0105249_10079471 3300009553 Bacteria 3044
111 Ga0105249_10837639 3300009553 Unclassified 985
112 Ga0105249_10876239 3300009553 Bacteria 964
113 Ga0105239_10391867 3300010375 Bacteria 1571
114 Ga0105239_10860435 3300010375 Bacteria 1040
115 Ga0105239_13030494 3300010375 Bacteria 547
116 Ga0105246_10199708 3300011119 Bacteria 1554
117 Ga0157337_1038295 3300012483 Bacteria 520
118 Ga0157338_1066559 3300012515 Bacteria 553
119 Ga0157370_10081370 3300013104 Bacteria 3047
120 Ga0157369_10677268 3300013105 Bacteria 1063
121 Ga0157374_10284761 3300013296 Bacteria 1632
122 Ga0157378_10013740 3300013297 Bacteria 7081
123 Ga0163162_10749245 3300013306 Bacteria 1096
124 Ga0163162_10874889 3300013306 Bacteria 1013
125 Ga0163162_11145766 3300013306 Bacteria 882
126 Ga0157372_10568914 3300013307 Bacteria 1321
127 Ga0157372_10982509 3300013307 Bacteria 978
128 Ga0157375_10086860 3300013308 Bacteria 3179
129 Ga0157375_10350180 3300013308 Bacteria 1643
130 Ga0157375_11488387 3300013308 Bacteria 799
131 Ga0163163_10051160 3300014325 Bacteria 4073
132 Ga0157380_10182692 3300014326 Bacteria 1844
133 Ga0157380_10383842 3300014326 Bacteria 1327
134 Ga0157377_10961180 3300014745 Bacteria 644
135 Ga0157379_10013773 3300014968 Bacteria 7086
136 Ga0157379_10382017 3300014968 Bacteria 1292
137 Ga0206356_10621627 3300020070 Bacteria 863
138 Ga0209758_1123752 3300025297 Bacteria 694
139 Ga0207426_1007137 3300025302 Bacteria 4718
140 Ga0207710_10048793 3300025900 Bacteria 1895
141 Ga0207680_10102063 3300025903 Bacteria 1845
142 Ga0207680_10118976 3300025903 Bacteria 1725
143 Ga0207645_10178496 3300025907 Bacteria 1393
144 Ga0207705_10008414 3300025909 Bacteria 7532
145 Ga0207707_10012111 3300025912 Bacteria 7498
146 Ga0207695_10002803 3300025913 Bacteria 25351
147 Ga0207695_10075060 3300025913 Bacteria 3441
148 Ga0207693_10421071 3300025915 Bacteria 1044
149 Ga0207660_10011800 3300025917 Bacteria 5696
150 Ga0207662_10438703 3300025918 Bacteria 891
151 Ga0207657_10292237 3300025919 Bacteria 1292
152 Ga0207649_10231619 3300025920 Bacteria 1321
153 Ga0207652_10037437 3300025921 Bacteria 4106
154 Ga0207646_10662217 3300025922 Bacteria 935
155 Ga0207694_11346471 3300025924 Bacteria 604
156 Ga0207659_10161900 3300025926 Bacteria 1758
157 Ga0207659_10689558 3300025926 Bacteria 874
158 Ga0207687_10154474 3300025927 Bacteria 1754
159 Ga0207644_10018537 3300025931 Bacteria 4710
160 Ga0207644_10250713 3300025931 Bacteria 1412
161 Ga0207644_10302497 3300025931 Bacteria 1289
162 Ga0207644_10479276 3300025931 Bacteria 1024
163 Ga0207690_10137239 3300025932 Bacteria 1797
164 Ga0207706_10049362 3300025933 Bacteria 3719
165 Ga0207706_10095246 3300025933 Bacteria 2619
166 Ga0207709_10245957 3300025935 Bacteria 1304
167 Ga0207709_10393317 3300025935 Bacteria 1058
168 Ga0207709_11521584 3300025935 Bacteria 555
169 Ga0207670_10413081 3300025936 Bacteria 1081
170 Ga0207669_10347449 3300025937 Bacteria 1144
171 Ga0207669_10456299 3300025937 Bacteria 1014
172 Ga0207691_10167321 3300025940 Bacteria 1926
173 Ga0207691_11392397 3300025940 Bacteria 576
174 Ga0207711_10078381 3300025941 Bacteria 2882
175 Ga0207711_10300829 3300025941 Bacteria 1480
176 Ga0207711_10338561 3300025941 Bacteria 1392
177 Ga0207661_10738770 3300025944 Bacteria 906
178 Ga0207679_10535535 3300025945 Bacteria 1049
179 Ga0207667_10113151 3300025949 Bacteria 2798
180 Ga0207651_10072376 3300025960 Bacteria 2447
181 Ga0207651_11140528 3300025960 Bacteria 699
182 Ga0207668_10290621 3300025972 Bacteria 1345
183 Ga0207668_11577787 3300025972 Bacteria 592
184 Ga0207640_10319046 3300025981 Bacteria 1236
185 Ga0207640_10767145 3300025981 Bacteria 833
186 Ga0207658_10000496 3300025986 Bacteria 36165
187 Ga0207658_10211883 3300025986 Bacteria 1624
188 Ga0207703_10145407 3300026035 Bacteria 2061
189 Ga0207639_10410003 3300026041 Bacteria 1223
190 Ga0207678_10310171 3300026067 Bacteria 1357
191 Ga0207708_10034284 3300026075 Bacteria 3861
192 Ga0207708_10209967 3300026075 Bacteria 1556
193 Ga0207708_10471639 3300026075 Bacteria 1048
194 Ga0207702_10088867 3300026078 Bacteria 2701
195 Ga0207641_10240718 3300026088 Bacteria 1686
196 Ga0207641_10816640 3300026088 Bacteria 923
197 Ga0207676_10236971 3300026095 Bacteria 1634
198 Ga0207676_10503648 3300026095 Unclassified 1150
199 Ga0207674_10155747 3300026116 Bacteria 2240
200 Ga0207675_100015933 3300026118 Bacteria 7012
201 Ga0207675_100903175 3300026118 Bacteria 900
202 Ga0207683_10851972 3300026121 Bacteria 846
203 Ga0209998_10013935 3300027717 Bacteria 1676
204 Ga0207428_10121327 3300027907 Bacteria 2004
205 Ga0268266_10020562 3300028379 Bacteria 5624
206 Ga0268266_10081341 3300028379 Bacteria 2824
207 Ga0268264_10010191 3300028381 Bacteria 7778
208 Ga0307517_10205948 3300028786 Bacteria 1221
209 Ga0265338_10621790 3300028800 Bacteria 751
210 Ga0307512_10242088 3300030522 Bacteria 911
211 Ga0265316_11230238 3300031344 Bacteria 518
212 Ga0307513_10030940 3300031456 Bacteria 6069
213 Ga0307514_10000225 3300031649 Bacteria 151002
214 Ga0373936_0111892 3300035113 Bacteria 1160
215 Ga0373941_0332051 3300035115 Bacteria 614
216 Ga0373954_0298447 3300035118 Bacteria 795
217 Ga0373942_0238789 3300035207 Bacteria 614
218 Ga0373962_0169371 3300035242 Bacteria 725
219 Ga0316574_0001496 3300035398 Bacteria 11115
220 Ga0373927_1013597 3300035695 Bacteria 548
221 Ga0316582_0551029 3300036647 Unclassified 794
222 Ga0316584_0532242 3300036712 Bacteria 822
223 Ga0395899_0009531 3300037312 Bacteria 7455
224 Ga0395900_0070977 3300037418 Bacteria 3580
225 Ga0395898_0123461 3300037466 Bacteria 2481
226 Ga0395898_0430465 3300037466 Bacteria 1257
227 Ga0395901_0007515 3300038443 Bacteria 11004
228 Ga0395901_0026827 3300038443 Bacteria 5915
229 Ga0436365_1556646 3300039437 Bacteria 2283
230 Ga0451798_0146213 3300041458 Bacteria 501
231 Ga0451798_1050220 3300041458 Bacteria 598
232 Ga0451807_1038819 3300041486 Bacteria 860
233 Ga0451835_0152907 3300041492 Bacteria 644
234 Ga0451577_0362421 3300042876 Bacteria 1315
235 Ga0453684_1693184 3300044712 Bacteria 646
236 Ga0451576_0002096 3300045051 Bacteria 31090
237 Ga0451576_0137656 3300045051 Bacteria 2547
238 Ga0495617_143042 3300046452 Bacteria 763
239 Ga0495584_0034713 3300046491 Bacteria 2550
240 Ga0495607_0121723 3300046501 Bacteria 1369
241 Ga0495583_0112722 3300046506 Bacteria 1151
242 Ga0495606_0291326 3300046507 Bacteria 888
243 Ga0495648_0478260 3300046524 Bacteria 539
244 Ga0495663_0320448 3300046525 Bacteria 561
245 Ga0495642_0100957 3300046528 Bacteria 1228
246 Ga0495642_0143899 3300046528 Bacteria 1030
247 Ga0495656_0027242 3300046615 Bacteria 2281
248 Ga0495611_0030678 3300046648 Bacteria 2365
249 Ga0495625_0274662 3300046660 Bacteria 1086
250 Ga0495625_0293654 3300046660 Bacteria 1042
251 Ga0495659_0008698 3300046664 Bacteria 3234
252 Ga0495659_0224310 3300046664 Bacteria 777
253 Ga0495647_0440798 3300046681 Unclassified 602
254 Ga0495669_0002414 3300046684 Bacteria 7653
255 Ga0495669_0153287 3300046684 Bacteria 1092
256 Ga0495670_0033127 3300046691 Bacteria 2571
257 Ga0495672_0069982 3300047320 Bacteria 1990
258 Ga0496100_0033155 3300048903 Bacteria 3230
259 Ga0496100_0553239 3300048903 Bacteria 890
260 Ga0496101_0034921 3300048904 Bacteria 3554
261 Ga0496101_0098919 3300048904 Bacteria 2180
262 Ga0496102_0057964 3300048905 Bacteria 3538
263 Ga0496103_0150198 3300048906 Bacteria 1492
264 Ga0496104_0360138 3300048907 Bacteria 1367
265 Ga0496104_0365434 3300048907 Bacteria 1355
266 Ga0496105_0845655 3300048908 Bacteria 693
267 Ga0496107_0069058 3300048910 Bacteria 2564
268 Ga0496107_0196027 3300048910 Bacteria 1501
269 Ga0496108_0131419 3300048911 Bacteria 2152
270 Ga0496108_0549076 3300048911 Bacteria 1008
271 Ga0496109_0012737 3300048912 Bacteria 7267
272 Ga0496110_0042273 3300048913 Bacteria 3978
273 Ga0496110_0287565 3300048913 Bacteria 1497
274 Ga0496111_0115985 3300048914 Bacteria 1975
275 Ga0496111_0122023 3300048914 Bacteria 1925
276 Ga0496112_0138635 3300048915 Bacteria 2402
277 Ga0496113_0095143 3300048916 Bacteria 2302
278 Ga0496113_0885836 3300048916 Bacteria 706
279 Ga0496115_0511222 3300048918 Bacteria 964
280 Ga0501031_0182123 3300049568 Bacteria 1372
281 Ga0501031_0199472 3300049568 Bacteria 1306
282 Ga0501031_0269646 3300049568 Bacteria 1105
283 Ga0501032_0155023 3300049569 Bacteria 1505
284 Ga0501032_0282737 3300049569 Bacteria 1074
285 Ga0501033_0029814 3300049570 Bacteria 4100
286 Ga0501033_0043413 3300049570 Bacteria 3349
287 Ga0501033_0209868 3300049570 Bacteria 1389
288 Ga0501034_0589890 3300049571 Bacteria 1018
289 Ga0501036_0062329 3300049572 Bacteria 3158
290 Ga0501036_0445319 3300049572 Bacteria 1079
291 Ga0501036_0974181 3300049572 Bacteria 695
292 Ga0501036_1046295 3300049572 Bacteria 667
293 Ga0501037_0036865 3300049573 Bacteria 3604
294 Ga0501037_0047031 3300049573 Bacteria 3163
295 Ga0501038_0028084 3300049574 Bacteria 4999
296 Ga0501038_0188372 3300049574 Bacteria 1661
297 Ga0501039_0086844 3300049575 Bacteria 2436
298 Ga0501039_0148782 3300049575 Bacteria 1840
299 Ga0501039_0288135 3300049575 Bacteria 1291
300 Ga0501039_1041733 3300049575 Bacteria 635
301 Ga0501040_0018229 3300049576 Bacteria 4660
302 Ga0501041_0053407 3300049577 Bacteria 2464
303 Ga0501041_0158552 3300049577 Bacteria 1414
304 Ga0501041_0195220 3300049577 Bacteria 1268
305 Ga0501041_0255152 3300049577 Bacteria 1102
306 Ga0501042_0007752 3300049578 Bacteria 7053
307 Ga0501042_0075474 3300049578 Bacteria 2412
308 Ga0501042_0290671 3300049578 Bacteria 1180
309 Ga0501043_0128173 3300049579 Bacteria 1989
310 Ga0501043_0130890 3300049579 Bacteria 1966
311 Ga0501043_0218640 3300049579 Bacteria 1475
312 Ga0501043_0264901 3300049579 Bacteria 1321
313 Ga0501046_0023421 3300049580 Bacteria 5081
314 Ga0501046_0031254 3300049580 Bacteria 4318
315 Ga0501046_0066311 3300049580 Bacteria 2814
316 Ga0501046_0233803 3300049580 Bacteria 1357
317 Ga0501047_0133012 3300049581 Bacteria 2367
318 Ga0501047_0195896 3300049581 Bacteria 1883
319 Ga0501048_0008081 3300049582 Bacteria 7964
320 Ga0501048_0008236 3300049582 Bacteria 7887
321 Ga0501048_0180226 3300049582 Bacteria 1497
322 Ga0501068_0108659 3300049584 Bacteria 1723
323 Ga0501068_0250107 3300049584 Bacteria 1129
324 Ga0501069_0074986 3300049585 Bacteria 1899
325 Ga0501069_0296197 3300049585 Bacteria 948
326 Ga0501069_0408888 3300049585 Bacteria 804
327 Ga0501070_0067375 3300049586 Bacteria 2965
328 Ga0501070_0240575 3300049586 Bacteria 1482
329 Ga0501070_0884639 3300049586 Bacteria 697
330 Ga0501071_0000630 3300049587 Bacteria 18317
331 Ga0501071_0013709 3300049587 Bacteria 5529
332 Ga0501071_0303848 3300049587 Bacteria 1210
333 Ga0501071_0815640 3300049587 Bacteria 719
334 Ga0501072_0050626 3300049588 Bacteria 3270
335 Ga0501072_0111601 3300049588 Bacteria 2176
336 Ga0501072_0341889 3300049588 Bacteria 1188
337 Ga0501073_0236126 3300049589 Bacteria 1263
338 Ga0501073_0267787 3300049589 Bacteria 1179
339 Ga0501073_0336406 3300049589 Bacteria 1042
340 Ga0501074_0037588 3300049590 Bacteria 3509
341 Ga0501074_0052791 3300049590 Bacteria 2933
342 Ga0501075_0006650 3300049591 Bacteria 7969
343 Ga0501075_0010198 3300049591 Bacteria 6597
344 Ga0501075_0100164 3300049591 Bacteria 2200
345 Ga0501076_0004560 3300049592 Bacteria 9866
346 Ga0501076_0018744 3300049592 Bacteria 5282
347 Ga0501076_0089650 3300049592 Bacteria 2472
348 Ga0501076_0770212 3300049592 Bacteria 794
349 Ga0501076_1430333 3300049592 Bacteria 568
350 Ga0501077_0085914 3300049593 Bacteria 1994
351 Ga0501077_0087427 3300049593 Bacteria 1975
352 Ga0501077_0107762 3300049593 Bacteria 1765
353 Ga0501079_0050257 3300049741 Bacteria 3218
354 Ga0501079_0117687 3300049741 Bacteria 2065
355 Ga0501079_0191422 3300049741 Bacteria 1596
356 Ga0501079_0280900 3300049741 Bacteria 1302
357 Ga0501079_0366413 3300049741 Bacteria 1129
358 Ga0501080_0336964 3300049742 Bacteria 1363
359 Ga0501080_0961485 3300049742 Bacteria 742
360 Ga0501081_0035292 3300049743 Bacteria 3404
361 Ga0501081_0040583 3300049743 Bacteria 3186
362 Ga0501081_0097225 3300049743 Bacteria 2077
363 Ga0501081_0117369 3300049743 Bacteria 1893
364 Ga0501083_0260967 3300049744 Bacteria 1127
365 Ga0501083_0329541 3300049744 Bacteria 993
366 Ga0501035_0115697 3300049822 Bacteria 2347
367 Ga0501035_0316531 3300049822 Bacteria 1312
368 Ga0501035_1541001 3300049822 Bacteria 506
369 Ga0501044_0106946 3300049823 Bacteria 2809
370 Ga0501044_1583925 3300049823 Bacteria 520
371 Ga0501045_0009986 3300049824 Bacteria 6639
372 Ga0501045_0050774 3300049824 Bacteria 3026
373 Ga0501045_0057646 3300049824 Bacteria 2842
374 Ga0501045_1250986 3300049824 Bacteria 541
375 nmdc:mga03683_2754_c1 3300050489 Bacteria 5517
376 nmdc:mga03683_85762_c1 3300050489 Bacteria 1366
377 nmdc:mga06z11_351768_c2 3300050494 Bacteria 528
378 nmdc:mga05p37_62219_c1 3300050507 Bacteria 4593
379 nmdc:mga06r32_92220_c1 3300050510 Bacteria 1915
380 nmdc:mga08y16_139427_c1 3300050511 Bacteria 2521
381 nmdc:mga08y16_795421_c1 3300050511 Bacteria 939
382 nmdc:mga0a205_49631_c1 3300050515 Bacteria 4051
383 Ga0495595_0276148 3300053084 Bacteria 843
384 Ga0495619_0096055 3300053085 Unclassified 2012
385 Ga0500644_0051771 3300053088 Bacteria 1411
386 Ga0500644_0157778 3300053088 Bacteria 915
387 Ga0500566_0308346 3300053094 Bacteria 742
388 Ga0500562_025457 3300053108 Bacteria 1548
389 Ga0500655_047313 3300053133 Bacteria 853
390 Ga0500568_0157803 3300053139 Bacteria 838
391 Ga0501084_0072194 3300054114 Bacteria 2890
392 Ga0501084_0097351 3300054114 Bacteria 2470
393 Ga0501084_0122913 3300054114 Bacteria 2183
394 Ga0501082_0009189 3300060353 Bacteria 8522
395 Ga0501082_0425597 3300060353 Bacteria 1159
396 Ga0530510_0017410 3300061734 Bacteria 5093
397 Ga0530510_0381158 3300061734 Bacteria 1061
398 Ga0530510_0559805 3300061734 Bacteria 868
399 2585151155 2582581280 Bacteria 5994497
400 2585196184 2582581293 Bacteria 5907401
401 2643750145 2643221545 Bacteria 5083237
402 2643781799 2643221552 Bacteria 5708754
403 2643931990 2643221584 Bacteria 5511711
404 2644001785 2643221598 Bacteria 4578346
405 2644087823 2643221614 Bacteria 4260023
406 2644345427 2643221661 Bacteria 4267604
407 2644367179 2643221666 Bacteria 4265935
408 2644507034 2643221691 Bacteria 5093099
409 2819538233 2818991435 Bacteria 5433759
410 2819647197 2818991454 Bacteria 5563326
411 Ga0157370_10869688
412 Ga0065715_10919298
413 Ga0070658_10063306
414 Ga0070676_10330085
415 Ga0070690_100875579
416 Ga0070666_10122346
417 Ga0070666_10185027
418 Ga0070680_100019671
419 Ga0068868_101122391
420 Ga0070689_100406608
421 Ga0070689_100553158
422 Ga0070691_10015786
423 Ga0070691_10584883
424 Ga0070687_100404425
425 Ga0070692_10140788
426 Ga0070668_101107302
427 Ga0070675_100526987
428 Ga0070675_100597163
429 Ga0070671_100033564
430 Ga0070671_100046683
431 Ga0070671_100290593
432 Ga0070671_100294386
433 Ga0070674_100139836
434 Ga0070673_100095234
435 Ga0070673_100581820
436 Ga0070673_102415362
437 Ga0070659_100207554
438 Ga0070667_100000115
439 Ga0070667_100562671
440 Ga0070667_100759526
441 Ga0070701_10371563
442 Ga0070701_10450743
443 Ga0070701_10606382
444 Ga0070711_100109316
445 Ga0070705_100140475
446 Ga0070700_100158234
447 Ga0070700_100427770
448 Ga0070700_101292924
449 Ga0070694_100035816
450 Ga0070708_100800051
451 Ga0070663_100346197
452 Ga0070678_100067192
453 Ga0070678_100561250
454 Ga0070678_100834166
455 Ga0070662_100029607
456 Ga0070662_100048328
457 Ga0070681_10011836
458 Ga0068867_100352183
459 Ga0068867_100959439
460 Ga0070679_100008662
461 Ga0070679_100599294
462 Ga0068853_100361218
463 Ga0068853_101346910
464 Ga0070672_100086569
465 Ga0070695_100069440
466 Ga0070696_100088638
467 Ga0070665_100058611
468 Ga0070665_100060881
469 Ga0068855_100009168
470 Ga0068855_100576275
471 Ga0070664_100717514
472 Ga0068857_100155311
473 Ga0068854_100218379
474 Ga0068854_100602707
475 Ga0068854_100820909
476 Ga0068856_100143336
477 Ga0068856_100254821
478 Ga0070702_100218912
479 Ga0070702_100652265
480 Ga0068852_101580779
481 Ga0068859_100102439
482 Ga0068859_100222071
483 Ga0068859_102569138
484 Ga0068864_100005795
485 Ga0068864_100416554
486 Ga0068866_11352620
487 Ga0068861_100072619
488 Ga0068861_100615236
489 Ga0068863_100661197
490 Ga0068863_100748877
491 Ga0068863_100824183
492 Ga0068858_100744127
493 Ga0068860_100019837
494 Ga0068862_100182033
495 Ga0081455_10001698
496 Ga0075362_10107458
497 Ga0075366_10012744
498 Ga0097621_101892625
499 Ga0068865_100698475
500 Ga0068865_101393792
501 Ga0097620_100102437
502 Ga0097620_100222060
503 Ga0097620_102569012
504 Ga0105250_10144374
505 Ga0105240_10003020
506 Ga0105240_10006208
507 Ga0111539_10068471
508 Ga0111539_10569031
509 Ga0105245_10040371
510 Ga0105247_10006836
511 Ga0114129_10098589
512 Ga0114129_10228144
513 Ga0105243_10137779
514 Ga0105243_10238489
515 Ga0105243_10383259
516 Ga0105248_10857120
517 Ga0105237_10153651
518 Ga0105237_11872428
519 Ga0105238_10862550
520 Ga0105249_10079471
521 Ga0105249_10837639
522 Ga0105249_10876239
523 Ga0105239_10391867
524 Ga0105239_10860435
525 Ga0105239_13030494
526 Ga0105246_10199708
527 Ga0157337_1038295
528 Ga0157338_1066559
529 Ga0157370_10081370
530 Ga0157369_10677268
531 Ga0157374_10284761
532 Ga0157378_10013740
533 Ga0163162_10749245
534 Ga0163162_10874889
535 Ga0163162_11145766
536 Ga0157372_10568914
537 Ga0157372_10982509
538 Ga0157375_10086860
539 Ga0157375_10350180
540 Ga0157375_11488387
541 Ga0163163_10051160
542 Ga0157380_10182692
543 Ga0157380_10383842
544 Ga0157377_10961180
545 Ga0157379_10013773
546 Ga0157379_10382017
547 Ga0206356_10621627
548 Ga0209758_1123752
549 Ga0207426_1007137
550 Ga0207710_10048793
551 Ga0207680_10102063
552 Ga0207680_10118976
553 Ga0207645_10178496
554 Ga0207705_10008414
555 Ga0207707_10012111
556 Ga0207695_10002803
557 Ga0207695_10075060
558 Ga0207693_10421071
559 Ga0207660_10011800
560 Ga0207662_10438703
561 Ga0207657_10292237
562 Ga0207649_10231619
563 Ga0207652_10037437
564 Ga0207646_10662217
565 Ga0207694_11346471
566 Ga0207659_10161900
567 Ga0207659_10689558
568 Ga0207687_10154474
569 Ga0207644_10018537
570 Ga0207644_10250713
571 Ga0207644_10302497
572 Ga0207644_10479276
573 Ga0207690_10137239
574 Ga0207706_10049362
575 Ga0207706_10095246
576 Ga0207709_10245957
577 Ga0207709_10393317
578 Ga0207709_11521584
579 Ga0207670_10413081
580 Ga0207669_10347449
581 Ga0207669_10456299
582 Ga0207691_10167321
583 Ga0207691_11392397
584 Ga0207711_10078381
585 Ga0207711_10300829
586 Ga0207711_10338561
587 Ga0207661_10738770
588 Ga0207679_10535535
589 Ga0207667_10113151
590 Ga0207651_10072376
591 Ga0207651_11140528
592 Ga0207668_10290621
593 Ga0207668_11577787
594 Ga0207640_10319046
595 Ga0207640_10767145
596 Ga0207658_10000496
597 Ga0207658_10211883
598 Ga0207703_10145407
599 Ga0207639_10410003
600 Ga0207678_10310171
601 Ga0207708_10034284
602 Ga0207708_10209967
603 Ga0207708_10471639
604 Ga0207702_10088867
605 Ga0207641_10240718
606 Ga0207641_10816640
607 Ga0207676_10236971
608 Ga0207676_10503648
609 Ga0207674_10155747
610 Ga0207675_100015933
611 Ga0207675_100903175
612 Ga0207683_10851972
613 Ga0209998_10013935
614 Ga0207428_10121327
615 Ga0268266_10020562
616 Ga0268266_10081341
617 Ga0268264_10010191
618 Ga0307517_10205948
619 Ga0265338_10621790
620 Ga0307512_10242088
621 Ga0265316_11230238
622 Ga0307513_10030940
623 Ga0307514_10000225
624 Ga0373936_0111892
625 Ga0373941_0332051
626 Ga0373954_0298447
627 Ga0373942_0238789
628 Ga0373962_0169371
629 Ga0316574_0001496
630 Ga0373927_1013597
631 Ga0316582_0551029
632 Ga0316584_0532242
633 Ga0395899_0009531
634 Ga0395900_0070977
635 Ga0395898_0123461
636 Ga0395898_0430465
637 Ga0395901_0007515
638 Ga0395901_0026827
639 Ga0436365_1556646
640 Ga0451798_0146213
641 Ga0451798_1050220
642 Ga0451807_1038819
643 Ga0451835_0152907
644 Ga0451577_0362421
645 Ga0453684_1693184
646 Ga0451576_0002096
647 Ga0451576_0137656
648 Ga0495617_143042
649 Ga0495584_0034713
650 Ga0495607_0121723
651 Ga0495583_0112722
652 Ga0495606_0291326
653 Ga0495648_0478260
654 Ga0495663_0320448
655 Ga0495642_0100957
656 Ga0495642_0143899
657 Ga0495656_0027242
658 Ga0495611_0030678
659 Ga0495625_0274662
660 Ga0495625_0293654
661 Ga0495659_0008698
662 Ga0495659_0224310
663 Ga0495647_0440798
664 Ga0495669_0002414
665 Ga0495669_0153287
666 Ga0495670_0033127
667 Ga0495672_0069982
668 Ga0496100_0033155
669 Ga0496100_0553239
670 Ga0496101_0034921
671 Ga0496101_0098919
672 Ga0496102_0057964
673 Ga0496103_0150198
674 Ga0496104_0360138
675 Ga0496104_0365434
676 Ga0496105_0845655
677 Ga0496107_0069058
678 Ga0496107_0196027
679 Ga0496108_0131419
680 Ga0496108_0549076
681 Ga0496109_0012737
682 Ga0496110_0042273
683 Ga0496110_0287565
684 Ga0496111_0115985
685 Ga0496111_0122023
686 Ga0496112_0138635
687 Ga0496113_0095143
688 Ga0496113_0885836
689 Ga0496115_0511222
690 Ga0501031_0182123
691 Ga0501031_0199472
692 Ga0501031_0269646
693 Ga0501032_0155023
694 Ga0501032_0282737
695 Ga0501033_0029814
696 Ga0501033_0043413
697 Ga0501033_0209868
698 Ga0501034_0589890
699 Ga0501036_0062329
700 Ga0501036_0445319
701 Ga0501036_0974181
702 Ga0501036_1046295
703 Ga0501037_0036865
704 Ga0501037_0047031
705 Ga0501038_0028084
706 Ga0501038_0188372
707 Ga0501039_0086844
708 Ga0501039_0148782
709 Ga0501039_0288135
710 Ga0501039_1041733
711 Ga0501040_0018229
712 Ga0501041_0053407
713 Ga0501041_0158552
714 Ga0501041_0195220
715 Ga0501041_0255152
716 Ga0501042_0007752
717 Ga0501042_0075474
718 Ga0501042_0290671
719 Ga0501043_0128173
720 Ga0501043_0130890
721 Ga0501043_0218640
722 Ga0501043_0264901
723 Ga0501046_0023421
724 Ga0501046_0031254
725 Ga0501046_0066311
726 Ga0501046_0233803
727 Ga0501047_0133012
728 Ga0501047_0195896
729 Ga0501048_0008081
730 Ga0501048_0008236
731 Ga0501048_0180226
732 Ga0501068_0108659
733 Ga0501068_0250107
734 Ga0501069_0074986
735 Ga0501069_0296197
736 Ga0501069_0408888
737 Ga0501070_0067375
738 Ga0501070_0240575
739 Ga0501070_0884639
740 Ga0501071_0000630
741 Ga0501071_0013709
742 Ga0501071_0303848
743 Ga0501071_0815640
744 Ga0501072_0050626
745 Ga0501072_0111601
746 Ga0501072_0341889
747 Ga0501073_0236126
748 Ga0501073_0267787
749 Ga0501073_0336406
750 Ga0501074_0037588
751 Ga0501074_0052791
752 Ga0501075_0006650
753 Ga0501075_0010198
754 Ga0501075_0100164
755 Ga0501076_0004560
756 Ga0501076_0018744
757 Ga0501076_0089650
758 Ga0501076_0770212
759 Ga0501076_1430333
760 Ga0501077_0085914
761 Ga0501077_0087427
762 Ga0501077_0107762
763 Ga0501079_0050257
764 Ga0501079_0117687
765 Ga0501079_0191422
766 Ga0501079_0280900
767 Ga0501079_0366413
768 Ga0501080_0336964
769 Ga0501080_0961485
770 Ga0501081_0035292
771 Ga0501081_0040583
772 Ga0501081_0097225
773 Ga0501081_0117369
774 Ga0501083_0260967
775 Ga0501083_0329541
776 Ga0501035_0115697
777 Ga0501035_0316531
778 Ga0501035_1541001
779 Ga0501044_0106946
780 Ga0501044_1583925
781 Ga0501045_0009986
782 Ga0501045_0050774
783 Ga0501045_0057646
784 Ga0501045_1250986
785 nmdc:mga03683_2754_c1
786 nmdc:mga03683_85762_c1
787 nmdc:mga06z11_351768_c2
788 nmdc:mga05p37_62219_c1
789 nmdc:mga06r32_92220_c1
790 nmdc:mga08y16_139427_c1
791 nmdc:mga08y16_795421_c1
792 nmdc:mga0a205_49631_c1
793 Ga0495595_0276148
794 Ga0495619_0096055
795 Ga0500644_0051771
796 Ga0500644_0157778
797 Ga0500566_0308346
798 Ga0500562_025457
799 Ga0500655_047313
800 Ga0500568_0157803
801 Ga0501084_0072194
802 Ga0501084_0097351
803 Ga0501084_0122913
804 Ga0501082_0009189
805 Ga0501082_0425597
806 Ga0530510_0017410
807 Ga0530510_0381158
808 Ga0530510_0559805
809 2585151155
810 2585196184
811 2643750145
812 2643781799
813 2643931990
814 2644001785
815 2644087823
816 2644345427
817 2644367179
818 2644507034
819 2819538233
820 2819647197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09996

DUF2237

Uncharacterized protein conserved in bacteria (DUF2237)

22

136

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.9403 10 126
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.9253 10 126
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.8294 1 126
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.8228 1 126
2lq3-assembly1.cif.gz_A solution nmr structure of syc0711_d from synechococcus sp., northeast structural genomics consortium (nesg) target snr212 0.4974 10 127
ID Description Score Start End Superfamily
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.9369 10 126 3.30.56.110
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.9212 10 126 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8519 11 126 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8312 11 126 3.30.56.110
2lq3A01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.6405 53 126 1.10.1660.80
ID Description Score Start End GO Terms
AF-A0A3N6NZH0-F1-model_v4 DUF2237 family protein 1.001 81 126
AF-S7WWJ5-F1-model_v4 DUF2237 domain-containing protein 0.9964 47 125
AF-A0A2R4BMP0-F1-model_v4 Uncharacterized protein 0.9961 50 126
AF-A0A2V5VJH0-F1-model_v4 DUF2237 domain-containing protein 0.9954 76 126
AF-A0A2V6DHX8-F1-model_v4 DUF2237 domain-containing protein 0.9944 84 126

Map