F437224

General Info

Members Datasets Scaffolds Average Seq Length
410 199 820 105

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10053870|Ga0111539_100538703
Length 123
Sequence MRRRRGSFFGFDGSVEGGFEVYAIIRAGGKQYRVKEGDTIHLELVPAEAGEKVVLGEVLFVGGDGEPRLGAPLVDKAQVVGTVLEQGRDRKVRVFKYKKRKHYRRTRGHRQSFTALRIDAIEI

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
137 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
140 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
150 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 1.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.78
Nodule 0
Rhizoplane 0.24
Rhizosphere 90.98
Stem 0
Stem Tuber 0
Unclassified 14.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10053870 3300009094 Bacteria 4788
2 Ga0070676_10061525 3300005328 Bacteria 2232
3 Ga0070676_11137417 3300005328 Bacteria 591
4 Ga0070690_100088436 3300005330 Unclassified 2036
5 Ga0070677_10329378 3300005333 Bacteria 785
6 Ga0070677_10917840 3300005333 Bacteria 507
7 Ga0070680_101078460 3300005336 Bacteria 694
8 Ga0070682_100623342 3300005337 Bacteria 855
9 Ga0068868_100430893 3300005338 Unclassified 1143
10 Ga0070689_100003521 3300005340 Bacteria 10414
11 Ga0070689_100030205 3300005340 Bacteria 4111
12 Ga0070689_100728774 3300005340 Unclassified 867
13 Ga0070687_100063151 3300005343 Bacteria 1963
14 Ga0070687_100549473 3300005343 Bacteria 786
15 Ga0070692_10581814 3300005345 Bacteria 738
16 Ga0070668_101769794 3300005347 Bacteria 568
17 Ga0070669_100532114 3300005353 Bacteria 978
18 Ga0070669_101428767 3300005353 Bacteria 601
19 Ga0070669_101728048 3300005353 Unclassified 545
20 Ga0070675_100338320 3300005354 Unclassified 1333
21 Ga0070675_101095764 3300005354 Bacteria 732
22 Ga0070671_101110579 3300005355 Unclassified 695
23 Ga0070673_100029346 3300005364 Bacteria 4101
24 Ga0070673_100151884 3300005364 Bacteria 1962
25 Ga0070688_100019154 3300005365 Bacteria 3963
26 Ga0070667_100029306 3300005367 Bacteria 4586
27 Ga0070703_10165280 3300005406 Bacteria 843
28 Ga0070701_10037120 3300005438 Bacteria 2459
29 Ga0070701_10140668 3300005438 Bacteria 1380
30 Ga0070701_10318872 3300005438 Bacteria 961
31 Ga0070705_100106177 3300005440 Unclassified 1785
32 Ga0070700_100039591 3300005441 Bacteria 2880
33 Ga0070700_100068343 3300005441 Bacteria 2259
34 Ga0070700_100733000 3300005441 Unclassified 789
35 Ga0070694_100021331 3300005444 Bacteria 4138
36 Ga0070694_100745718 3300005444 Bacteria 799
37 Ga0070694_100955794 3300005444 Bacteria 710
38 Ga0070708_100080041 3300005445 Bacteria 2956
39 Ga0070708_100108622 3300005445 Bacteria 2548
40 Ga0070708_100184850 3300005445 Bacteria 1949
41 Ga0070708_101024971 3300005445 Unclassified 774
42 Ga0070708_101914238 3300005445 Bacteria 550
43 Ga0070663_100097513 3300005455 Bacteria 2188
44 Ga0070678_100145276 3300005456 Bacteria 1903
45 Ga0070662_100362761 3300005457 Bacteria 1189
46 Ga0070681_11357067 3300005458 Bacteria 634
47 Ga0068867_100075754 3300005459 Bacteria 2524
48 Ga0068867_101251054 3300005459 Bacteria 683
49 Ga0070685_10124131 3300005466 Bacteria 1607
50 Ga0070685_10995631 3300005466 Bacteria 629
51 Ga0070706_100004931 3300005467 Bacteria 12774
52 Ga0070706_100020725 3300005467 Bacteria 6056
53 Ga0070706_100670220 3300005467 Bacteria 962
54 Ga0070706_101546587 3300005467 Unclassified 606
55 Ga0070706_101967244 3300005467 Unclassified 530
56 Ga0070707_100021790 3300005468 Bacteria 6056
57 Ga0070707_100058360 3300005468 Bacteria 3701
58 Ga0070707_101148766 3300005468 Bacteria 743
59 Ga0070698_100009915 3300005471 Bacteria 10183
60 Ga0070698_100040761 3300005471 Bacteria 4771
61 Ga0070698_100669253 3300005471 Bacteria 979
62 Ga0070699_100010559 3300005518 Bacteria 7993
63 Ga0070699_100046235 3300005518 Bacteria 3767
64 Ga0070699_100112077 3300005518 Bacteria 2396
65 Ga0070699_100156189 3300005518 Bacteria 2019
66 Ga0070697_100180980 3300005536 Bacteria 1787
67 Ga0070697_100203179 3300005536 Bacteria 1684
68 Ga0070697_100663625 3300005536 Bacteria 919
69 Ga0070672_100403722 3300005543 Bacteria 1172
70 Ga0070672_100606015 3300005543 Bacteria 954
71 Ga0070686_100003198 3300005544 Bacteria 8977
72 Ga0070695_100006052 3300005545 Bacteria 7148
73 Ga0070695_100499747 3300005545 Bacteria 940
74 Ga0070695_100525264 3300005545 Bacteria 919
75 Ga0070695_101287167 3300005545 Bacteria 604
76 Ga0070695_101526984 3300005545 Bacteria 556
77 Ga0070695_101900472 3300005545 Unclassified 500
78 Ga0070696_100398863 3300005546 Unclassified 1076
79 Ga0070696_100424267 3300005546 Bacteria 1045
80 Ga0070696_101724902 3300005546 Unclassified 540
81 Ga0070693_101241217 3300005547 Bacteria 574
82 Ga0070704_100025382 3300005549 Bacteria 3901
83 Ga0070704_100040295 3300005549 Bacteria 3214
84 Ga0070704_100076370 3300005549 Bacteria 2450
85 Ga0070704_100145069 3300005549 Bacteria 1859
86 Ga0070704_100922419 3300005549 Bacteria 786
87 Ga0070664_100254160 3300005564 Bacteria 1580
88 Ga0070664_100540519 3300005564 Unclassified 1077
89 Ga0068854_100576454 3300005578 Unclassified 958
90 Ga0070702_100121920 3300005615 Bacteria 1633
91 Ga0068852_100466911 3300005616 Bacteria 1252
92 Ga0068859_100029354 3300005617 Bacteria 5518
93 Ga0068859_100127561 3300005617 Bacteria 2614
94 Ga0068859_100553132 3300005617 Bacteria 1245
95 Ga0068864_100058951 3300005618 Bacteria 3320
96 Ga0068864_101725882 3300005618 Bacteria 631
97 Ga0068866_10080561 3300005718 Bacteria 1747
98 Ga0068861_100476586 3300005719 Bacteria 1123
99 Ga0068861_101295577 3300005719 Bacteria 708
100 Ga0068861_101441255 3300005719 Unclassified 674
101 Ga0068870_10743019 3300005840 Bacteria 681
102 Ga0068858_100027698 3300005842 Bacteria 5265
103 Ga0068860_101476138 3300005843 Bacteria 701
104 Ga0068862_100043098 3300005844 Bacteria 3846
105 Ga0068862_100154464 3300005844 Bacteria 2044
106 Ga0075365_10005854 3300006038 Bacteria 6686
107 Ga0075368_10167811 3300006042 Bacteria 922
108 Ga0075368_10195476 3300006042 Bacteria 855
109 Ga0075363_100084271 3300006048 Bacteria 1743
110 Ga0075363_100476975 3300006048 Bacteria 739
111 Ga0075363_100711173 3300006048 Unclassified 607
112 Ga0075364_10006503 3300006051 Bacteria 6870
113 Ga0075364_10039389 3300006051 Bacteria 3063
114 Ga0075364_10841342 3300006051 Bacteria 625
115 Ga0075362_10007040 3300006177 Bacteria 4227
116 Ga0075367_10000544 3300006178 Bacteria 14300
117 Ga0075367_10005334 3300006178 Bacteria 6368
118 Ga0075367_10170146 3300006178 Bacteria 1357
119 Ga0075367_10206867 3300006178 Bacteria 1227
120 Ga0075369_10182677 3300006186 Bacteria 965
121 Ga0075366_10001280 3300006195 Bacteria 12532
122 Ga0097621_100457228 3300006237 Bacteria 1151
123 Ga0075370_10028296 3300006353 Bacteria 3114
124 Ga0068871_100124615 3300006358 Bacteria 2179
125 Ga0075428_100016336 3300006844 Bacteria 8202
126 Ga0075428_100026496 3300006844 Bacteria 6417
127 Ga0075428_100026875 3300006844 Bacteria 6373
128 Ga0075428_100093910 3300006844 Bacteria 3271
129 Ga0075428_100107381 3300006844 Unclassified 3042
130 Ga0075428_100141649 3300006844 Bacteria 2614
131 Ga0075428_100303314 3300006844 Bacteria 1717
132 Ga0075428_100552908 3300006844 Bacteria 1230
133 Ga0075428_100661005 3300006844 Bacteria 1114
134 Ga0075428_100696364 3300006844 Bacteria 1082
135 Ga0075428_100704510 3300006844 Unclassified 1075
136 Ga0075428_101516381 3300006844 Bacteria 702
137 Ga0075428_102160190 3300006844 Unclassified 575
138 Ga0075430_100023405 3300006846 Bacteria 5258
139 Ga0075430_100363049 3300006846 Bacteria 1196
140 Ga0075430_100438600 3300006846 Bacteria 1078
141 Ga0075430_100562033 3300006846 Bacteria 941
142 Ga0075430_101723409 3300006846 Unclassified 514
143 Ga0075431_100000909 3300006847 Bacteria 26078
144 Ga0075431_100231043 3300006847 Bacteria 1885
145 Ga0075431_100232890 3300006847 Bacteria 1876
146 Ga0075431_101869893 3300006847 Bacteria 556
147 Ga0075433_10075122 3300006852 Bacteria 2974
148 Ga0075433_10135197 3300006852 Bacteria 2191
149 Ga0075433_10199192 3300006852 Bacteria 1781
150 Ga0075434_100009347 3300006871 Bacteria 9138
151 Ga0075434_100187399 3300006871 Bacteria 2089
152 Ga0075434_100310278 3300006871 Bacteria 1598
153 Ga0075434_100526954 3300006871 Bacteria 1202
154 Ga0075434_100832561 3300006871 Bacteria 939
155 Ga0075429_100009682 3300006880 Bacteria 8355
156 Ga0075429_100011149 3300006880 Bacteria 7781
157 Ga0075429_100254931 3300006880 Bacteria 1536
158 Ga0075429_100371438 3300006880 Bacteria 1252
159 Ga0068865_100015068 3300006881 Bacteria 4925
160 Ga0075436_100153022 3300006914 Bacteria 1624
161 Ga0097620_100029354 3300006931 Bacteria 5518
162 Ga0097620_100127546 3300006931 Bacteria 2614
163 Ga0097620_100553102 3300006931 Bacteria 1245
164 Ga0075435_100027006 3300007076 Bacteria 4486
165 Ga0075435_100029398 3300007076 Bacteria 4311
166 Ga0075435_100365275 3300007076 Bacteria 1238
167 Ga0075435_101398844 3300007076 Bacteria 613
168 Ga0099795_10060923 3300007788 Bacteria 1400
169 Ga0111539_10001712 3300009094 Bacteria 29185
170 Ga0111539_10011102 3300009094 Bacteria 11331
171 Ga0111539_10294030 3300009094 Bacteria 1890
172 Ga0111539_12220485 3300009094 Unclassified 637
173 Ga0105245_10015771 3300009098 Bacteria 6589
174 Ga0114129_10013588 3300009147 Bacteria 11601
175 Ga0114129_10032719 3300009147 Bacteria 7347
176 Ga0114129_10063682 3300009147 Bacteria 5147
177 Ga0114129_10121703 3300009147 Bacteria 3591
178 Ga0114129_10137921 3300009147 Bacteria 3346
179 Ga0114129_10175335 3300009147 Bacteria 2920
180 Ga0114129_10546398 3300009147 Bacteria 1507
181 Ga0114129_10599795 3300009147 Bacteria 1427
182 Ga0114129_11036254 3300009147 Bacteria 1031
183 Ga0114129_11295093 3300009147 Unclassified 903
184 Ga0114129_11384435 3300009147 Bacteria 869
185 Ga0114129_11417065 3300009147 Bacteria 857
186 Ga0114129_11802511 3300009147 Bacteria 744
187 Ga0114129_12567641 3300009147 Unclassified 608
188 Ga0105243_10216366 3300009148 Bacteria 1690
189 Ga0105241_10569437 3300009174 Bacteria 1019
190 Ga0105242_10137596 3300009176 Bacteria 2115
191 Ga0105248_10347836 3300009177 Bacteria 1669
192 Ga0105249_10253749 3300009553 Bacteria 1745
193 Ga0105249_10814447 3300009553 Bacteria 998
194 Ga0105246_10533983 3300011119 Bacteria 1002
195 Ga0157378_10448184 3300013297 Unclassified 1280
196 Ga0163162_10310310 3300013306 Bacteria 1710
197 Ga0157375_10228085 3300013308 Bacteria 2021
198 Ga0157375_10940391 3300013308 Bacteria 1007
199 Ga0157375_11640603 3300013308 Bacteria 761
200 Ga0163163_11173501 3300014325 Bacteria 830
201 Ga0157380_10009264 3300014326 Bacteria 7045
202 Ga0157380_10018288 3300014326 Bacteria 5201
203 Ga0157380_10601185 3300014326 Bacteria 1088
204 Ga0157380_10739632 3300014326 Bacteria 994
205 Ga0157380_12032161 3300014326 Bacteria 637
206 Ga0157377_10065341 3300014745 Bacteria 2090
207 Ga0157377_10321315 3300014745 Bacteria 1028
208 Ga0157376_11721368 3300014969 Bacteria 662
209 Ga0163161_10710901 3300017792 Bacteria 837
210 Ga0207653_10020496 3300025885 Bacteria 2093
211 Ga0207682_10464919 3300025893 Bacteria 599
212 Ga0207680_10141033 3300025903 Unclassified 1598
213 Ga0207643_10688302 3300025908 Bacteria 660
214 Ga0207684_10000858 3300025910 Bacteria 34901
215 Ga0207684_10571031 3300025910 Bacteria 967
216 Ga0207684_11338122 3300025910 Unclassified 588
217 Ga0207684_11350251 3300025910 Bacteria 585
218 Ga0207707_11065579 3300025912 Bacteria 660
219 Ga0207662_10000634 3300025918 Bacteria 15797
220 Ga0207646_10002741 3300025922 Bacteria 20580
221 Ga0207646_10031936 3300025922 Bacteria 4767
222 Ga0207681_11596081 3300025923 Unclassified 546
223 Ga0207659_10530283 3300025926 Unclassified 999
224 Ga0207659_10968282 3300025926 Bacteria 732
225 Ga0207644_10616020 3300025931 Bacteria 902
226 Ga0207644_11250487 3300025931 Bacteria 624
227 Ga0207706_10018321 3300025933 Bacteria 6300
228 Ga0207706_10199044 3300025933 Bacteria 1757
229 Ga0207686_10678620 3300025934 Bacteria 817
230 Ga0207709_10846511 3300025935 Bacteria 741
231 Ga0207670_10006464 3300025936 Bacteria 6502
232 Ga0207669_10263976 3300025937 Unclassified 1289
233 Ga0207704_10224555 3300025938 Unclassified 1392
234 Ga0207691_10024678 3300025940 Bacteria 5654
235 Ga0207691_10056817 3300025940 Bacteria 3564
236 Ga0207711_10225301 3300025941 Bacteria 1716
237 Ga0207711_11570889 3300025941 Bacteria 601
238 Ga0207689_10003286 3300025942 Bacteria 14815
239 Ga0207679_10123505 3300025945 Bacteria 2065
240 Ga0207651_10067810 3300025960 Bacteria 2512
241 Ga0207651_10102848 3300025960 Bacteria 2125
242 Ga0207712_10607380 3300025961 Unclassified 947
243 Ga0207640_10634328 3300025981 Bacteria 908
244 Ga0207658_10495595 3300025986 Unclassified 1087
245 Ga0207677_10324830 3300026023 Unclassified 1280
246 Ga0207703_10024827 3300026035 Bacteria 4715
247 Ga0207639_11551327 3300026041 Unclassified 621
248 Ga0207678_10145282 3300026067 Bacteria 2024
249 Ga0207708_10003999 3300026075 Bacteria 10848
250 Ga0207708_10077399 3300026075 Bacteria 2553
251 Ga0207708_10573784 3300026075 Unclassified 953
252 Ga0207708_10896331 3300026075 Unclassified 767
253 Ga0207641_10037531 3300026088 Bacteria 4047
254 Ga0207641_12211416 3300026088 Unclassified 550
255 Ga0207648_10005847 3300026089 Bacteria 12315
256 Ga0207648_10657697 3300026089 Unclassified 969
257 Ga0207676_10630276 3300026095 Unclassified 1033
258 Ga0207676_10646324 3300026095 Bacteria 1020
259 Ga0207674_10924918 3300026116 Unclassified 840
260 Ga0207675_100037703 3300026118 Bacteria 4509
261 Ga0207675_100104143 3300026118 Unclassified 2674
262 Ga0207675_100208750 3300026118 Bacteria 1878
263 Ga0207675_100227032 3300026118 Bacteria 1800
264 Ga0207675_101436135 3300026118 Bacteria 711
265 Ga0207675_101559965 3300026118 Bacteria 681
266 Ga0207683_10088233 3300026121 Bacteria 2759
267 Ga0207698_10608042 3300026142 Unclassified 1078
268 Ga0209970_1010834 3300027614 Bacteria 1495
269 Ga0209971_1094528 3300027682 Bacteria 730
270 Ga0209966_1140031 3300027695 Unclassified 561
271 Ga0209813_10151925 3300027866 Bacteria 830
272 Ga0207428_10000167 3300027907 Bacteria 91345
273 Ga0207428_11114300 3300027907 Bacteria 551
274 Ga0268266_11729095 3300028379 Unclassified 601
275 Ga0268265_10009392 3300028380 Bacteria 6608
276 Ga0268265_10208266 3300028380 Bacteria 1702
277 Ga0268264_12035696 3300028381 Bacteria 583
278 Ga0316579_10244384 3300031691 Bacteria 868
279 Ga0316576_10027090 3300031727 Bacteria 4027
280 Ga0316576_10381901 3300031727 Bacteria 1046
281 Ga0307416_100448056 3300032002 Bacteria 1343
282 Ga0307416_102108419 3300032002 Bacteria 666
283 Ga0316583_10175712 3300032133 Bacteria 745
284 Ga0316593_10212314 3300032168 Bacteria 717
285 Ga0316592_1013899 3300033524 Bacteria 1665
286 Ga0316592_1015961 3300033524 Bacteria 1567
287 Ga0316592_1053198 3300033524 Bacteria 905
288 Ga0316588_1007957 3300033528 Bacteria 2168
289 Ga0316596_1078370 3300033541 Bacteria 887
290 Ga0316596_1165661 3300033541 Bacteria 609
291 Ga0373940_0012695 3300035088 Unclassified 2022
292 Ga0373932_0241843 3300035112 Unclassified 656
293 Ga0373939_0479880 3300035114 Bacteria 528
294 Ga0373941_0108406 3300035115 Bacteria 976
295 Ga0373933_0811005 3300035724 Unclassified 616
296 Ga0316582_0364696 3300036647 Unclassified 994
297 Ga0316584_1196441 3300036712 Unclassified 501
298 Ga0451577_0431394 3300042876 Bacteria 1197
299 Ga0453684_0005879 3300044712 Bacteria 23824
300 Ga0453684_1051318 3300044712 Bacteria 863
301 Ga0495638_0008197 3300046460 Bacteria 7429
302 Ga0495656_0020462 3300046615 Bacteria 2567
303 Ga0495672_0000397 3300047320 Bacteria 53007
304 Ga0496109_0640165 3300048912 Bacteria 1000
305 Ga0501031_0096979 3300049568 Bacteria 1924
306 Ga0501032_1058271 3300049569 Bacteria 509
307 Ga0501036_0043726 3300049572 Bacteria 3794
308 Ga0501036_1619192 3300049572 Bacteria 523
309 Ga0501037_1002737 3300049573 Bacteria 544
310 Ga0501038_0651091 3300049574 Unclassified 793
311 Ga0501040_0320037 3300049576 Bacteria 1109
312 Ga0501040_1332896 3300049576 Bacteria 521
313 Ga0501041_0070276 3300049577 Bacteria 2149
314 Ga0501041_0203936 3300049577 Bacteria 1240
315 Ga0501042_0130216 3300049578 Bacteria 1813
316 Ga0501043_0943011 3300049579 Bacteria 617
317 Ga0501046_0202878 3300049580 Bacteria 1475
318 Ga0501048_0267792 3300049582 Bacteria 1214
319 Ga0501071_0030935 3300049587 Bacteria 3790
320 Ga0501072_0333046 3300049588 Bacteria 1206
321 Ga0501072_0408281 3300049588 Bacteria 1077
322 Ga0501072_1562228 3300049588 Bacteria 509
323 Ga0501073_0389932 3300049589 Bacteria 962
324 Ga0501074_0658059 3300049590 Bacteria 740
325 Ga0501075_0066738 3300049591 Bacteria 2715
326 Ga0501075_0068335 3300049591 Bacteria 2684
327 Ga0501075_0187676 3300049591 Bacteria 1577
328 Ga0501076_0012382 3300049592 Bacteria 6376
329 Ga0501076_0013047 3300049592 Bacteria 6222
330 Ga0501076_0021428 3300049592 Bacteria 4957
331 Ga0501076_0274077 3300049592 Bacteria 1382
332 Ga0501076_0666412 3300049592 Bacteria 859
333 Ga0501077_0740958 3300049593 Unclassified 632
334 Ga0501079_0154322 3300049741 Bacteria 1790
335 Ga0501079_0450405 3300049741 Bacteria 1011
336 Ga0501079_1516540 3300049741 Unclassified 527
337 Ga0501080_0475820 3300049742 Bacteria 1118
338 Ga0501081_0055222 3300049743 Bacteria 2744
339 Ga0501044_0355847 3300049823 Bacteria 1383
340 Ga0501045_0289919 3300049824 Bacteria 1218
341 nmdc:mga03683_65132_c1 3300050489 Bacteria 1548
342 nmdc:mga03n38_35919_c1 3300050490 Bacteria 2127
343 nmdc:mga03n38_409099_c1 3300050490 Unclassified 748
344 nmdc:mga03n38_413928_c1 3300050490 Bacteria 744
345 nmdc:mga00v17_32691_c1 3300050491 Bacteria 3077
346 nmdc:mga00v17_85413_c1 3300050491 Bacteria 1976
347 nmdc:mga00v17_93047_c1 3300050491 Bacteria 1895
348 nmdc:mga0yw44_48773_c1 3300050492 Bacteria 2554
349 nmdc:mga0yw44_789617_c1 3300050492 Bacteria 645
350 nmdc:mga0k408_569_c1 3300050493 Bacteria 20349
351 nmdc:mga06z11_110825_c1 3300050494 Unclassified 1519
352 nmdc:mga06z11_17078_c1 3300050494 Bacteria 3285
353 nmdc:mga06z11_351073_c1 3300050494 Bacteria 883
354 nmdc:mga06z11_8377_c1 3300050494 Bacteria 4308
355 nmdc:mga04h51_176479_c1 3300050495 Bacteria 830
356 nmdc:mga04h51_24375_c1 3300050495 Bacteria 1852
357 nmdc:mga07m45_18788_c1 3300050496 Bacteria 3738
358 nmdc:mga07m45_242356_c1 3300050496 Bacteria 1049
359 nmdc:mga05p37_1125747_c1 3300050507 Bacteria 819
360 nmdc:mga05p37_1410646_c1 3300050507 Unclassified 701
361 nmdc:mga05p37_1645303_c1 3300050507 Bacteria 629
362 nmdc:mga05p37_267616_c1 3300050507 Bacteria 2043
363 nmdc:mga05p37_28128_c1 3300050507 Bacteria 6852
364 nmdc:mga05p37_32598_c1 3300050507 Bacteria 6372
365 nmdc:mga05p37_32936_c1 3300050507 Bacteria 6344
366 nmdc:mga05p37_42815_c1 3300050507 Bacteria 5566
367 nmdc:mga05p37_468301_c1 3300050507 Bacteria 1454
368 nmdc:mga05p37_51765_c1 3300050507 Bacteria 5049
369 nmdc:mga05p37_609253_c1 3300050507 Bacteria 1231
370 nmdc:mga05p37_62755_c1 3300050507 Bacteria 4573
371 nmdc:mga09592_104066_c1 3300050508 Bacteria 2433
372 nmdc:mga09592_170237_c1 3300050508 Bacteria 1883
373 nmdc:mga09592_172778_c1 3300050508 Bacteria 1869
374 nmdc:mga09592_221949_c1 3300050508 Bacteria 1637
375 nmdc:mga09592_31076_c1 3300050508 Bacteria 4448
376 nmdc:mga09592_64809_c1 3300050508 Bacteria 3094
377 nmdc:mga0qj67_16489_c1 3300050509 Bacteria 5605
378 nmdc:mga06r32_32231_c1 3300050510 Bacteria 4928
379 nmdc:mga06r32_354459_c1 3300050510 Bacteria 1452
380 nmdc:mga06r32_758737_c1 3300050510 Bacteria 933
381 nmdc:mga06r32_9318_c1 3300050510 Bacteria 8851
382 nmdc:mga08y16_3112_c1 3300050511 Bacteria 17186
383 nmdc:mga08y16_32379_c1 3300050511 Bacteria 5497
384 nmdc:mga08y16_57009_c1 3300050511 Bacteria 4083
385 nmdc:mga08y16_637316_c1 3300050511 Unclassified 1071
386 nmdc:mga0n895_110864_c1 3300050512 Bacteria 2760
387 nmdc:mga0n895_130894_c1 3300050512 Bacteria 2534
388 nmdc:mga0n895_206138_c1 3300050512 Bacteria 1997
389 nmdc:mga0n895_368774_c1 3300050512 Bacteria 1454
390 nmdc:mga0n895_544936_c1 3300050512 Bacteria 1166
391 nmdc:mga0rr50_100056_c1 3300050513 Unclassified 2276
392 nmdc:mga0rr50_111365_c1 3300050513 Bacteria 2166
393 nmdc:mga0rr50_1709391_c1 3300050513 Bacteria 530
394 nmdc:mga0rr50_6311_c1 3300050513 Bacteria 7202
395 nmdc:mga08x19_32055_c1 3300050514 Bacteria 3310
396 nmdc:mga0a205_452235_c1 3300050515 Bacteria 1144
397 nmdc:mga0a205_59670_c1 3300050515 Bacteria 3685
398 nmdc:mga0a205_603241_c1 3300050515 Unclassified 951
399 nmdc:mga0a205_7467_c1 3300050515 Bacteria 9899
400 Ga0501084_0103280 3300054114 Bacteria 2394
401 Ga0501084_0545544 3300054114 Bacteria 980
402 Ga0501084_0698737 3300054114 Bacteria 855
403 Ga0501082_0039514 3300060353 Bacteria 4070
404 Ga0501082_0154359 3300060353 Bacteria 1995
405 Ga0501082_0170494 3300060353 Bacteria 1892
406 Ga0501082_0360890 3300060353 Bacteria 1267
407 Ga0501082_1056364 3300060353 Bacteria 710
408 Ga0530510_0164478 3300061734 Bacteria 1642
409 Ga0530510_0699103 3300061734 Unclassified 772
410 Ga0530510_1170969 3300061734 Bacteria 589
411 Ga0111539_10053870
412 Ga0070676_10061525
413 Ga0070676_11137417
414 Ga0070690_100088436
415 Ga0070677_10329378
416 Ga0070677_10917840
417 Ga0070680_101078460
418 Ga0070682_100623342
419 Ga0068868_100430893
420 Ga0070689_100003521
421 Ga0070689_100030205
422 Ga0070689_100728774
423 Ga0070687_100063151
424 Ga0070687_100549473
425 Ga0070692_10581814
426 Ga0070668_101769794
427 Ga0070669_100532114
428 Ga0070669_101428767
429 Ga0070669_101728048
430 Ga0070675_100338320
431 Ga0070675_101095764
432 Ga0070671_101110579
433 Ga0070673_100029346
434 Ga0070673_100151884
435 Ga0070688_100019154
436 Ga0070667_100029306
437 Ga0070703_10165280
438 Ga0070701_10037120
439 Ga0070701_10140668
440 Ga0070701_10318872
441 Ga0070705_100106177
442 Ga0070700_100039591
443 Ga0070700_100068343
444 Ga0070700_100733000
445 Ga0070694_100021331
446 Ga0070694_100745718
447 Ga0070694_100955794
448 Ga0070708_100080041
449 Ga0070708_100108622
450 Ga0070708_100184850
451 Ga0070708_101024971
452 Ga0070708_101914238
453 Ga0070663_100097513
454 Ga0070678_100145276
455 Ga0070662_100362761
456 Ga0070681_11357067
457 Ga0068867_100075754
458 Ga0068867_101251054
459 Ga0070685_10124131
460 Ga0070685_10995631
461 Ga0070706_100004931
462 Ga0070706_100020725
463 Ga0070706_100670220
464 Ga0070706_101546587
465 Ga0070706_101967244
466 Ga0070707_100021790
467 Ga0070707_100058360
468 Ga0070707_101148766
469 Ga0070698_100009915
470 Ga0070698_100040761
471 Ga0070698_100669253
472 Ga0070699_100010559
473 Ga0070699_100046235
474 Ga0070699_100112077
475 Ga0070699_100156189
476 Ga0070697_100180980
477 Ga0070697_100203179
478 Ga0070697_100663625
479 Ga0070672_100403722
480 Ga0070672_100606015
481 Ga0070686_100003198
482 Ga0070695_100006052
483 Ga0070695_100499747
484 Ga0070695_100525264
485 Ga0070695_101287167
486 Ga0070695_101526984
487 Ga0070695_101900472
488 Ga0070696_100398863
489 Ga0070696_100424267
490 Ga0070696_101724902
491 Ga0070693_101241217
492 Ga0070704_100025382
493 Ga0070704_100040295
494 Ga0070704_100076370
495 Ga0070704_100145069
496 Ga0070704_100922419
497 Ga0070664_100254160
498 Ga0070664_100540519
499 Ga0068854_100576454
500 Ga0070702_100121920
501 Ga0068852_100466911
502 Ga0068859_100029354
503 Ga0068859_100127561
504 Ga0068859_100553132
505 Ga0068864_100058951
506 Ga0068864_101725882
507 Ga0068866_10080561
508 Ga0068861_100476586
509 Ga0068861_101295577
510 Ga0068861_101441255
511 Ga0068870_10743019
512 Ga0068858_100027698
513 Ga0068860_101476138
514 Ga0068862_100043098
515 Ga0068862_100154464
516 Ga0075365_10005854
517 Ga0075368_10167811
518 Ga0075368_10195476
519 Ga0075363_100084271
520 Ga0075363_100476975
521 Ga0075363_100711173
522 Ga0075364_10006503
523 Ga0075364_10039389
524 Ga0075364_10841342
525 Ga0075362_10007040
526 Ga0075367_10000544
527 Ga0075367_10005334
528 Ga0075367_10170146
529 Ga0075367_10206867
530 Ga0075369_10182677
531 Ga0075366_10001280
532 Ga0097621_100457228
533 Ga0075370_10028296
534 Ga0068871_100124615
535 Ga0075428_100016336
536 Ga0075428_100026496
537 Ga0075428_100026875
538 Ga0075428_100093910
539 Ga0075428_100107381
540 Ga0075428_100141649
541 Ga0075428_100303314
542 Ga0075428_100552908
543 Ga0075428_100661005
544 Ga0075428_100696364
545 Ga0075428_100704510
546 Ga0075428_101516381
547 Ga0075428_102160190
548 Ga0075430_100023405
549 Ga0075430_100363049
550 Ga0075430_100438600
551 Ga0075430_100562033
552 Ga0075430_101723409
553 Ga0075431_100000909
554 Ga0075431_100231043
555 Ga0075431_100232890
556 Ga0075431_101869893
557 Ga0075433_10075122
558 Ga0075433_10135197
559 Ga0075433_10199192
560 Ga0075434_100009347
561 Ga0075434_100187399
562 Ga0075434_100310278
563 Ga0075434_100526954
564 Ga0075434_100832561
565 Ga0075429_100009682
566 Ga0075429_100011149
567 Ga0075429_100254931
568 Ga0075429_100371438
569 Ga0068865_100015068
570 Ga0075436_100153022
571 Ga0097620_100029354
572 Ga0097620_100127546
573 Ga0097620_100553102
574 Ga0075435_100027006
575 Ga0075435_100029398
576 Ga0075435_100365275
577 Ga0075435_101398844
578 Ga0099795_10060923
579 Ga0111539_10001712
580 Ga0111539_10011102
581 Ga0111539_10294030
582 Ga0111539_12220485
583 Ga0105245_10015771
584 Ga0114129_10013588
585 Ga0114129_10032719
586 Ga0114129_10063682
587 Ga0114129_10121703
588 Ga0114129_10137921
589 Ga0114129_10175335
590 Ga0114129_10546398
591 Ga0114129_10599795
592 Ga0114129_11036254
593 Ga0114129_11295093
594 Ga0114129_11384435
595 Ga0114129_11417065
596 Ga0114129_11802511
597 Ga0114129_12567641
598 Ga0105243_10216366
599 Ga0105241_10569437
600 Ga0105242_10137596
601 Ga0105248_10347836
602 Ga0105249_10253749
603 Ga0105249_10814447
604 Ga0105246_10533983
605 Ga0157378_10448184
606 Ga0163162_10310310
607 Ga0157375_10228085
608 Ga0157375_10940391
609 Ga0157375_11640603
610 Ga0163163_11173501
611 Ga0157380_10009264
612 Ga0157380_10018288
613 Ga0157380_10601185
614 Ga0157380_10739632
615 Ga0157380_12032161
616 Ga0157377_10065341
617 Ga0157377_10321315
618 Ga0157376_11721368
619 Ga0163161_10710901
620 Ga0207653_10020496
621 Ga0207682_10464919
622 Ga0207680_10141033
623 Ga0207643_10688302
624 Ga0207684_10000858
625 Ga0207684_10571031
626 Ga0207684_11338122
627 Ga0207684_11350251
628 Ga0207707_11065579
629 Ga0207662_10000634
630 Ga0207646_10002741
631 Ga0207646_10031936
632 Ga0207681_11596081
633 Ga0207659_10530283
634 Ga0207659_10968282
635 Ga0207644_10616020
636 Ga0207644_11250487
637 Ga0207706_10018321
638 Ga0207706_10199044
639 Ga0207686_10678620
640 Ga0207709_10846511
641 Ga0207670_10006464
642 Ga0207669_10263976
643 Ga0207704_10224555
644 Ga0207691_10024678
645 Ga0207691_10056817
646 Ga0207711_10225301
647 Ga0207711_11570889
648 Ga0207689_10003286
649 Ga0207679_10123505
650 Ga0207651_10067810
651 Ga0207651_10102848
652 Ga0207712_10607380
653 Ga0207640_10634328
654 Ga0207658_10495595
655 Ga0207677_10324830
656 Ga0207703_10024827
657 Ga0207639_11551327
658 Ga0207678_10145282
659 Ga0207708_10003999
660 Ga0207708_10077399
661 Ga0207708_10573784
662 Ga0207708_10896331
663 Ga0207641_10037531
664 Ga0207641_12211416
665 Ga0207648_10005847
666 Ga0207648_10657697
667 Ga0207676_10630276
668 Ga0207676_10646324
669 Ga0207674_10924918
670 Ga0207675_100037703
671 Ga0207675_100104143
672 Ga0207675_100208750
673 Ga0207675_100227032
674 Ga0207675_101436135
675 Ga0207675_101559965
676 Ga0207683_10088233
677 Ga0207698_10608042
678 Ga0209970_1010834
679 Ga0209971_1094528
680 Ga0209966_1140031
681 Ga0209813_10151925
682 Ga0207428_10000167
683 Ga0207428_11114300
684 Ga0268266_11729095
685 Ga0268265_10009392
686 Ga0268265_10208266
687 Ga0268264_12035696
688 Ga0316579_10244384
689 Ga0316576_10027090
690 Ga0316576_10381901
691 Ga0307416_100448056
692 Ga0307416_102108419
693 Ga0316583_10175712
694 Ga0316593_10212314
695 Ga0316592_1013899
696 Ga0316592_1015961
697 Ga0316592_1053198
698 Ga0316588_1007957
699 Ga0316596_1078370
700 Ga0316596_1165661
701 Ga0373940_0012695
702 Ga0373932_0241843
703 Ga0373939_0479880
704 Ga0373941_0108406
705 Ga0373933_0811005
706 Ga0316582_0364696
707 Ga0316584_1196441
708 Ga0451577_0431394
709 Ga0453684_0005879
710 Ga0453684_1051318
711 Ga0495638_0008197
712 Ga0495656_0020462
713 Ga0495672_0000397
714 Ga0496109_0640165
715 Ga0501031_0096979
716 Ga0501032_1058271
717 Ga0501036_0043726
718 Ga0501036_1619192
719 Ga0501037_1002737
720 Ga0501038_0651091
721 Ga0501040_0320037
722 Ga0501040_1332896
723 Ga0501041_0070276
724 Ga0501041_0203936
725 Ga0501042_0130216
726 Ga0501043_0943011
727 Ga0501046_0202878
728 Ga0501048_0267792
729 Ga0501071_0030935
730 Ga0501072_0333046
731 Ga0501072_0408281
732 Ga0501072_1562228
733 Ga0501073_0389932
734 Ga0501074_0658059
735 Ga0501075_0066738
736 Ga0501075_0068335
737 Ga0501075_0187676
738 Ga0501076_0012382
739 Ga0501076_0013047
740 Ga0501076_0021428
741 Ga0501076_0274077
742 Ga0501076_0666412
743 Ga0501077_0740958
744 Ga0501079_0154322
745 Ga0501079_0450405
746 Ga0501079_1516540
747 Ga0501080_0475820
748 Ga0501081_0055222
749 Ga0501044_0355847
750 Ga0501045_0289919
751 nmdc:mga03683_65132_c1
752 nmdc:mga03n38_35919_c1
753 nmdc:mga03n38_409099_c1
754 nmdc:mga03n38_413928_c1
755 nmdc:mga00v17_32691_c1
756 nmdc:mga00v17_85413_c1
757 nmdc:mga00v17_93047_c1
758 nmdc:mga0yw44_48773_c1
759 nmdc:mga0yw44_789617_c1
760 nmdc:mga0k408_569_c1
761 nmdc:mga06z11_110825_c1
762 nmdc:mga06z11_17078_c1
763 nmdc:mga06z11_351073_c1
764 nmdc:mga06z11_8377_c1
765 nmdc:mga04h51_176479_c1
766 nmdc:mga04h51_24375_c1
767 nmdc:mga07m45_18788_c1
768 nmdc:mga07m45_242356_c1
769 nmdc:mga05p37_1125747_c1
770 nmdc:mga05p37_1410646_c1
771 nmdc:mga05p37_1645303_c1
772 nmdc:mga05p37_267616_c1
773 nmdc:mga05p37_28128_c1
774 nmdc:mga05p37_32598_c1
775 nmdc:mga05p37_32936_c1
776 nmdc:mga05p37_42815_c1
777 nmdc:mga05p37_468301_c1
778 nmdc:mga05p37_51765_c1
779 nmdc:mga05p37_609253_c1
780 nmdc:mga05p37_62755_c1
781 nmdc:mga09592_104066_c1
782 nmdc:mga09592_170237_c1
783 nmdc:mga09592_172778_c1
784 nmdc:mga09592_221949_c1
785 nmdc:mga09592_31076_c1
786 nmdc:mga09592_64809_c1
787 nmdc:mga0qj67_16489_c1
788 nmdc:mga06r32_32231_c1
789 nmdc:mga06r32_354459_c1
790 nmdc:mga06r32_758737_c1
791 nmdc:mga06r32_9318_c1
792 nmdc:mga08y16_3112_c1
793 nmdc:mga08y16_32379_c1
794 nmdc:mga08y16_57009_c1
795 nmdc:mga08y16_637316_c1
796 nmdc:mga0n895_110864_c1
797 nmdc:mga0n895_130894_c1
798 nmdc:mga0n895_206138_c1
799 nmdc:mga0n895_368774_c1
800 nmdc:mga0n895_544936_c1
801 nmdc:mga0rr50_100056_c1
802 nmdc:mga0rr50_111365_c1
803 nmdc:mga0rr50_1709391_c1
804 nmdc:mga0rr50_6311_c1
805 nmdc:mga08x19_32055_c1
806 nmdc:mga0a205_452235_c1
807 nmdc:mga0a205_59670_c1
808 nmdc:mga0a205_603241_c1
809 nmdc:mga0a205_7467_c1
810 Ga0501084_0103280
811 Ga0501084_0545544
812 Ga0501084_0698737
813 Ga0501082_0039514
814 Ga0501082_0154359
815 Ga0501082_0170494
816 Ga0501082_0360890
817 Ga0501082_1056364
818 Ga0530510_0164478
819 Ga0530510_0699103
820 Ga0530510_1170969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00829

Ribosomal_L21p

Ribosomal prokaryotic L21 protein

21

121

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhn-assembly1.cif.gz_U vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9098 1 104
8cgd-assembly1.cif.gz_q clindamycin bound to the 50s subunit 0.909 1 105
7p7u-assembly1.cif.gz_U e. faecalis 70s ribosome with p-trna, state iv 0.9053 1 104
7nhn-assembly1.cif.gz_U vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9014 1 104
8cgd-assembly1.cif.gz_q clindamycin bound to the 50s subunit 0.9006 1 105
ID Description Score Start End Superfamily
af_C0H4Y5_87_186_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.9214 2 102 2.40.10.190
af_C0H4Y5_87_186_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.9127 2 102 2.40.10.190
af_Q54IF0_61_161_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.9071 1 102 2.40.10.190
af_Q2FXS8_1_100_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8952 1 102 2.40.10.190
af_Q4DUK1_23_123_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8924 1 102 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7C3LIK7-F1-model_v4 Large ribosomal subunit protein bL21 0.9252 1 105 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6L5C5Q6-F1-model_v4 deleted 0.9231 1 102
AF-A0A522U108-F1-model_v4 Large ribosomal subunit protein bL21 0.9223 2 103 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6J4UD25-F1-model_v4 Large ribosomal subunit protein bL21 0.9222 2 105 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A539CRB1-F1-model_v4 Large ribosomal subunit protein bL21 0.9215 2 105 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map