F437211

General Info

Members Datasets Scaffolds Average Seq Length
410 171 820 262

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100084011|Ga0075430_1000840112
Length 302
Sequence MREPWAESAEESDTLSLVRRALMNLMRNRFSLLMWIAAATLSAVVSTHTQWLHSPTAGAPRTRDGKVDMTGRVPRVDGKPDLSGLWQVQGDPRAPGGLFGLGESLNSRYFRNVLADYPADKAPLTPDGLARLKQNLQPTTFNPVLNCLPDGVPHGDLLPEPFKVVHSKGVILFLYEVETTFRQVFMDGRKLPIDPSPAWQGYSVGRWEGDTLVVDTIGFNDRSWLDARGTPHSEDMRVEERFRRRDYGHMDLTITITDPKTFTQPITFSVVLDLMPDTDLLEHYCAENEKDDARIRGAASRK

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 1.22
Rhizosphere 98.54
Stem 0
Stem Tuber 0
Unclassified 34.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100084011 3300006846 Bacteria 2667
2 JGI24746J21847_1001196 3300001977 Unclassified 4113
3 JGI25406J46586_10000181 3300003203 Bacteria 28391
4 JGI25406J46586_10003951 3300003203 Bacteria 6934
5 Ga0065704_10107514 3300005289 Bacteria 2053
6 Ga0065704_10123360 3300005289 Bacteria 1734
7 Ga0065712_10011823 3300005290 Unclassified 2178
8 Ga0065712_10067780 3300005290 Bacteria 37076
9 Ga0065712_10067795 3300005290 Bacteria 33443
10 Ga0065712_10079372 3300005290 Bacteria 3225
11 Ga0065712_10193460 3300005290 Bacteria 1138
12 Ga0065715_10004319 3300005293 Unclassified 4564
13 Ga0065715_10120406 3300005293 Unclassified 2259
14 Ga0065707_10002523 3300005295 Bacteria 4629
15 Ga0070658_10030222 3300005327 Bacteria 4353
16 Ga0070676_10009929 3300005328 Bacteria 5153
17 Ga0070676_10031768 3300005328 Bacteria 3020
18 Ga0070683_100077299 3300005329 Unclassified 3112
19 Ga0070690_100028225 3300005330 Bacteria 3475
20 Ga0070670_100008991 3300005331 Bacteria 8533
21 Ga0070670_100040430 3300005331 Unclassified 4009
22 Ga0070670_100062692 3300005331 Unclassified 3191
23 Ga0070677_10011161 3300005333 Unclassified 3090
24 Ga0070677_10046776 3300005333 Bacteria 1732
25 Ga0068869_100001443 3300005334 Bacteria 14071
26 Ga0068869_100033322 3300005334 Bacteria 3636
27 Ga0068869_100036473 3300005334 Bacteria 3491
28 Ga0068869_100430001 3300005334 Unclassified 1091
29 Ga0070666_10006887 3300005335 Bacteria 7002
30 Ga0070666_10032810 3300005335 Bacteria 3432
31 Ga0070666_10048334 3300005335 Bacteria 2858
32 Ga0070689_100056418 3300005340 Unclassified 3045
33 Ga0070687_100030121 3300005343 Bacteria 2650
34 Ga0070687_100160399 3300005343 Unclassified 1329
35 Ga0070661_100082088 3300005344 Bacteria 2381
36 Ga0070661_100095498 3300005344 Bacteria 2205
37 Ga0070668_100027700 3300005347 Bacteria 4302
38 Ga0070668_100093490 3300005347 Unclassified 2373
39 Ga0070668_100104659 3300005347 Bacteria 2246
40 Ga0070669_100266455 3300005353 Unclassified 1368
41 Ga0070669_100309563 3300005353 Bacteria 1273
42 Ga0070675_100011894 3300005354 Bacteria 6820
43 Ga0070675_100022247 3300005354 Bacteria 5064
44 Ga0070675_100037372 3300005354 Unclassified 3955
45 Ga0070675_100078732 3300005354 Bacteria 2745
46 Ga0070675_100082029 3300005354 Bacteria 2690
47 Ga0070675_100227164 3300005354 Bacteria 1627
48 Ga0070674_100141526 3300005356 Bacteria 1806
49 Ga0070673_100006293 3300005364 Bacteria 7705
50 Ga0070673_100026356 3300005364 Bacteria 4292
51 Ga0070673_100289271 3300005364 Bacteria 1439
52 Ga0070688_100043255 3300005365 Unclassified 2774
53 Ga0070688_100245388 3300005365 Bacteria 1273
54 Ga0070659_100192002 3300005366 Bacteria 1679
55 Ga0070667_100165343 3300005367 Bacteria 1951
56 Ga0070667_100235944 3300005367 Unclassified 1632
57 Ga0070703_10060848 3300005406 Bacteria 1235
58 Ga0070701_10002044 3300005438 Bacteria 7662
59 Ga0070700_100003395 3300005441 Bacteria 8212
60 Ga0070700_100042562 3300005441 Bacteria 2789
61 Ga0070694_100175364 3300005444 Bacteria 1582
62 Ga0070678_100066026 3300005456 Bacteria 2688
63 Ga0070678_100086941 3300005456 Unclassified 2386
64 Ga0070678_100379335 3300005456 Bacteria 1223
65 Ga0070662_100027105 3300005457 Unclassified 3974
66 Ga0070662_100186704 3300005457 Unclassified 1637
67 Ga0070681_10196273 3300005458 Bacteria 1937
68 Ga0068867_100005906 3300005459 Bacteria 8684
69 Ga0068867_100009144 3300005459 Bacteria 6991
70 Ga0068867_100074975 3300005459 Unclassified 2537
71 Ga0068867_100188490 3300005459 Bacteria 1644
72 Ga0070685_10017420 3300005466 Unclassified 3846
73 Ga0070685_10089021 3300005466 Unclassified 1865
74 Ga0070707_100181501 3300005468 Bacteria 2052
75 Ga0070698_100252882 3300005471 Bacteria 1695
76 Ga0070699_100170102 3300005518 Bacteria 1931
77 Ga0070684_100415626 3300005535 Bacteria 1241
78 Ga0068853_100196486 3300005539 Bacteria 1835
79 Ga0068853_100598275 3300005539 Bacteria 1047
80 Ga0070672_100006991 3300005543 Bacteria 7635
81 Ga0070672_100008470 3300005543 Bacteria 7038
82 Ga0070672_100028847 3300005543 Bacteria 4155
83 Ga0070672_100038357 3300005543 Unclassified 3660
84 Ga0070672_100072596 3300005543 Unclassified 2740
85 Ga0070672_100499903 3300005543 Unclassified 1052
86 Ga0070686_100041759 3300005544 Unclassified 2869
87 Ga0070686_100054954 3300005544 Bacteria 2549
88 Ga0070696_100123796 3300005546 Bacteria 1874
89 Ga0070665_100009511 3300005548 Bacteria 9829
90 Ga0070665_100042104 3300005548 Unclassified 4590
91 Ga0070704_100171066 3300005549 Unclassified 1728
92 Ga0070704_100375763 3300005549 Bacteria 1206
93 Ga0070704_100418866 3300005549 Unclassified 1146
94 Ga0070664_100002672 3300005564 Bacteria 14391
95 Ga0070664_100002714 3300005564 Bacteria 14286
96 Ga0070664_100138644 3300005564 Unclassified 2140
97 Ga0068857_100078440 3300005577 Unclassified 2948
98 Ga0068854_100141806 3300005578 Bacteria 1845
99 Ga0068854_100205775 3300005578 Bacteria 1550
100 Ga0068852_100029568 3300005616 Unclassified 4503
101 Ga0068852_100465976 3300005616 Unclassified 1253
102 Ga0068859_100159911 3300005617 Unclassified 2331
103 Ga0068859_100718027 3300005617 Unclassified 1089
104 Ga0068864_100023183 3300005618 Bacteria 5210
105 Ga0068864_100104079 3300005618 Bacteria 2521
106 Ga0068864_100124069 3300005618 Bacteria 2312
107 Ga0068864_100144708 3300005618 Unclassified 2148
108 Ga0068864_100169333 3300005618 Bacteria 1991
109 Ga0068864_100267502 3300005618 Unclassified 1592
110 Ga0068866_10065330 3300005718 Bacteria 1903
111 Ga0068861_100084285 3300005719 Unclassified 2495
112 Ga0068861_100104637 3300005719 Unclassified 2259
113 Ga0068861_100289762 3300005719 Unclassified 1413
114 Ga0068870_10006831 3300005840 Bacteria 5061
115 Ga0068870_10037078 3300005840 Unclassified 2512
116 Ga0068870_10050208 3300005840 Unclassified 2203
117 Ga0068863_100023500 3300005841 Bacteria 5885
118 Ga0068863_100044803 3300005841 Bacteria 4198
119 Ga0068863_100408437 3300005841 Unclassified 1329
120 Ga0068863_100522048 3300005841 Unclassified 1171
121 Ga0068858_100004008 3300005842 Bacteria 14532
122 Ga0068858_100013337 3300005842 Bacteria 7752
123 Ga0068858_100053943 3300005842 Bacteria 3718
124 Ga0068858_100147133 3300005842 Bacteria 2213
125 Ga0068858_100152085 3300005842 Bacteria 2176
126 Ga0068860_100226874 3300005843 Bacteria 1815
127 Ga0068860_100233077 3300005843 Unclassified 1789
128 Ga0068862_100014568 3300005844 Bacteria 6529
129 Ga0081539_10000017 3300005985 Bacteria 375107
130 Ga0081539_10000285 3300005985 Bacteria 114370
131 Ga0081539_10019259 3300005985 Bacteria 4682
132 Ga0081539_10026762 3300005985 Bacteria 3669
133 Ga0081539_10052487 3300005985 Unclassified 2289
134 Ga0097621_100016393 3300006237 Bacteria 5601
135 Ga0097621_100135975 3300006237 Unclassified 2097
136 Ga0097621_100226205 3300006237 Unclassified 1632
137 Ga0068871_100009767 3300006358 Bacteria 6964
138 Ga0068871_100080633 3300006358 Unclassified 2695
139 Ga0068871_100120858 3300006358 Bacteria 2212
140 Ga0075428_100001910 3300006844 Bacteria 22363
141 Ga0075430_100000208 3300006846 Bacteria 40199
142 Ga0075430_100055166 3300006846 Bacteria 3342
143 Ga0075430_100066056 3300006846 Bacteria 3038
144 Ga0075430_100110114 3300006846 Bacteria 2297
145 Ga0075430_100117589 3300006846 Unclassified 2216
146 Ga0075431_100008497 3300006847 Bacteria 10279
147 Ga0075431_100011969 3300006847 Bacteria 8752
148 Ga0075431_100164448 3300006847 Unclassified 2281
149 Ga0075431_100208309 3300006847 Bacteria 1998
150 Ga0075433_10001433 3300006852 Bacteria 17582
151 Ga0075433_10001587 3300006852 Bacteria 16834
152 Ga0075433_10127532 3300006852 Unclassified 2260
153 Ga0075434_100030924 3300006871 Bacteria 5276
154 Ga0075434_100160088 3300006871 Unclassified 2271
155 Ga0075429_100006925 3300006880 Bacteria 9849
156 Ga0075429_100043187 3300006880 Bacteria 3922
157 Ga0075429_100060108 3300006880 Unclassified 3311
158 Ga0075429_100087142 3300006880 Bacteria 2721
159 Ga0075429_100178153 3300006880 Unclassified 1863
160 Ga0075429_100191667 3300006880 Bacteria 1791
161 Ga0068865_100006125 3300006881 Bacteria 7334
162 Ga0068865_100018066 3300006881 Bacteria 4545
163 Ga0068865_100046979 3300006881 Bacteria 2964
164 Ga0068865_100121604 3300006881 Bacteria 1942
165 Ga0068865_100323268 3300006881 Unclassified 1242
166 Ga0097620_100159924 3300006931 Unclassified 2331
167 Ga0097620_100718051 3300006931 Bacteria 1089
168 Ga0105240_10036313 3300009093 Bacteria 6341
169 Ga0105240_11043617 3300009093 Bacteria 872
170 Ga0111539_10001092 3300009094 Bacteria 35851
171 Ga0111539_10001941 3300009094 Bacteria 27564
172 Ga0111539_10020426 3300009094 Bacteria 8156
173 Ga0111539_10026937 3300009094 Bacteria 7022
174 Ga0111539_10038840 3300009094 Bacteria 5742
175 Ga0111539_10137216 3300009094 Bacteria 2864
176 Ga0111539_10554207 3300009094 Bacteria 1339
177 Ga0111539_10794682 3300009094 Unclassified 1101
178 Ga0105245_10008278 3300009098 Bacteria 9087
179 Ga0105245_10037291 3300009098 Unclassified 4322
180 Ga0105245_10325805 3300009098 Bacteria 1515
181 Ga0114129_10022061 3300009147 Bacteria 9036
182 Ga0114129_10053896 3300009147 Bacteria 5641
183 Ga0114129_10160497 3300009147 Bacteria 3071
184 Ga0114129_10190760 3300009147 Unclassified 2783
185 Ga0114129_10559546 3300009147 Bacteria 1486
186 Ga0114129_10921867 3300009147 Bacteria 1105
187 Ga0105243_10437661 3300009148 Bacteria 1223
188 Ga0105241_10045319 3300009174 Bacteria 3336
189 Ga0105241_10057373 3300009174 Unclassified 2987
190 Ga0105242_10009406 3300009176 Bacteria 7494
191 Ga0105242_10246434 3300009176 Unclassified 1608
192 Ga0105248_10168585 3300009177 Unclassified 2468
193 Ga0105248_10327163 3300009177 Bacteria 1726
194 Ga0105248_10349791 3300009177 Bacteria 1664
195 Ga0105248_10377548 3300009177 Bacteria 1596
196 Ga0105248_10381654 3300009177 Bacteria 1587
197 Ga0105248_10508667 3300009177 Bacteria 1358
198 Ga0105237_10080496 3300009545 Unclassified 3248
199 Ga0105237_10169036 3300009545 Unclassified 2186
200 Ga0105237_10335731 3300009545 Bacteria 1516
201 Ga0105238_10019934 3300009551 Bacteria 6825
202 Ga0105238_10132399 3300009551 Bacteria 2472
203 Ga0105249_10055034 3300009553 Unclassified 3638
204 Ga0105249_10140012 3300009553 Bacteria 2319
205 Ga0105249_10930799 3300009553 Unclassified 937
206 Ga0105239_10033695 3300010375 Bacteria 5624
207 Ga0105239_10135220 3300010375 Bacteria 2744
208 Ga0105246_10005106 3300011119 Bacteria 7984
209 Ga0105246_10012696 3300011119 Bacteria 5264
210 Ga0105246_10399032 3300011119 Bacteria 1141
211 Ga0157371_10237178 3300013102 Bacteria 1311
212 Ga0157370_10069118 3300013104 Bacteria 3336
213 Ga0157369_10079890 3300013105 Unclassified 3502
214 Ga0157378_10013601 3300013297 Bacteria 7118
215 Ga0157378_10224665 3300013297 Bacteria 1786
216 Ga0157378_10322888 3300013297 Unclassified 1500
217 Ga0163162_10057627 3300013306 Unclassified 3913
218 Ga0163162_10104073 3300013306 Bacteria 2933
219 Ga0163162_10393028 3300013306 Unclassified 1519
220 Ga0157372_10281571 3300013307 Bacteria 1933
221 Ga0157372_10448638 3300013307 Unclassified 1503
222 Ga0157375_10026198 3300013308 Bacteria 5430
223 Ga0157375_10176291 3300013308 Bacteria 2287
224 Ga0157375_10204200 3300013308 Bacteria 2132
225 Ga0157375_10639465 3300013308 Unclassified 1221
226 Ga0163163_10022306 3300014325 Bacteria 5992
227 Ga0163163_10024484 3300014325 Bacteria 5746
228 Ga0163163_10029862 3300014325 Bacteria 5245
229 Ga0157380_10003056 3300014326 Bacteria 11410
230 Ga0157380_10195152 3300014326 Bacteria 1791
231 Ga0157377_10019006 3300014745 Bacteria 3583
232 Ga0157377_10042868 3300014745 Unclassified 2515
233 Ga0157377_10094804 3300014745 Bacteria 1768
234 Ga0157379_10083978 3300014968 Bacteria 2854
235 Ga0157379_10188833 3300014968 Unclassified 1862
236 Ga0157376_10025092 3300014969 Bacteria 4691
237 Ga0157376_10036353 3300014969 Unclassified 3990
238 Ga0163161_10139899 3300017792 Unclassified 1832
239 Ga0207697_10001069 3300025315 Bacteria 15123
240 Ga0207697_10122174 3300025315 Bacteria 1121
241 Ga0207656_10049573 3300025321 Bacteria 1811
242 Ga0207682_10000455 3300025893 Bacteria 18872
243 Ga0207682_10008243 3300025893 Bacteria 4128
244 Ga0207682_10011366 3300025893 Bacteria 3477
245 Ga0207682_10087821 3300025893 Unclassified 1343
246 Ga0207642_10026576 3300025899 Bacteria 2358
247 Ga0207642_10110084 3300025899 Bacteria 1401
248 Ga0207642_10248585 3300025899 Unclassified 1008
249 Ga0207688_10010347 3300025901 Bacteria 5077
250 Ga0207688_10358684 3300025901 Unclassified 899
251 Ga0207680_10053118 3300025903 Unclassified 2431
252 Ga0207645_10001977 3300025907 Bacteria 16474
253 Ga0207643_10000145 3300025908 Bacteria 48099
254 Ga0207643_10046148 3300025908 Bacteria 2462
255 Ga0207643_10064257 3300025908 Unclassified 2100
256 Ga0207643_10065151 3300025908 Bacteria 2087
257 Ga0207643_10069510 3300025908 Unclassified 2024
258 Ga0207707_10020247 3300025912 Bacteria 5807
259 Ga0207695_10050166 3300025913 Unclassified 4393
260 Ga0207695_10113832 3300025913 Bacteria 2681
261 Ga0207671_10021786 3300025914 Bacteria 4856
262 Ga0207662_10002969 3300025918 Bacteria 8634
263 Ga0207662_10017122 3300025918 Unclassified 4097
264 Ga0207657_10147481 3300025919 Unclassified 1918
265 Ga0207649_10471385 3300025920 Unclassified 951
266 Ga0207646_10615988 3300025922 Unclassified 974
267 Ga0207681_10024731 3300025923 Bacteria 3856
268 Ga0207681_10373408 3300025923 Bacteria 1146
269 Ga0207694_10014951 3300025924 Bacteria 5853
270 Ga0207694_10054797 3300025924 Bacteria 3095
271 Ga0207694_10104765 3300025924 Bacteria 2245
272 Ga0207650_10025413 3300025925 Bacteria 4218
273 Ga0207650_10031419 3300025925 Unclassified 3835
274 Ga0207650_10353582 3300025925 Unclassified 1209
275 Ga0207659_10012009 3300025926 Bacteria 5487
276 Ga0207659_10021912 3300025926 Unclassified 4249
277 Ga0207659_10028103 3300025926 Bacteria 3818
278 Ga0207659_10045554 3300025926 Unclassified 3093
279 Ga0207659_10066309 3300025926 Unclassified 2619
280 Ga0207659_10128812 3300025926 Bacteria 1950
281 Ga0207659_10193861 3300025926 Bacteria 1618
282 Ga0207687_10021950 3300025927 Bacteria 4244
283 Ga0207687_10532646 3300025927 Unclassified 984
284 Ga0207644_10132817 3300025931 Bacteria 1908
285 Ga0207690_10150308 3300025932 Bacteria 1726
286 Ga0207690_10316359 3300025932 Bacteria 1226
287 Ga0207706_10013462 3300025933 Bacteria 7434
288 Ga0207706_10034852 3300025933 Bacteria 4478
289 Ga0207706_10067360 3300025933 Unclassified 3150
290 Ga0207686_10008822 3300025934 Bacteria 5452
291 Ga0207686_10008923 3300025934 Bacteria 5426
292 Ga0207686_10034281 3300025934 Unclassified 3037
293 Ga0207670_10137739 3300025936 Bacteria 1797
294 Ga0207704_10003129 3300025938 Bacteria 7483
295 Ga0207704_10017282 3300025938 Bacteria 3734
296 Ga0207691_10002338 3300025940 Bacteria 18568
297 Ga0207691_10017129 3300025940 Bacteria 6874
298 Ga0207691_10034108 3300025940 Unclassified 4736
299 Ga0207691_10059388 3300025940 Bacteria 3477
300 Ga0207691_10074850 3300025940 Bacteria 3054
301 Ga0207691_10109819 3300025940 Bacteria 2453
302 Ga0207711_10205987 3300025941 Bacteria 1796
303 Ga0207711_10213428 3300025941 Unclassified 1763
304 Ga0207711_10377300 3300025941 Unclassified 1315
305 Ga0207689_10000874 3300025942 Bacteria 29034
306 Ga0207689_10018823 3300025942 Bacteria 5824
307 Ga0207689_10036304 3300025942 Bacteria 4092
308 Ga0207679_10004967 3300025945 Bacteria 8301
309 Ga0207679_10036469 3300025945 Bacteria 3488
310 Ga0207651_10009770 3300025960 Bacteria 5276
311 Ga0207651_10043086 3300025960 Bacteria 3009
312 Ga0207651_10100745 3300025960 Bacteria 2142
313 Ga0207651_10132059 3300025960 Unclassified 1913
314 Ga0207651_10294764 3300025960 Bacteria 1346
315 Ga0207651_10441833 3300025960 Unclassified 1114
316 Ga0207712_10120161 3300025961 Unclassified 1987
317 Ga0207712_10451642 3300025961 Unclassified 1090
318 Ga0207658_10021215 3300025986 Bacteria 4506
319 Ga0207658_10021866 3300025986 Unclassified 4447
320 Ga0207658_10218351 3300025986 Bacteria 1602
321 Ga0207658_10335395 3300025986 Bacteria 1313
322 Ga0207703_10030848 3300026035 Unclassified 4237
323 Ga0207703_10086050 3300026035 Unclassified 2632
324 Ga0207703_10086640 3300026035 Unclassified 2624
325 Ga0207703_10131351 3300026035 Bacteria 2163
326 Ga0207703_10671012 3300026035 Bacteria 984
327 Ga0207678_10164027 3300026067 Bacteria 1897
328 Ga0207708_10003360 3300026075 Bacteria 11806
329 Ga0207708_10109635 3300026075 Bacteria 2142
330 Ga0207708_10156335 3300026075 Bacteria 1798
331 Ga0207641_10079454 3300026088 Bacteria 2843
332 Ga0207641_10305970 3300026088 Unclassified 1503
333 Ga0207641_10464895 3300026088 Unclassified 1224
334 Ga0207641_10488835 3300026088 Bacteria 1194
335 Ga0207648_10011641 3300026089 Bacteria 8280
336 Ga0207648_10028307 3300026089 Bacteria 4970
337 Ga0207648_10244613 3300026089 Bacteria 1598
338 Ga0207676_10021179 3300026095 Bacteria 4768
339 Ga0207676_10107341 3300026095 Bacteria 2328
340 Ga0207676_10259478 3300026095 Bacteria 1568
341 Ga0207674_10225190 3300026116 Unclassified 1824
342 Ga0207674_10406545 3300026116 Unclassified 1316
343 Ga0207675_100010748 3300026118 Bacteria 8577
344 Ga0207675_100053966 3300026118 Unclassified 3749
345 Ga0207675_100142771 3300026118 Unclassified 2275
346 Ga0207675_100276186 3300026118 Bacteria 1632
347 Ga0207683_10019763 3300026121 Bacteria 5754
348 Ga0207683_10048326 3300026121 Bacteria 3726
349 Ga0207683_10050222 3300026121 Unclassified 3653
350 Ga0207698_10415189 3300026142 Unclassified 1290
351 Ga0209983_1032426 3300027665 Bacteria 1116
352 Ga0209974_10053949 3300027876 Unclassified 1355
353 Ga0207428_10000876 3300027907 Bacteria 33831
354 Ga0207428_10001791 3300027907 Bacteria 21986
355 Ga0207428_10174084 3300027907 Unclassified 1629
356 Ga0268266_10009887 3300028379 Bacteria 8386
357 Ga0268266_10033792 3300028379 Unclassified 4347
358 Ga0268265_10178563 3300028380 Bacteria 1822
359 Ga0268264_10051747 3300028381 Bacteria 3424
360 Ga0268264_10106586 3300028381 Bacteria 2447
361 Ga0307408_100079203 3300031548 Unclassified 2451
362 Ga0265314_10026188 3300031711 Bacteria 4385
363 Ga0307405_10155050 3300031731 Bacteria 1615
364 Ga0307413_10006710 3300031824 Bacteria 5284
365 Ga0307410_10205796 3300031852 Unclassified 1505
366 Ga0307412_10218460 3300031911 Unclassified 1459
367 Ga0307409_100026470 3300031995 Bacteria 4091
368 Ga0307416_100102219 3300032002 Bacteria 2498
369 Ga0307414_10088233 3300032004 Unclassified 2295
370 Ga0307411_10056000 3300032005 Bacteria 2597
371 Ga0373948_0029912 3300034817 Bacteria 1092
372 Ga0373961_0022409 3300035241 Unclassified 1690
373 Ga0439435_0011779 3300042436 Unclassified 2104
374 Ga0495580_0512618 3300046472 Unclassified 800
375 Ga0495598_0039309 3300046537 Bacteria 1375
376 Ga0495621_0081351 3300046539 Unclassified 1208
377 Ga0495621_0187836 3300046539 Unclassified 827
378 Ga0495659_0055139 3300046664 Unclassified 1456
379 Ga0496109_0035695 3300048912 Unclassified 4487
380 Ga0496109_0060605 3300048912 Bacteria 3458
381 Ga0496113_0152475 3300048916 Unclassified 1824
382 Ga0496113_0286945 3300048916 Unclassified 1316
383 Ga0496115_0208190 3300048918 Bacteria 1616
384 nmdc:mga05p37_17564_c1 3300050507 Bacteria 8637
385 nmdc:mga05p37_436465_c1 3300050507 Bacteria 1520
386 nmdc:mga05p37_437650_c1 3300050507 Unclassified 1517
387 nmdc:mga05p37_840232_c1 3300050507 Bacteria 999
388 nmdc:mga09592_172873_c1 3300050508 Unclassified 1868
389 nmdc:mga09592_45582_c1 3300050508 Unclassified 3694
390 nmdc:mga09592_81035_c1 3300050508 Bacteria 2765
391 nmdc:mga09592_85874_c1 3300050508 Unclassified 2685
392 nmdc:mga09592_93210_c1 3300050508 Bacteria 2575
393 nmdc:mga09592_99222_c1 3300050508 Unclassified 2493
394 nmdc:mga0qj67_106532_c1 3300050509 Bacteria 2261
395 nmdc:mga0qj67_14717_c1 3300050509 Bacteria 5915
396 nmdc:mga0qj67_367416_c1 3300050509 Bacteria 1162
397 nmdc:mga0qj67_618173_c1 3300050509 Unclassified 866
398 nmdc:mga0qj67_69702_c1 3300050509 Unclassified 2804
399 nmdc:mga06r32_363476_c1 3300050510 Bacteria 1431
400 nmdc:mga06r32_76616_c1 3300050510 Bacteria 3248
401 nmdc:mga06r32_8581_c1 3300050510 Bacteria 9211
402 nmdc:mga08y16_13645_c1 3300050511 Bacteria 8554
403 nmdc:mga08y16_176878_c1 3300050511 Unclassified 2216
404 nmdc:mga08y16_6882_c1 3300050511 Bacteria 11924
405 nmdc:mga08y16_729000_c1 3300050511 Unclassified 989
406 nmdc:mga0n895_103322_c1 3300050512 Unclassified 2861
407 nmdc:mga0n895_99865_c1 3300050512 Bacteria 2911
408 nmdc:mga0a205_1962_c1 3300050515 Bacteria 17909
409 nmdc:mga0a205_23664_c1 3300050515 Bacteria 5826
410 Ga0500568_0003562 3300053139 Bacteria 8606
411 Ga0075430_100084011
412 JGI24746J21847_1001196
413 JGI25406J46586_10000181
414 JGI25406J46586_10003951
415 Ga0065704_10107514
416 Ga0065704_10123360
417 Ga0065712_10011823
418 Ga0065712_10067780
419 Ga0065712_10067795
420 Ga0065712_10079372
421 Ga0065712_10193460
422 Ga0065715_10004319
423 Ga0065715_10120406
424 Ga0065707_10002523
425 Ga0070658_10030222
426 Ga0070676_10009929
427 Ga0070676_10031768
428 Ga0070683_100077299
429 Ga0070690_100028225
430 Ga0070670_100008991
431 Ga0070670_100040430
432 Ga0070670_100062692
433 Ga0070677_10011161
434 Ga0070677_10046776
435 Ga0068869_100001443
436 Ga0068869_100033322
437 Ga0068869_100036473
438 Ga0068869_100430001
439 Ga0070666_10006887
440 Ga0070666_10032810
441 Ga0070666_10048334
442 Ga0070689_100056418
443 Ga0070687_100030121
444 Ga0070687_100160399
445 Ga0070661_100082088
446 Ga0070661_100095498
447 Ga0070668_100027700
448 Ga0070668_100093490
449 Ga0070668_100104659
450 Ga0070669_100266455
451 Ga0070669_100309563
452 Ga0070675_100011894
453 Ga0070675_100022247
454 Ga0070675_100037372
455 Ga0070675_100078732
456 Ga0070675_100082029
457 Ga0070675_100227164
458 Ga0070674_100141526
459 Ga0070673_100006293
460 Ga0070673_100026356
461 Ga0070673_100289271
462 Ga0070688_100043255
463 Ga0070688_100245388
464 Ga0070659_100192002
465 Ga0070667_100165343
466 Ga0070667_100235944
467 Ga0070703_10060848
468 Ga0070701_10002044
469 Ga0070700_100003395
470 Ga0070700_100042562
471 Ga0070694_100175364
472 Ga0070678_100066026
473 Ga0070678_100086941
474 Ga0070678_100379335
475 Ga0070662_100027105
476 Ga0070662_100186704
477 Ga0070681_10196273
478 Ga0068867_100005906
479 Ga0068867_100009144
480 Ga0068867_100074975
481 Ga0068867_100188490
482 Ga0070685_10017420
483 Ga0070685_10089021
484 Ga0070707_100181501
485 Ga0070698_100252882
486 Ga0070699_100170102
487 Ga0070684_100415626
488 Ga0068853_100196486
489 Ga0068853_100598275
490 Ga0070672_100006991
491 Ga0070672_100008470
492 Ga0070672_100028847
493 Ga0070672_100038357
494 Ga0070672_100072596
495 Ga0070672_100499903
496 Ga0070686_100041759
497 Ga0070686_100054954
498 Ga0070696_100123796
499 Ga0070665_100009511
500 Ga0070665_100042104
501 Ga0070704_100171066
502 Ga0070704_100375763
503 Ga0070704_100418866
504 Ga0070664_100002672
505 Ga0070664_100002714
506 Ga0070664_100138644
507 Ga0068857_100078440
508 Ga0068854_100141806
509 Ga0068854_100205775
510 Ga0068852_100029568
511 Ga0068852_100465976
512 Ga0068859_100159911
513 Ga0068859_100718027
514 Ga0068864_100023183
515 Ga0068864_100104079
516 Ga0068864_100124069
517 Ga0068864_100144708
518 Ga0068864_100169333
519 Ga0068864_100267502
520 Ga0068866_10065330
521 Ga0068861_100084285
522 Ga0068861_100104637
523 Ga0068861_100289762
524 Ga0068870_10006831
525 Ga0068870_10037078
526 Ga0068870_10050208
527 Ga0068863_100023500
528 Ga0068863_100044803
529 Ga0068863_100408437
530 Ga0068863_100522048
531 Ga0068858_100004008
532 Ga0068858_100013337
533 Ga0068858_100053943
534 Ga0068858_100147133
535 Ga0068858_100152085
536 Ga0068860_100226874
537 Ga0068860_100233077
538 Ga0068862_100014568
539 Ga0081539_10000017
540 Ga0081539_10000285
541 Ga0081539_10019259
542 Ga0081539_10026762
543 Ga0081539_10052487
544 Ga0097621_100016393
545 Ga0097621_100135975
546 Ga0097621_100226205
547 Ga0068871_100009767
548 Ga0068871_100080633
549 Ga0068871_100120858
550 Ga0075428_100001910
551 Ga0075430_100000208
552 Ga0075430_100055166
553 Ga0075430_100066056
554 Ga0075430_100110114
555 Ga0075430_100117589
556 Ga0075431_100008497
557 Ga0075431_100011969
558 Ga0075431_100164448
559 Ga0075431_100208309
560 Ga0075433_10001433
561 Ga0075433_10001587
562 Ga0075433_10127532
563 Ga0075434_100030924
564 Ga0075434_100160088
565 Ga0075429_100006925
566 Ga0075429_100043187
567 Ga0075429_100060108
568 Ga0075429_100087142
569 Ga0075429_100178153
570 Ga0075429_100191667
571 Ga0068865_100006125
572 Ga0068865_100018066
573 Ga0068865_100046979
574 Ga0068865_100121604
575 Ga0068865_100323268
576 Ga0097620_100159924
577 Ga0097620_100718051
578 Ga0105240_10036313
579 Ga0105240_11043617
580 Ga0111539_10001092
581 Ga0111539_10001941
582 Ga0111539_10020426
583 Ga0111539_10026937
584 Ga0111539_10038840
585 Ga0111539_10137216
586 Ga0111539_10554207
587 Ga0111539_10794682
588 Ga0105245_10008278
589 Ga0105245_10037291
590 Ga0105245_10325805
591 Ga0114129_10022061
592 Ga0114129_10053896
593 Ga0114129_10160497
594 Ga0114129_10190760
595 Ga0114129_10559546
596 Ga0114129_10921867
597 Ga0105243_10437661
598 Ga0105241_10045319
599 Ga0105241_10057373
600 Ga0105242_10009406
601 Ga0105242_10246434
602 Ga0105248_10168585
603 Ga0105248_10327163
604 Ga0105248_10349791
605 Ga0105248_10377548
606 Ga0105248_10381654
607 Ga0105248_10508667
608 Ga0105237_10080496
609 Ga0105237_10169036
610 Ga0105237_10335731
611 Ga0105238_10019934
612 Ga0105238_10132399
613 Ga0105249_10055034
614 Ga0105249_10140012
615 Ga0105249_10930799
616 Ga0105239_10033695
617 Ga0105239_10135220
618 Ga0105246_10005106
619 Ga0105246_10012696
620 Ga0105246_10399032
621 Ga0157371_10237178
622 Ga0157370_10069118
623 Ga0157369_10079890
624 Ga0157378_10013601
625 Ga0157378_10224665
626 Ga0157378_10322888
627 Ga0163162_10057627
628 Ga0163162_10104073
629 Ga0163162_10393028
630 Ga0157372_10281571
631 Ga0157372_10448638
632 Ga0157375_10026198
633 Ga0157375_10176291
634 Ga0157375_10204200
635 Ga0157375_10639465
636 Ga0163163_10022306
637 Ga0163163_10024484
638 Ga0163163_10029862
639 Ga0157380_10003056
640 Ga0157380_10195152
641 Ga0157377_10019006
642 Ga0157377_10042868
643 Ga0157377_10094804
644 Ga0157379_10083978
645 Ga0157379_10188833
646 Ga0157376_10025092
647 Ga0157376_10036353
648 Ga0163161_10139899
649 Ga0207697_10001069
650 Ga0207697_10122174
651 Ga0207656_10049573
652 Ga0207682_10000455
653 Ga0207682_10008243
654 Ga0207682_10011366
655 Ga0207682_10087821
656 Ga0207642_10026576
657 Ga0207642_10110084
658 Ga0207642_10248585
659 Ga0207688_10010347
660 Ga0207688_10358684
661 Ga0207680_10053118
662 Ga0207645_10001977
663 Ga0207643_10000145
664 Ga0207643_10046148
665 Ga0207643_10064257
666 Ga0207643_10065151
667 Ga0207643_10069510
668 Ga0207707_10020247
669 Ga0207695_10050166
670 Ga0207695_10113832
671 Ga0207671_10021786
672 Ga0207662_10002969
673 Ga0207662_10017122
674 Ga0207657_10147481
675 Ga0207649_10471385
676 Ga0207646_10615988
677 Ga0207681_10024731
678 Ga0207681_10373408
679 Ga0207694_10014951
680 Ga0207694_10054797
681 Ga0207694_10104765
682 Ga0207650_10025413
683 Ga0207650_10031419
684 Ga0207650_10353582
685 Ga0207659_10012009
686 Ga0207659_10021912
687 Ga0207659_10028103
688 Ga0207659_10045554
689 Ga0207659_10066309
690 Ga0207659_10128812
691 Ga0207659_10193861
692 Ga0207687_10021950
693 Ga0207687_10532646
694 Ga0207644_10132817
695 Ga0207690_10150308
696 Ga0207690_10316359
697 Ga0207706_10013462
698 Ga0207706_10034852
699 Ga0207706_10067360
700 Ga0207686_10008822
701 Ga0207686_10008923
702 Ga0207686_10034281
703 Ga0207670_10137739
704 Ga0207704_10003129
705 Ga0207704_10017282
706 Ga0207691_10002338
707 Ga0207691_10017129
708 Ga0207691_10034108
709 Ga0207691_10059388
710 Ga0207691_10074850
711 Ga0207691_10109819
712 Ga0207711_10205987
713 Ga0207711_10213428
714 Ga0207711_10377300
715 Ga0207689_10000874
716 Ga0207689_10018823
717 Ga0207689_10036304
718 Ga0207679_10004967
719 Ga0207679_10036469
720 Ga0207651_10009770
721 Ga0207651_10043086
722 Ga0207651_10100745
723 Ga0207651_10132059
724 Ga0207651_10294764
725 Ga0207651_10441833
726 Ga0207712_10120161
727 Ga0207712_10451642
728 Ga0207658_10021215
729 Ga0207658_10021866
730 Ga0207658_10218351
731 Ga0207658_10335395
732 Ga0207703_10030848
733 Ga0207703_10086050
734 Ga0207703_10086640
735 Ga0207703_10131351
736 Ga0207703_10671012
737 Ga0207678_10164027
738 Ga0207708_10003360
739 Ga0207708_10109635
740 Ga0207708_10156335
741 Ga0207641_10079454
742 Ga0207641_10305970
743 Ga0207641_10464895
744 Ga0207641_10488835
745 Ga0207648_10011641
746 Ga0207648_10028307
747 Ga0207648_10244613
748 Ga0207676_10021179
749 Ga0207676_10107341
750 Ga0207676_10259478
751 Ga0207674_10225190
752 Ga0207674_10406545
753 Ga0207675_100010748
754 Ga0207675_100053966
755 Ga0207675_100142771
756 Ga0207675_100276186
757 Ga0207683_10019763
758 Ga0207683_10048326
759 Ga0207683_10050222
760 Ga0207698_10415189
761 Ga0209983_1032426
762 Ga0209974_10053949
763 Ga0207428_10000876
764 Ga0207428_10001791
765 Ga0207428_10174084
766 Ga0268266_10009887
767 Ga0268266_10033792
768 Ga0268265_10178563
769 Ga0268264_10051747
770 Ga0268264_10106586
771 Ga0307408_100079203
772 Ga0265314_10026188
773 Ga0307405_10155050
774 Ga0307413_10006710
775 Ga0307410_10205796
776 Ga0307412_10218460
777 Ga0307409_100026470
778 Ga0307416_100102219
779 Ga0307414_10088233
780 Ga0307411_10056000
781 Ga0373948_0029912
782 Ga0373961_0022409
783 Ga0439435_0011779
784 Ga0495580_0512618
785 Ga0495598_0039309
786 Ga0495621_0081351
787 Ga0495621_0187836
788 Ga0495659_0055139
789 Ga0496109_0035695
790 Ga0496109_0060605
791 Ga0496113_0152475
792 Ga0496113_0286945
793 Ga0496115_0208190
794 nmdc:mga05p37_17564_c1
795 nmdc:mga05p37_436465_c1
796 nmdc:mga05p37_437650_c1
797 nmdc:mga05p37_840232_c1
798 nmdc:mga09592_172873_c1
799 nmdc:mga09592_45582_c1
800 nmdc:mga09592_81035_c1
801 nmdc:mga09592_85874_c1
802 nmdc:mga09592_93210_c1
803 nmdc:mga09592_99222_c1
804 nmdc:mga0qj67_106532_c1
805 nmdc:mga0qj67_14717_c1
806 nmdc:mga0qj67_367416_c1
807 nmdc:mga0qj67_618173_c1
808 nmdc:mga0qj67_69702_c1
809 nmdc:mga06r32_363476_c1
810 nmdc:mga06r32_76616_c1
811 nmdc:mga06r32_8581_c1
812 nmdc:mga08y16_13645_c1
813 nmdc:mga08y16_176878_c1
814 nmdc:mga08y16_6882_c1
815 nmdc:mga08y16_729000_c1
816 nmdc:mga0n895_103322_c1
817 nmdc:mga0n895_99865_c1
818 nmdc:mga0a205_1962_c1
819 nmdc:mga0a205_23664_c1
820 Ga0500568_0003562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ca3-assembly1.cif.gz_A crystal structure of the glycosynthase mutant d324n of escherichia coli gh63 glycosidase in complex with glucose and lactose 0.8347 156 213
8bk2-assembly1.cif.gz_A x-ray structure of meningococcal factor h binding protein variant 2 in complex with a specific and bactericidal human monoclonal antibody 1b1 0.7353 190 228
8t7z-assembly1.cif.gz_F crystal structure of alpha-glucosidase (yici) from klebsiella aerogenes 0.7244 160 212
8t7z-assembly1.cif.gz_E crystal structure of alpha-glucosidase (yici) from klebsiella aerogenes 0.7223 160 212
8t7z-assembly1.cif.gz_C crystal structure of alpha-glucosidase (yici) from klebsiella aerogenes 0.719 160 212
ID Description Score Start End Superfamily
af_E9PTR6_25_177_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7535 189 230 2.40.128.20
af_A0A1D6I7U7_1_80_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7472 191 226 3.10.129.10
af_B6SNT9_15_153_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7361 191 230 3.10.129.10
af_Q7XV63_16_151_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7277 191 229 3.10.129.10
af_A0A1D6EKL6_187_395_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7261 191 230 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V9C7H0-F1-model_v4 Uncharacterized protein 0.9476 155 231
AF-A0A2V8KPN4-F1-model_v4 Uncharacterized protein 0.9473 134 230
AF-A0A2V8I653-F1-model_v4 Uncharacterized protein 0.9353 114 230
AF-A0A2V8FM27-F1-model_v4 Uncharacterized protein 0.9283 141 230
AF-A0A7X5WE72-F1-model_v4 deleted 0.9258 137 230

Map