F437181

General Info

Members Datasets Scaffolds Average Seq Length
410 202 820 182

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100336286|Ga0070706_1003362863
Length 211
Sequence MHLLSSFSECYPNHCSEVTSYVTPDATTMVTDLHTQLDLVRDFVNTFDLETGIDKIATSDELATWFSEQGLVHDLIEPTEQEVEDAHSLREAIRELLLAHNGVEVDAATASQTLEEAGRKAHLGVRFEDGRPVLAPEGDGACAALGRIVATVAELAPTDEWKRMKTCRDEHCRVVFYDKSRNRSRAWCSMEVCGNREKARSFRQRHAHSAS

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
87 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 2558860280 Kutzneria sp. 744 Isolate Unclassified
199 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
200 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
201 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
202 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.8
Metatranscriptomes 0.49
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.95
Rhizosphere 87.07
Stem 0
Stem Tuber 0
Unclassified 9.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100336286 3300005467 Bacteria 1408
2 Ga0070658_10028586 3300005327 Bacteria 4478
3 Ga0070683_100129799 3300005329 Bacteria 2385
4 Ga0070680_100037484 3300005336 Bacteria 3917
5 Ga0070682_100418294 3300005337 Bacteria 1018
6 Ga0070682_100484767 3300005337 Bacteria 955
7 Ga0068868_100317308 3300005338 Bacteria 1327
8 Ga0068868_100470010 3300005338 Bacteria 1097
9 Ga0070660_100051424 3300005339 Bacteria 3173
10 Ga0070671_100481918 3300005355 Bacteria 1066
11 Ga0070659_100032341 3300005366 Bacteria 4056
12 Ga0070703_10193187 3300005406 Bacteria 794
13 Ga0070709_10045926 3300005434 Bacteria 2714
14 Ga0070714_100008658 3300005435 Bacteria 7956
15 Ga0070714_100024330 3300005435 Bacteria 4984
16 Ga0070714_100033947 3300005435 Bacteria 4271
17 Ga0070714_100037311 3300005435 Bacteria 4083
18 Ga0070714_100070280 3300005435 Bacteria 3026
19 Ga0070714_101452819 3300005435 Bacteria 670
20 Ga0070713_100041466 3300005436 Bacteria 3750
21 Ga0070713_100130919 3300005436 Bacteria 2212
22 Ga0070710_10003439 3300005437 Bacteria 7503
23 Ga0070710_10009232 3300005437 Bacteria 4820
24 Ga0070711_100027039 3300005439 Bacteria 3763
25 Ga0070711_100047147 3300005439 Bacteria 2940
26 Ga0070694_100089405 3300005444 Bacteria 2158
27 Ga0070681_10051474 3300005458 Bacteria 4108
28 Ga0070681_10079821 3300005458 Bacteria 3228
29 Ga0070707_100001986 3300005468 Bacteria 19582
30 Ga0070707_100440146 3300005468 Bacteria 1264
31 Ga0070698_100219347 3300005471 Bacteria 1836
32 Ga0070699_100607965 3300005518 Unclassified 997
33 Ga0070679_100072110 3300005530 Bacteria 3445
34 Ga0070679_100078303 3300005530 Bacteria 3294
35 Ga0070679_100089487 3300005530 Bacteria 3065
36 Ga0070684_100064797 3300005535 Bacteria 3206
37 Ga0070684_100201828 3300005535 Bacteria 1811
38 Ga0070684_100995624 3300005535 Bacteria 787
39 Ga0070695_100000814 3300005545 Bacteria 16811
40 Ga0070696_100297114 3300005546 Unclassified 1236
41 Ga0070704_100064573 3300005549 Bacteria 2632
42 Ga0068855_100248344 3300005563 Bacteria 1985
43 Ga0068855_100294375 3300005563 Unclassified 1799
44 Ga0070664_100174483 3300005564 Bacteria 1908
45 Ga0068854_100289205 3300005578 Bacteria 1322
46 Ga0068856_100145685 3300005614 Bacteria 2376
47 Ga0068852_100097658 3300005616 Bacteria 2643
48 Ga0068851_10491877 3300005834 Bacteria 734
49 Ga0068863_100412618 3300005841 Bacteria 1322
50 Ga0068858_101400072 3300005842 Unclassified 689
51 Ga0070717_10007800 3300006028 Bacteria 7966
52 Ga0070717_10056185 3300006028 Bacteria 3251
53 Ga0070717_10088713 3300006028 Bacteria 2607
54 Ga0070717_10236822 3300006028 Bacteria 1608
55 Ga0070715_10021489 3300006163 Bacteria 2503
56 Ga0070715_10069226 3300006163 Bacteria 1572
57 Ga0070716_100019365 3300006173 Bacteria 3556
58 Ga0070712_100016542 3300006175 Bacteria 4765
59 Ga0070712_100206280 3300006175 Unclassified 1547
60 Ga0070712_100543346 3300006175 Bacteria 978
61 Ga0097621_100857940 3300006237 Bacteria 844
62 Ga0075434_100157187 3300006871 Bacteria 2293
63 Ga0099795_10082408 3300007788 Bacteria 1233
64 Ga0105251_10123382 3300009011 Bacteria 1176
65 Ga0105240_10040071 3300009093 Bacteria 5995
66 Ga0105240_10153851 3300009093 Bacteria 2737
67 Ga0105240_10407593 3300009093 Unclassified 1530
68 Ga0105240_10902481 3300009093 Bacteria 950
69 Ga0111539_10259034 3300009094 Bacteria 2025
70 Ga0105245_10521741 3300009098 Bacteria 1206
71 Ga0105247_10048396 3300009101 Bacteria 2611
72 Ga0114129_10313509 3300009147 Bacteria 2087
73 Ga0105248_10088356 3300009177 Bacteria 3488
74 Ga0105237_10011717 3300009545 Bacteria 9272
75 Ga0105238_11399165 3300009551 Bacteria 727
76 Ga0105239_10658587 3300010375 Bacteria 1196
77 Ga0157369_10915916 3300013105 Unclassified 899
78 Ga0157374_10053595 3300013296 Bacteria 3760
79 Ga0163162_11484963 3300013306 Bacteria 772
80 Ga0157372_10018568 3300013307 Bacteria 7480
81 Ga0182008_10068894 3300014497 Unclassified 1741
82 Ga0157376_10036784 3300014969 Bacteria 3968
83 Ga0206356_10989153 3300020070 Bacteria 2931
84 Ga0206353_11954450 3300020082 Bacteria 2665
85 Ga0207692_10005324 3300025898 Bacteria 5149
86 Ga0207692_10028126 3300025898 Bacteria 2655
87 Ga0207692_10068332 3300025898 Bacteria 1863
88 Ga0207685_10067479 3300025905 Bacteria 1439
89 Ga0207699_10017684 3300025906 Bacteria 3760
90 Ga0207705_10079078 3300025909 Bacteria 2394
91 Ga0207707_10085947 3300025912 Bacteria 2749
92 Ga0207695_10251802 3300025913 Bacteria 1665
93 Ga0207695_10252136 3300025913 Bacteria 1664
94 Ga0207671_10027756 3300025914 Bacteria 4232
95 Ga0207693_10000282 3300025915 Bacteria 47278
96 Ga0207660_10319830 3300025917 Bacteria 1239
97 Ga0207657_10000988 3300025919 Bacteria 30190
98 Ga0207652_10447624 3300025921 Bacteria 1164
99 Ga0207646_10001768 3300025922 Bacteria 26172
100 Ga0207700_10045424 3300025928 Bacteria 3241
101 Ga0207700_10079100 3300025928 Bacteria 2559
102 Ga0207664_10007295 3300025929 Bacteria 7666
103 Ga0207664_10035721 3300025929 Bacteria 3836
104 Ga0207664_10044965 3300025929 Bacteria 3460
105 Ga0207664_10190897 3300025929 Unclassified 1763
106 Ga0207686_10306195 3300025934 Unclassified 1182
107 Ga0207665_10001074 3300025939 Bacteria 18382
108 Ga0207665_10050605 3300025939 Bacteria 2794
109 Ga0207711_10408641 3300025941 Unclassified 1262
110 Ga0207661_10074555 3300025944 Bacteria 2781
111 Ga0207661_10395142 3300025944 Bacteria 1253
112 Ga0207667_10541194 3300025949 Bacteria 1178
113 Ga0207677_10250380 3300026023 Bacteria 1438
114 Ga0207677_11026924 3300026023 Bacteria 749
115 Ga0207702_10116059 3300026078 Bacteria 2388
116 Ga0207641_10659413 3300026088 Bacteria 1028
117 Ga0207698_10207099 3300026142 Bacteria 1761
118 Ga0265338_10000924 3300028800 Bacteria 49511
119 Ga0265338_10116893 3300028800 Bacteria 2135
120 Ga0265324_10021117 3300029957 Bacteria 2336
121 Ga0265327_10048038 3300031251 Bacteria 2247
122 Ga0265313_10113507 3300031595 Bacteria 1189
123 Ga0316583_10057266 3300032133 Bacteria 1369
124 Ga0373926_0024316 3300035083 Bacteria 2109
125 Ga0373936_0093672 3300035113 Bacteria 1261
126 Ga0373953_0261626 3300035117 Bacteria 753
127 Ga0373956_0110362 3300035119 Bacteria 1280
128 Ga0373957_0301356 3300035120 Bacteria 680
129 Ga0373943_0004768 3300035170 Bacteria 6129
130 Ga0373924_0111082 3300035410 Bacteria 1185
131 Ga0373933_0050680 3300035724 Unclassified 2479
132 Ga0373947_0000371 3300035725 Bacteria 25349
133 Ga0373937_0000725 3300036401 Bacteria 28683
134 Ga0373925_0001462 3300037068 Bacteria 20386
135 Ga0395899_0045692 3300037312 Bacteria 3263
136 Ga0395900_0253268 3300037418 Bacteria 1761
137 Ga0395898_0109506 3300037466 Bacteria 2648
138 Ga0395905_0308059 3300037471 Bacteria 1472
139 Ga0395901_0459363 3300038443 Bacteria 1301
140 Ga0436363_1276431 3300039450 Bacteria 902
141 Ga0466965_0024499 3300044683 Bacteria 2920
142 Ga0466965_0257070 3300044683 Bacteria 938
143 Ga0466965_0539877 3300044683 Bacteria 657
144 Ga0466966_0059424 3300044684 Bacteria 2414
145 Ga0466961_0008333 3300044693 Bacteria 6599
146 Ga0466961_0014252 3300044693 Bacteria 5103
147 Ga0466961_0030814 3300044693 Bacteria 3446
148 Ga0466961_0118620 3300044693 Bacteria 1662
149 Ga0466963_0000102 3300044694 Bacteria 30465
150 Ga0466963_0003617 3300044694 Bacteria 8883
151 Ga0466963_0005276 3300044694 Bacteria 7547
152 Ga0466963_0012870 3300044694 Bacteria 5125
153 Ga0466963_0016078 3300044694 Bacteria 4647
154 Ga0466963_0019443 3300044694 Bacteria 4261
155 Ga0466963_0035681 3300044694 Bacteria 3240
156 Ga0466963_0038174 3300044694 Bacteria 3139
157 Ga0466964_0003428 3300044706 Bacteria 5785
158 Ga0466964_0006069 3300044706 Bacteria 4504
159 Ga0466964_0017967 3300044706 Bacteria 2709
160 Ga0466964_0068165 3300044706 Unclassified 1498
161 Ga0466964_0122918 3300044706 Bacteria 1172
162 Ga0466971_0015053 3300044719 Bacteria 3402
163 Ga0466971_0063321 3300044719 Bacteria 1674
164 Ga0466971_0081435 3300044719 Bacteria 1476
165 Ga0466968_0001167 3300044735 Bacteria 9315
166 Ga0466968_0091919 3300044735 Bacteria 1346
167 Ga0466970_0009132 3300044765 Bacteria 5004
168 Ga0466970_0038292 3300044765 Bacteria 2543
169 Ga0466970_0201142 3300044765 Bacteria 1108
170 Ga0466957_0005782 3300044842 Bacteria 6952
171 Ga0466957_0008474 3300044842 Bacteria 5849
172 Ga0466957_0010928 3300044842 Bacteria 5221
173 Ga0466957_0012050 3300044842 Bacteria 4998
174 Ga0466957_0188909 3300044842 Bacteria 1349
175 Ga0466957_0325143 3300044842 Unclassified 1038
176 Ga0466957_0400897 3300044842 Bacteria 938
177 Ga0466957_0512068 3300044842 Bacteria 833
178 Ga0466957_0609987 3300044842 Bacteria 764
179 Ga0466957_0647849 3300044842 Bacteria 742
180 Ga0466960_0018742 3300044901 Bacteria 3038
181 Ga0466960_0061333 3300044901 Bacteria 1846
182 Ga0466959_0024990 3300045049 Bacteria 4424
183 Ga0466959_0082093 3300045049 Unclassified 2322
184 Ga0466959_0387019 3300045049 Bacteria 951
185 Ga0466958_0005167 3300045836 Bacteria 6983
186 Ga0466958_0005361 3300045836 Bacteria 6889
187 Ga0466958_0010780 3300045836 Bacteria 5128
188 Ga0466958_0019589 3300045836 Bacteria 3939
189 Ga0466958_0023292 3300045836 Bacteria 3632
190 Ga0466958_0023638 3300045836 Bacteria 3610
191 Ga0466958_0106069 3300045836 Bacteria 1751
192 Ga0466958_0198218 3300045836 Bacteria 1277
193 Ga0466967_0000094 3300045976 Bacteria 31562
194 Ga0466967_0011615 3300045976 Bacteria 6686
195 Ga0466967_0014799 3300045976 Bacteria 6093
196 Ga0466967_0023089 3300045976 Bacteria 5091
197 Ga0466967_0039568 3300045976 Bacteria 4054
198 Ga0466967_0053118 3300045976 Bacteria 3560
199 Ga0466967_0076521 3300045976 Bacteria 3010
200 Ga0466967_0101536 3300045976 Bacteria 2629
201 Ga0466967_0122027 3300045976 Bacteria 2409
202 Ga0466967_0275727 3300045976 Bacteria 1612
203 Ga0466967_0347276 3300045976 Bacteria 1436
204 Ga0466967_0588715 3300045976 Bacteria 1097
205 Ga0495592_0000050 3300046454 Bacteria 111971
206 Ga0495592_0140719 3300046454 Unclassified 1679
207 Ga0495592_0204476 3300046454 Bacteria 1330
208 Ga0495592_0336732 3300046454 Bacteria 971
209 Ga0495603_0094958 3300046455 Bacteria 1742
210 Ga0495629_0006824 3300046459 Bacteria 8441
211 Ga0495629_0091126 3300046459 Bacteria 2127
212 Ga0495629_0107223 3300046459 Bacteria 1949
213 Ga0495641_0005829 3300046461 Bacteria 8165
214 Ga0495641_0029085 3300046461 Bacteria 2665
215 Ga0495641_0031545 3300046461 Bacteria 2531
216 Ga0495651_0000028 3300046462 Bacteria 105473
217 Ga0495651_0106647 3300046462 Bacteria 2076
218 Ga0495651_0556150 3300046462 Bacteria 728
219 Ga0495653_0001289 3300046463 Bacteria 19386
220 Ga0495653_0005665 3300046463 Bacteria 10200
221 Ga0495653_0039159 3300046463 Bacteria 3715
222 Ga0495653_0447260 3300046463 Bacteria 813
223 Ga0495580_0004702 3300046472 Bacteria 11446
224 Ga0495582_0003512 3300046473 Bacteria 8836
225 Ga0495582_0152107 3300046473 Unclassified 1314
226 Ga0495639_0000481 3300046475 Bacteria 19003
227 Ga0495662_0000184 3300046476 Bacteria 25256
228 Ga0495662_0000359 3300046476 Bacteria 20037
229 Ga0495662_0127326 3300046476 Unclassified 1251
230 Ga0495664_0006065 3300046477 Bacteria 6664
231 Ga0495664_0164078 3300046477 Bacteria 1348
232 Ga0495664_0248175 3300046477 Bacteria 1076
233 Ga0495584_0019684 3300046491 Bacteria 3429
234 Ga0495585_0178492 3300046492 Bacteria 1093
235 Ga0495607_0053355 3300046501 Bacteria 2337
236 Ga0495608_0002062 3300046511 Bacteria 14459
237 Ga0495608_0048015 3300046511 Bacteria 2837
238 Ga0495608_0081771 3300046511 Bacteria 2098
239 Ga0495608_0167776 3300046511 Unclassified 1393
240 Ga0495608_0456216 3300046511 Bacteria 777
241 Ga0495618_0001024 3300046514 Bacteria 19164
242 Ga0495618_0051562 3300046514 Bacteria 2599
243 Ga0495618_0113005 3300046514 Unclassified 1739
244 Ga0495618_0130561 3300046514 Bacteria 1607
245 Ga0495618_0232721 3300046514 Unclassified 1160
246 Ga0495618_0244664 3300046514 Bacteria 1127
247 Ga0495628_0000060 3300046516 Bacteria 87173
248 Ga0495628_0008128 3300046516 Bacteria 9029
249 Ga0495628_0177947 3300046516 Bacteria 1610
250 Ga0495630_0000995 3300046517 Bacteria 19714
251 Ga0495630_0104039 3300046517 Bacteria 2148
252 Ga0495630_0221223 3300046517 Unclassified 1445
253 Ga0495644_0157446 3300046523 Unclassified 870
254 Ga0495666_0000688 3300046526 Bacteria 15346
255 Ga0495652_0000969 3300046529 Bacteria 32863
256 Ga0495652_0008136 3300046529 Bacteria 9590
257 Ga0495652_0010648 3300046529 Bacteria 8330
258 Ga0495665_0004703 3300046531 Bacteria 7364
259 Ga0495640_0014224 3300046533 Bacteria 6030
260 Ga0495640_0123159 3300046533 Bacteria 1683
261 Ga0495640_0203567 3300046533 Unclassified 1254
262 Ga0495640_0213372 3300046533 Unclassified 1219
263 Ga0495586_0033309 3300046535 Bacteria 2765
264 Ga0495586_0067682 3300046535 Bacteria 1947
265 Ga0495587_0000062 3300046536 Bacteria 91862
266 Ga0495587_0086090 3300046536 Bacteria 1819
267 Ga0495645_0000207 3300046543 Bacteria 42086
268 Ga0495645_0004423 3300046543 Bacteria 9598
269 Ga0495645_0055416 3300046543 Bacteria 2879
270 Ga0495645_0379763 3300046543 Unclassified 904
271 Ga0495667_0009415 3300046559 Bacteria 6617
272 Ga0495667_0190482 3300046559 Bacteria 1314
273 Ga0495667_0256554 3300046559 Bacteria 1112
274 Ga0495656_0017577 3300046615 Bacteria 2731
275 Ga0495634_0024255 3300046642 Bacteria 4259
276 Ga0495634_0068329 3300046642 Bacteria 2348
277 Ga0495611_0025819 3300046648 Bacteria 2562
278 Ga0495635_0009343 3300046663 Bacteria 6852
279 Ga0495635_0074020 3300046663 Bacteria 2333
280 Ga0495635_0191008 3300046663 Unclassified 1390
281 Ga0495661_0179833 3300046665 Bacteria 1122
282 Ga0495657_0014967 3300046675 Bacteria 5690
283 Ga0495657_0136625 3300046675 Bacteria 1531
284 Ga0495599_0000202 3300046678 Bacteria 39562
285 Ga0495599_0180866 3300046678 Bacteria 1300
286 Ga0495623_0000230 3300046679 Bacteria 35964
287 Ga0495646_0013664 3300046680 Bacteria 5161
288 Ga0495646_0017844 3300046680 Bacteria 4497
289 Ga0495646_0019601 3300046680 Bacteria 4279
290 Ga0495647_0000670 3300046681 Bacteria 10187
291 Ga0495658_0023169 3300046683 Bacteria 3293
292 Ga0495613_0005595 3300046689 Bacteria 9434
293 Ga0495613_0028992 3300046689 Bacteria 4115
294 Ga0495613_0183245 3300046689 Unclassified 1482
295 Ga0495624_0027518 3300046690 Bacteria 3722
296 Ga0495624_0052653 3300046690 Bacteria 2571
297 Ga0495624_0067971 3300046690 Bacteria 2222
298 Ga0495670_0054914 3300046691 Bacteria 1997
299 Ga0495600_0008576 3300046809 Bacteria 6286
300 Ga0495600_0053048 3300046809 Bacteria 2648
301 Ga0495600_0247676 3300046809 Unclassified 1134
302 Ga0495600_0763222 3300046809 Bacteria 578
303 Ga0495581_0017948 3300047315 Bacteria 4111
304 Ga0495581_0236512 3300047315 Bacteria 1068
305 Ga0495604_0000262 3300047317 Bacteria 46873
306 Ga0495604_0045005 3300047317 Bacteria 3446
307 Ga0495604_0078218 3300047317 Bacteria 2483
308 Ga0495636_0052271 3300047318 Bacteria 1714
309 Ga0495674_0013316 3300047319 Bacteria 7734
310 Ga0495674_0354643 3300047319 Unclassified 1190
311 Ga0495674_0682323 3300047319 Unclassified 807
312 Ga0495676_0019630 3300047321 Bacteria 5942
313 Ga0495676_0032491 3300047321 Bacteria 4404
314 Ga0495676_0211460 3300047321 Bacteria 1341
315 Ga0495676_0722340 3300047321 Bacteria 644
316 Ga0495680_0020304 3300047322 Bacteria 5592
317 Ga0495680_0034009 3300047322 Bacteria 4123
318 Ga0495680_0109560 3300047322 Bacteria 2047
319 Ga0495675_0000020 3300047444 Bacteria 111526
320 Ga0495675_0045314 3300047444 Bacteria 2801
321 Ga0495677_0049076 3300047445 Unclassified 1551
322 Ga0495684_0012195 3300047471 Bacteria 6630
323 Ga0495684_0016556 3300047471 Bacteria 5679
324 Ga0495684_0039015 3300047471 Bacteria 3640
325 Ga0495593_0001863 3300047673 Bacteria 12556
326 Ga0495602_0000222 3300048088 Bacteria 53050
327 Ga0495602_0039532 3300048088 Bacteria 4342
328 Ga0495614_0001717 3300048089 Bacteria 9568
329 Ga0496100_0041479 3300048903 Bacteria 2933
330 Ga0496100_0206156 3300048903 Bacteria 1436
331 Ga0496101_0011809 3300048904 Bacteria 5809
332 Ga0496101_0108366 3300048904 Bacteria 2088
333 Ga0496102_0021075 3300048905 Bacteria 5764
334 Ga0496102_0082856 3300048905 Bacteria 2958
335 Ga0496103_0014385 3300048906 Bacteria 4700
336 Ga0496103_0018723 3300048906 Bacteria 4155
337 Ga0496104_0014672 3300048907 Bacteria 7078
338 Ga0496104_0015903 3300048907 Bacteria 6828
339 Ga0496104_0230125 3300048907 Bacteria 1765
340 Ga0496104_0441737 3300048907 Bacteria 1213
341 Ga0496105_0017378 3300048908 Bacteria 5765
342 Ga0496105_0019886 3300048908 Bacteria 5418
343 Ga0496105_0029719 3300048908 Bacteria 4473
344 Ga0496106_0115368 3300048909 Bacteria 2094
345 Ga0496106_0259759 3300048909 Bacteria 1390
346 Ga0496107_0009770 3300048910 Bacteria 6654
347 Ga0496107_0031675 3300048910 Bacteria 3776
348 Ga0496107_0323184 3300048910 Unclassified 1148
349 Ga0496108_0009079 3300048911 Bacteria 8054
350 Ga0496108_0034402 3300048911 Bacteria 4210
351 Ga0496108_0071809 3300048911 Bacteria 2921
352 Ga0496108_0397947 3300048911 Unclassified 1203
353 Ga0496109_0010667 3300048912 Bacteria 7860
354 Ga0496109_0026642 3300048912 Bacteria 5157
355 Ga0496109_0148123 3300048912 Bacteria 2197
356 Ga0496109_0329022 3300048912 Bacteria 1442
357 Ga0496109_1174499 3300048912 Bacteria 704
358 Ga0496110_1021754 3300048913 Bacteria 734
359 Ga0496111_0036366 3300048914 Bacteria 3520
360 Ga0496111_0046870 3300048914 Bacteria 3113
361 Ga0496112_0098299 3300048915 Bacteria 2896
362 Ga0496112_0106028 3300048915 Bacteria 2780
363 Ga0496112_0793866 3300048915 Bacteria 872
364 Ga0496113_0029330 3300048916 Bacteria 3971
365 Ga0496113_0131356 3300048916 Bacteria 1965
366 Ga0496113_0644251 3300048916 Bacteria 847
367 Ga0496114_0017907 3300048917 Bacteria 5725
368 Ga0496114_0052601 3300048917 Bacteria 3393
369 Ga0496114_0066011 3300048917 Bacteria 3033
370 Ga0496114_0382330 3300048917 Bacteria 1246
371 Ga0496115_0020647 3300048918 Bacteria 5082
372 Ga0496115_0048713 3300048918 Bacteria 3389
373 Ga0496115_0061199 3300048918 Bacteria 3035
374 Ga0496115_0079276 3300048918 Bacteria 2673
375 Ga0496115_0118095 3300048918 Bacteria 2181
376 Ga0496115_0209041 3300048918 Bacteria 1612
377 Ga0496115_0447098 3300048918 Bacteria 1044
378 Ga0501068_0552736 3300049584 Bacteria 749
379 Ga0501069_0456910 3300049585 Bacteria 759
380 Ga0501077_0160142 3300049593 Bacteria 1429
381 nmdc:mga0n895_25551_c1 3300050512 Bacteria 5582
382 nmdc:mga0a205_95152_c1 3300050515 Bacteria 2877
383 Ga0495601_0000218 3300053077 Bacteria 30705
384 Ga0495601_0005907 3300053077 Bacteria 7136
385 Ga0495601_0053519 3300053077 Bacteria 2551
386 Ga0495601_0158768 3300053077 Unclassified 1477
387 Ga0495601_0203688 3300053077 Bacteria 1293
388 Ga0495601_0492409 3300053077 Bacteria 791
389 Ga0495612_0003098 3300053078 Bacteria 6890
390 Ga0495612_0016785 3300053078 Bacteria 2932
391 Ga0495612_0062708 3300053078 Bacteria 1541
392 Ga0495655_0004634 3300053083 Bacteria 2368
393 Ga0495655_0073844 3300053083 Unclassified 960
394 Ga0495595_0063170 3300053084 Bacteria 1738
395 Ga0495595_0198492 3300053084 Unclassified 998
396 Ga0495619_0001137 3300053085 Bacteria 17476
397 Ga0495619_0235244 3300053085 Unclassified 1269
398 Ga0495619_0355939 3300053085 Unclassified 1012
399 Ga0495619_0410843 3300053085 Bacteria 934
400 Ga0495619_0482150 3300053085 Bacteria 854
401 Ga0466962_0000096 3300061719 Bacteria 35253
402 Ga0466962_0020166 3300061719 Bacteria 3204
403 Ga0466962_0060040 3300061719 Bacteria 1815
404 2559428524 2558860280 Bacteria 11429938
405 2776373704 2775506925 Bacteria 7237746
406 2863070134 2863067949 Bacteria 8541735
407 2866552130 2866552031 Bacteria 5824618
408 2866555756 2866552031 Bacteria 5824618
409 8056208182 8056207758 Bacteria 8639239
410 8056211037 8056207758 Bacteria 8639239
411 Ga0070706_100336286
412 Ga0070658_10028586
413 Ga0070683_100129799
414 Ga0070680_100037484
415 Ga0070682_100418294
416 Ga0070682_100484767
417 Ga0068868_100317308
418 Ga0068868_100470010
419 Ga0070660_100051424
420 Ga0070671_100481918
421 Ga0070659_100032341
422 Ga0070703_10193187
423 Ga0070709_10045926
424 Ga0070714_100008658
425 Ga0070714_100024330
426 Ga0070714_100033947
427 Ga0070714_100037311
428 Ga0070714_100070280
429 Ga0070714_101452819
430 Ga0070713_100041466
431 Ga0070713_100130919
432 Ga0070710_10003439
433 Ga0070710_10009232
434 Ga0070711_100027039
435 Ga0070711_100047147
436 Ga0070694_100089405
437 Ga0070681_10051474
438 Ga0070681_10079821
439 Ga0070707_100001986
440 Ga0070707_100440146
441 Ga0070698_100219347
442 Ga0070699_100607965
443 Ga0070679_100072110
444 Ga0070679_100078303
445 Ga0070679_100089487
446 Ga0070684_100064797
447 Ga0070684_100201828
448 Ga0070684_100995624
449 Ga0070695_100000814
450 Ga0070696_100297114
451 Ga0070704_100064573
452 Ga0068855_100248344
453 Ga0068855_100294375
454 Ga0070664_100174483
455 Ga0068854_100289205
456 Ga0068856_100145685
457 Ga0068852_100097658
458 Ga0068851_10491877
459 Ga0068863_100412618
460 Ga0068858_101400072
461 Ga0070717_10007800
462 Ga0070717_10056185
463 Ga0070717_10088713
464 Ga0070717_10236822
465 Ga0070715_10021489
466 Ga0070715_10069226
467 Ga0070716_100019365
468 Ga0070712_100016542
469 Ga0070712_100206280
470 Ga0070712_100543346
471 Ga0097621_100857940
472 Ga0075434_100157187
473 Ga0099795_10082408
474 Ga0105251_10123382
475 Ga0105240_10040071
476 Ga0105240_10153851
477 Ga0105240_10407593
478 Ga0105240_10902481
479 Ga0111539_10259034
480 Ga0105245_10521741
481 Ga0105247_10048396
482 Ga0114129_10313509
483 Ga0105248_10088356
484 Ga0105237_10011717
485 Ga0105238_11399165
486 Ga0105239_10658587
487 Ga0157369_10915916
488 Ga0157374_10053595
489 Ga0163162_11484963
490 Ga0157372_10018568
491 Ga0182008_10068894
492 Ga0157376_10036784
493 Ga0206356_10989153
494 Ga0206353_11954450
495 Ga0207692_10005324
496 Ga0207692_10028126
497 Ga0207692_10068332
498 Ga0207685_10067479
499 Ga0207699_10017684
500 Ga0207705_10079078
501 Ga0207707_10085947
502 Ga0207695_10251802
503 Ga0207695_10252136
504 Ga0207671_10027756
505 Ga0207693_10000282
506 Ga0207660_10319830
507 Ga0207657_10000988
508 Ga0207652_10447624
509 Ga0207646_10001768
510 Ga0207700_10045424
511 Ga0207700_10079100
512 Ga0207664_10007295
513 Ga0207664_10035721
514 Ga0207664_10044965
515 Ga0207664_10190897
516 Ga0207686_10306195
517 Ga0207665_10001074
518 Ga0207665_10050605
519 Ga0207711_10408641
520 Ga0207661_10074555
521 Ga0207661_10395142
522 Ga0207667_10541194
523 Ga0207677_10250380
524 Ga0207677_11026924
525 Ga0207702_10116059
526 Ga0207641_10659413
527 Ga0207698_10207099
528 Ga0265338_10000924
529 Ga0265338_10116893
530 Ga0265324_10021117
531 Ga0265327_10048038
532 Ga0265313_10113507
533 Ga0316583_10057266
534 Ga0373926_0024316
535 Ga0373936_0093672
536 Ga0373953_0261626
537 Ga0373956_0110362
538 Ga0373957_0301356
539 Ga0373943_0004768
540 Ga0373924_0111082
541 Ga0373933_0050680
542 Ga0373947_0000371
543 Ga0373937_0000725
544 Ga0373925_0001462
545 Ga0395899_0045692
546 Ga0395900_0253268
547 Ga0395898_0109506
548 Ga0395905_0308059
549 Ga0395901_0459363
550 Ga0436363_1276431
551 Ga0466965_0024499
552 Ga0466965_0257070
553 Ga0466965_0539877
554 Ga0466966_0059424
555 Ga0466961_0008333
556 Ga0466961_0014252
557 Ga0466961_0030814
558 Ga0466961_0118620
559 Ga0466963_0000102
560 Ga0466963_0003617
561 Ga0466963_0005276
562 Ga0466963_0012870
563 Ga0466963_0016078
564 Ga0466963_0019443
565 Ga0466963_0035681
566 Ga0466963_0038174
567 Ga0466964_0003428
568 Ga0466964_0006069
569 Ga0466964_0017967
570 Ga0466964_0068165
571 Ga0466964_0122918
572 Ga0466971_0015053
573 Ga0466971_0063321
574 Ga0466971_0081435
575 Ga0466968_0001167
576 Ga0466968_0091919
577 Ga0466970_0009132
578 Ga0466970_0038292
579 Ga0466970_0201142
580 Ga0466957_0005782
581 Ga0466957_0008474
582 Ga0466957_0010928
583 Ga0466957_0012050
584 Ga0466957_0188909
585 Ga0466957_0325143
586 Ga0466957_0400897
587 Ga0466957_0512068
588 Ga0466957_0609987
589 Ga0466957_0647849
590 Ga0466960_0018742
591 Ga0466960_0061333
592 Ga0466959_0024990
593 Ga0466959_0082093
594 Ga0466959_0387019
595 Ga0466958_0005167
596 Ga0466958_0005361
597 Ga0466958_0010780
598 Ga0466958_0019589
599 Ga0466958_0023292
600 Ga0466958_0023638
601 Ga0466958_0106069
602 Ga0466958_0198218
603 Ga0466967_0000094
604 Ga0466967_0011615
605 Ga0466967_0014799
606 Ga0466967_0023089
607 Ga0466967_0039568
608 Ga0466967_0053118
609 Ga0466967_0076521
610 Ga0466967_0101536
611 Ga0466967_0122027
612 Ga0466967_0275727
613 Ga0466967_0347276
614 Ga0466967_0588715
615 Ga0495592_0000050
616 Ga0495592_0140719
617 Ga0495592_0204476
618 Ga0495592_0336732
619 Ga0495603_0094958
620 Ga0495629_0006824
621 Ga0495629_0091126
622 Ga0495629_0107223
623 Ga0495641_0005829
624 Ga0495641_0029085
625 Ga0495641_0031545
626 Ga0495651_0000028
627 Ga0495651_0106647
628 Ga0495651_0556150
629 Ga0495653_0001289
630 Ga0495653_0005665
631 Ga0495653_0039159
632 Ga0495653_0447260
633 Ga0495580_0004702
634 Ga0495582_0003512
635 Ga0495582_0152107
636 Ga0495639_0000481
637 Ga0495662_0000184
638 Ga0495662_0000359
639 Ga0495662_0127326
640 Ga0495664_0006065
641 Ga0495664_0164078
642 Ga0495664_0248175
643 Ga0495584_0019684
644 Ga0495585_0178492
645 Ga0495607_0053355
646 Ga0495608_0002062
647 Ga0495608_0048015
648 Ga0495608_0081771
649 Ga0495608_0167776
650 Ga0495608_0456216
651 Ga0495618_0001024
652 Ga0495618_0051562
653 Ga0495618_0113005
654 Ga0495618_0130561
655 Ga0495618_0232721
656 Ga0495618_0244664
657 Ga0495628_0000060
658 Ga0495628_0008128
659 Ga0495628_0177947
660 Ga0495630_0000995
661 Ga0495630_0104039
662 Ga0495630_0221223
663 Ga0495644_0157446
664 Ga0495666_0000688
665 Ga0495652_0000969
666 Ga0495652_0008136
667 Ga0495652_0010648
668 Ga0495665_0004703
669 Ga0495640_0014224
670 Ga0495640_0123159
671 Ga0495640_0203567
672 Ga0495640_0213372
673 Ga0495586_0033309
674 Ga0495586_0067682
675 Ga0495587_0000062
676 Ga0495587_0086090
677 Ga0495645_0000207
678 Ga0495645_0004423
679 Ga0495645_0055416
680 Ga0495645_0379763
681 Ga0495667_0009415
682 Ga0495667_0190482
683 Ga0495667_0256554
684 Ga0495656_0017577
685 Ga0495634_0024255
686 Ga0495634_0068329
687 Ga0495611_0025819
688 Ga0495635_0009343
689 Ga0495635_0074020
690 Ga0495635_0191008
691 Ga0495661_0179833
692 Ga0495657_0014967
693 Ga0495657_0136625
694 Ga0495599_0000202
695 Ga0495599_0180866
696 Ga0495623_0000230
697 Ga0495646_0013664
698 Ga0495646_0017844
699 Ga0495646_0019601
700 Ga0495647_0000670
701 Ga0495658_0023169
702 Ga0495613_0005595
703 Ga0495613_0028992
704 Ga0495613_0183245
705 Ga0495624_0027518
706 Ga0495624_0052653
707 Ga0495624_0067971
708 Ga0495670_0054914
709 Ga0495600_0008576
710 Ga0495600_0053048
711 Ga0495600_0247676
712 Ga0495600_0763222
713 Ga0495581_0017948
714 Ga0495581_0236512
715 Ga0495604_0000262
716 Ga0495604_0045005
717 Ga0495604_0078218
718 Ga0495636_0052271
719 Ga0495674_0013316
720 Ga0495674_0354643
721 Ga0495674_0682323
722 Ga0495676_0019630
723 Ga0495676_0032491
724 Ga0495676_0211460
725 Ga0495676_0722340
726 Ga0495680_0020304
727 Ga0495680_0034009
728 Ga0495680_0109560
729 Ga0495675_0000020
730 Ga0495675_0045314
731 Ga0495677_0049076
732 Ga0495684_0012195
733 Ga0495684_0016556
734 Ga0495684_0039015
735 Ga0495593_0001863
736 Ga0495602_0000222
737 Ga0495602_0039532
738 Ga0495614_0001717
739 Ga0496100_0041479
740 Ga0496100_0206156
741 Ga0496101_0011809
742 Ga0496101_0108366
743 Ga0496102_0021075
744 Ga0496102_0082856
745 Ga0496103_0014385
746 Ga0496103_0018723
747 Ga0496104_0014672
748 Ga0496104_0015903
749 Ga0496104_0230125
750 Ga0496104_0441737
751 Ga0496105_0017378
752 Ga0496105_0019886
753 Ga0496105_0029719
754 Ga0496106_0115368
755 Ga0496106_0259759
756 Ga0496107_0009770
757 Ga0496107_0031675
758 Ga0496107_0323184
759 Ga0496108_0009079
760 Ga0496108_0034402
761 Ga0496108_0071809
762 Ga0496108_0397947
763 Ga0496109_0010667
764 Ga0496109_0026642
765 Ga0496109_0148123
766 Ga0496109_0329022
767 Ga0496109_1174499
768 Ga0496110_1021754
769 Ga0496111_0036366
770 Ga0496111_0046870
771 Ga0496112_0098299
772 Ga0496112_0106028
773 Ga0496112_0793866
774 Ga0496113_0029330
775 Ga0496113_0131356
776 Ga0496113_0644251
777 Ga0496114_0017907
778 Ga0496114_0052601
779 Ga0496114_0066011
780 Ga0496114_0382330
781 Ga0496115_0020647
782 Ga0496115_0048713
783 Ga0496115_0061199
784 Ga0496115_0079276
785 Ga0496115_0118095
786 Ga0496115_0209041
787 Ga0496115_0447098
788 Ga0501068_0552736
789 Ga0501069_0456910
790 Ga0501077_0160142
791 nmdc:mga0n895_25551_c1
792 nmdc:mga0a205_95152_c1
793 Ga0495601_0000218
794 Ga0495601_0005907
795 Ga0495601_0053519
796 Ga0495601_0158768
797 Ga0495601_0203688
798 Ga0495601_0492409
799 Ga0495612_0003098
800 Ga0495612_0016785
801 Ga0495612_0062708
802 Ga0495655_0004634
803 Ga0495655_0073844
804 Ga0495595_0063170
805 Ga0495595_0198492
806 Ga0495619_0001137
807 Ga0495619_0235244
808 Ga0495619_0355939
809 Ga0495619_0410843
810 Ga0495619_0482150
811 Ga0466962_0000096
812 Ga0466962_0020166
813 Ga0466962_0060040
814 2559428524
815 2776373704
816 2863070134
817 2866552130
818 2866555756
819 8056208182
820 8056211037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11706

zf-CGNR

CGNR zinc finger

163

206

0.99

PF07336

ABATE

Putative stress-induced transcription regulator

37

159

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.6104 1 172
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.5944 1 172
4wqr-assembly2.cif.gz_59 complex of 70s ribosome with trna-phe and mrna with c-a mismatch in the first position in the a-site. 0.4303 91 137
7dgw-assembly1.cif.gz_A de novo designed protein h4a2s 0.4197 5 124
6awb-assembly1.cif.gz_R structure of 30s ribosomal subunit and rna polymerase complex in non-rotated state 0.3692 4 88
ID Description Score Start End Superfamily
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.6207 9 172 1.10.3300.10
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.5822 9 172 1.10.3300.10
af_P43337_8_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.4568 86 120 3.90.79.10
af_A0A0R4IKJ1_281_358_1.20.1270.10 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4541 10 124 1.20.1270.10
af_P40527_568_743_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.44 89 134 3.40.1110.10
ID Description Score Start End GO Terms
AF-A0A855X4R7-F1-model_v4 Zinc finger CGNR domain-containing protein 0.8959 8 176
AF-A0A2S6GT42-F1-model_v4 Putative RNA-binding Zn ribbon-like protein 0.8908 4 176
AF-A0A535EJH2-F1-model_v4 Zinc finger CGNR domain-containing protein 0.8847 47 175
AF-A0A316ISY2-F1-model_v4 Putative RNA-binding Zn ribbon-like protein 0.8833 10 173
AF-A0A838SPJ3-F1-model_v4 CGNR zinc finger domain-containing protein 0.8826 4 175

Map