F437115

General Info

Members Datasets Scaffolds Average Seq Length
409 208 818 142

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_75146_c1|nmdc:mga06r32_75146_c1_1154_1660
Length 168
Sequence MKGSGERVVVPIRLTSEQLHQIRKQGEATYPYECCGLLLGHIVSDEKVVAETYAAENAKEEGAQHNRFLISPEAVRKAEEYARNQKLEILGFYHSHPNAPARPSQFDLDHAWPFYSYIIVSVKDGKAEDLTCWRMRDDRSCFDPEQMKGAESAVRHPESGVGSSELGV

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
80 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
144 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
145 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
146 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
149 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
150 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
189 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
190 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 1.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.71
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 13.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_75146_c1 3300050510 Bacteria 3278
2 Ga0058862_12748644 3300004803 Bacteria 695
3 Ga0065715_10246074 3300005293 Bacteria 1183
4 Ga0065715_10347248 3300005293 Unclassified 957
5 Ga0065707_10177164 3300005295 Bacteria 1442
6 Ga0070676_10004645 3300005328 Bacteria 7254
7 Ga0070676_10449698 3300005328 Bacteria 906
8 Ga0070676_10599510 3300005328 Bacteria 794
9 Ga0070683_100625022 3300005329 Bacteria 1031
10 Ga0070690_100123041 3300005330 Bacteria 1743
11 Ga0070690_100383895 3300005330 Bacteria 1027
12 Ga0070670_100001976 3300005331 Bacteria 16769
13 Ga0070670_100938034 3300005331 Bacteria 786
14 Ga0070677_10199217 3300005333 Bacteria 965
15 Ga0070677_10350014 3300005333 Unclassified 765
16 Ga0068869_100003381 3300005334 Bacteria 9738
17 Ga0068869_100705596 3300005334 Bacteria 861
18 Ga0070666_10204664 3300005335 Bacteria 1389
19 Ga0068868_101006237 3300005338 Unclassified 763
20 Ga0070689_100112979 3300005340 Bacteria 2163
21 Ga0070687_101515243 3300005343 Unclassified 505
22 Ga0070661_100495772 3300005344 Bacteria 977
23 Ga0070669_100083542 3300005353 Bacteria 2381
24 Ga0070669_100397736 3300005353 Bacteria 1127
25 Ga0070669_101134795 3300005353 Bacteria 674
26 Ga0070675_100005569 3300005354 Bacteria 9644
27 Ga0070675_100396881 3300005354 Unclassified 1230
28 Ga0070675_100604814 3300005354 Bacteria 994
29 Ga0070675_100758332 3300005354 Bacteria 886
30 Ga0070675_101620298 3300005354 Unclassified 597
31 Ga0070675_101984878 3300005354 Bacteria 536
32 Ga0070674_100201123 3300005356 Bacteria 1538
33 Ga0070674_100210906 3300005356 Bacteria 1505
34 Ga0070674_100227974 3300005356 Bacteria 1452
35 Ga0070673_100065056 3300005364 Bacteria 2907
36 Ga0070673_100341116 3300005364 Bacteria 1328
37 Ga0070688_100304024 3300005365 Bacteria 1154
38 Ga0070688_101777933 3300005365 Bacteria 506
39 Ga0070659_101610344 3300005366 Unclassified 580
40 Ga0070701_10078171 3300005438 Bacteria 1785
41 Ga0070700_100004253 3300005441 Bacteria 7475
42 Ga0070700_100894290 3300005441 Bacteria 722
43 Ga0070694_100334185 3300005444 Bacteria 1170
44 Ga0070663_100226443 3300005455 Bacteria 1470
45 Ga0070678_100085575 3300005456 Bacteria 2403
46 Ga0070678_100085839 3300005456 Bacteria 2399
47 Ga0070678_100233548 3300005456 Bacteria 1534
48 Ga0070662_101093795 3300005457 Bacteria 684
49 Ga0070681_10036647 3300005458 Bacteria 4924
50 Ga0068867_100006782 3300005459 Bacteria 8094
51 Ga0068867_100311215 3300005459 Bacteria 1301
52 Ga0068867_102020896 3300005459 Bacteria 545
53 Ga0070685_10075886 3300005466 Bacteria 2003
54 Ga0070698_100734668 3300005471 Bacteria 930
55 Ga0070672_100062654 3300005543 Bacteria 2935
56 Ga0070672_100105418 3300005543 Bacteria 2292
57 Ga0070672_100165608 3300005543 Unclassified 1836
58 Ga0070672_100388428 3300005543 Bacteria 1195
59 Ga0070672_100444870 3300005543 Bacteria 1116
60 Ga0070672_100456853 3300005543 Bacteria 1101
61 Ga0070672_100904602 3300005543 Bacteria 780
62 Ga0070686_100047013 3300005544 Bacteria 2727
63 Ga0070686_100100277 3300005544 Bacteria 1955
64 Ga0070696_101935660 3300005546 Unclassified 511
65 Ga0070693_100767791 3300005547 Bacteria 712
66 Ga0070665_100390080 3300005548 Bacteria 1400
67 Ga0068855_101114982 3300005563 Bacteria 824
68 Ga0070664_100002860 3300005564 Bacteria 13977
69 Ga0070664_100084580 3300005564 Bacteria 2739
70 Ga0070664_100684161 3300005564 Bacteria 955
71 Ga0068857_100367607 3300005577 Bacteria 1334
72 Ga0070702_100265662 3300005615 Bacteria 1171
73 Ga0070702_101481470 3300005615 Bacteria 558
74 Ga0070702_101487691 3300005615 Unclassified 557
75 Ga0068859_100114599 3300005617 Bacteria 2760
76 Ga0068859_100193416 3300005617 Bacteria 2119
77 Ga0068859_100512352 3300005617 Bacteria 1295
78 Ga0068864_100714928 3300005618 Unclassified 979
79 Ga0068864_100746621 3300005618 Bacteria 959
80 Ga0068864_101451260 3300005618 Unclassified 689
81 Ga0068866_10428679 3300005718 Bacteria 859
82 Ga0068861_101054802 3300005719 Bacteria 779
83 Ga0068870_10145538 3300005840 Bacteria 1390
84 Ga0068870_10604478 3300005840 Unclassified 745
85 Ga0068863_100788257 3300005841 Unclassified 947
86 Ga0068858_100572029 3300005842 Bacteria 1095
87 Ga0068860_100289031 3300005843 Bacteria 1604
88 Ga0068860_100306568 3300005843 Bacteria 1556
89 Ga0068860_100898836 3300005843 Bacteria 901
90 Ga0068862_100835781 3300005844 Bacteria 901
91 Ga0068862_101930479 3300005844 Unclassified 600
92 Ga0097621_100369780 3300006237 Bacteria 1279
93 Ga0097621_100732996 3300006237 Bacteria 912
94 Ga0097621_100866175 3300006237 Bacteria 840
95 Ga0068871_100242396 3300006358 Bacteria 1568
96 Ga0068871_100350046 3300006358 Unclassified 1306
97 Ga0075428_100078228 3300006844 Bacteria 3610
98 Ga0075428_100087118 3300006844 Bacteria 3406
99 Ga0075428_100155451 3300006844 Bacteria 2485
100 Ga0075428_100390712 3300006844 Bacteria 1491
101 Ga0075430_100011544 3300006846 Bacteria 7509
102 Ga0075430_100058799 3300006846 Bacteria 3232
103 Ga0075430_100105915 3300006846 Bacteria 2346
104 Ga0075431_100033445 3300006847 Bacteria 5299
105 Ga0075431_100043497 3300006847 Bacteria 4634
106 Ga0075431_100135443 3300006847 Unclassified 2539
107 Ga0075431_101044691 3300006847 Bacteria 783
108 Ga0075431_101084343 3300006847 Unclassified 766
109 Ga0075433_10052160 3300006852 Bacteria 3563
110 Ga0075433_10766037 3300006852 Bacteria 844
111 Ga0075434_100086344 3300006871 Bacteria 3138
112 Ga0075429_100002500 3300006880 Bacteria 15462
113 Ga0075429_100028238 3300006880 Bacteria 4871
114 Ga0075429_100191044 3300006880 Bacteria 1794
115 Ga0075429_100439213 3300006880 Unclassified 1143
116 Ga0075429_101970470 3300006880 Bacteria 506
117 Ga0068865_100010155 3300006881 Bacteria 5852
118 Ga0068865_100052028 3300006881 Bacteria 2837
119 Ga0068865_100192029 3300006881 Bacteria 1580
120 Ga0068865_101111308 3300006881 Bacteria 696
121 Ga0097620_100114604 3300006931 Bacteria 2760
122 Ga0097620_100193430 3300006931 Bacteria 2119
123 Ga0097620_100512307 3300006931 Bacteria 1295
124 Ga0105244_10182622 3300009036 Bacteria 994
125 Ga0111539_10000301 3300009094 Bacteria 59888
126 Ga0111539_10003762 3300009094 Bacteria 19974
127 Ga0111539_10091263 3300009094 Bacteria 3579
128 Ga0111539_10609984 3300009094 Bacteria 1271
129 Ga0111539_10658993 3300009094 Bacteria 1219
130 Ga0111539_11455687 3300009094 Unclassified 794
131 Ga0111539_12979935 3300009094 Unclassified 547
132 Ga0105245_11399504 3300009098 Bacteria 749
133 Ga0114129_10005797 3300009147 Bacteria 17486
134 Ga0114129_10066644 3300009147 Bacteria 5022
135 Ga0114129_10103315 3300009147 Bacteria 3940
136 Ga0114129_10123588 3300009147 Bacteria 3559
137 Ga0114129_10307894 3300009147 Bacteria 2109
138 Ga0114129_10315698 3300009147 Bacteria 2079
139 Ga0114129_10335094 3300009147 Bacteria 2008
140 Ga0114129_10516236 3300009147 Unclassified 1558
141 Ga0114129_11014279 3300009147 Bacteria 1044
142 Ga0114129_11520283 3300009147 Unclassified 822
143 Ga0105243_10477156 3300009148 Bacteria 1176
144 Ga0105243_11142002 3300009148 Bacteria 789
145 Ga0105243_12778241 3300009148 Bacteria 530
146 Ga0105242_10453873 3300009176 Bacteria 1209
147 Ga0105242_10505320 3300009176 Bacteria 1150
148 Ga0105242_10929783 3300009176 Bacteria 872
149 Ga0105242_11027133 3300009176 Unclassified 834
150 Ga0105248_10115039 3300009177 Bacteria 3034
151 Ga0105248_10137757 3300009177 Bacteria 2753
152 Ga0105248_10506386 3300009177 Bacteria 1361
153 Ga0105248_12617766 3300009177 Bacteria 575
154 Ga0105249_10701095 3300009553 Bacteria 1072
155 Ga0105249_10993259 3300009553 Bacteria 908
156 Ga0105246_10342986 3300011119 Bacteria 1221
157 Ga0105246_12031626 3300011119 Unclassified 555
158 Ga0157374_10143898 3300013296 Bacteria 2315
159 Ga0157374_11060704 3300013296 Bacteria 830
160 Ga0157378_10225466 3300013297 Bacteria 1783
161 Ga0163162_10830555 3300013306 Unclassified 1040
162 Ga0163162_11044353 3300013306 Bacteria 925
163 Ga0163162_11939143 3300013306 Unclassified 674
164 Ga0157372_10782204 3300013307 Bacteria 1109
165 Ga0157375_10212333 3300013308 Bacteria 2093
166 Ga0157375_10460365 3300013308 Bacteria 1437
167 Ga0157375_10498964 3300013308 Bacteria 1381
168 Ga0157375_10551261 3300013308 Bacteria 1314
169 Ga0157375_10747396 3300013308 Bacteria 1129
170 Ga0157375_10977811 3300013308 Unclassified 987
171 Ga0163163_10063738 3300014325 Bacteria 3656
172 Ga0163163_10247655 3300014325 Bacteria 1832
173 Ga0163163_11255252 3300014325 Unclassified 803
174 Ga0163163_11606028 3300014325 Unclassified 711
175 Ga0157380_10010374 3300014326 Bacteria 6701
176 Ga0157380_10025464 3300014326 Bacteria 4487
177 Ga0157380_10089793 3300014326 Bacteria 2533
178 Ga0157380_10099269 3300014326 Bacteria 2421
179 Ga0157380_10391936 3300014326 Bacteria 1314
180 Ga0157380_10651681 3300014326 Bacteria 1050
181 Ga0157380_10761604 3300014326 Bacteria 981
182 Ga0157380_11640142 3300014326 Unclassified 699
183 Ga0157376_10624957 3300014969 Bacteria 1075
184 Ga0157376_11139824 3300014969 Bacteria 807
185 Ga0157376_11228575 3300014969 Bacteria 778
186 Ga0157376_11704296 3300014969 Bacteria 665
187 Ga0163161_10168199 3300017792 Bacteria 1675
188 Ga0163161_10478307 3300017792 Bacteria 1011
189 Ga0206356_11913046 3300020070 Bacteria 901
190 Ga0206355_1160654 3300020076 Unclassified 924
191 Ga0206351_10118725 3300020077 Bacteria 2305
192 Ga0206352_10327221 3300020078 Bacteria 721
193 Ga0206350_10258056 3300020080 Bacteria 1052
194 Ga0206353_10999076 3300020082 Bacteria 883
195 Ga0207682_10046973 3300025893 Bacteria 1776
196 Ga0207642_10005695 3300025899 Bacteria 4084
197 Ga0207688_10088110 3300025901 Bacteria 1780
198 Ga0207680_10107922 3300025903 Bacteria 1800
199 Ga0207645_10007084 3300025907 Bacteria 7971
200 Ga0207643_10615128 3300025908 Unclassified 700
201 Ga0207705_11230769 3300025909 Bacteria 574
202 Ga0207707_10087976 3300025912 Bacteria 2714
203 Ga0207662_10121727 3300025918 Bacteria 1637
204 Ga0207657_10652305 3300025919 Bacteria 819
205 Ga0207649_10074960 3300025920 Bacteria 2173
206 Ga0207649_10232296 3300025920 Bacteria 1320
207 Ga0207681_10062348 3300025923 Bacteria 2567
208 Ga0207650_10003641 3300025925 Bacteria 10556
209 Ga0207650_10595339 3300025925 Bacteria 929
210 Ga0207650_10826351 3300025925 Bacteria 786
211 Ga0207650_10837970 3300025925 Bacteria 780
212 Ga0207659_10010252 3300025926 Bacteria 5881
213 Ga0207659_10021753 3300025926 Bacteria 4263
214 Ga0207659_10322751 3300025926 Unclassified 1274
215 Ga0207659_10520442 3300025926 Bacteria 1009
216 Ga0207659_10826596 3300025926 Bacteria 796
217 Ga0207659_10926230 3300025926 Bacteria 749
218 Ga0207659_11395132 3300025926 Unclassified 601
219 Ga0207687_10753841 3300025927 Bacteria 829
220 Ga0207644_10150848 3300025931 Bacteria 1798
221 Ga0207644_11750537 3300025931 Bacteria 520
222 Ga0207690_10377745 3300025932 Bacteria 1125
223 Ga0207706_10068362 3300025933 Bacteria 3126
224 Ga0207706_10314363 3300025933 Bacteria 1364
225 Ga0207706_10388676 3300025933 Bacteria 1210
226 Ga0207706_10661471 3300025933 Bacteria 894
227 Ga0207686_10066206 3300025934 Bacteria 2307
228 Ga0207686_10402022 3300025934 Bacteria 1043
229 Ga0207709_10076589 3300025935 Bacteria 2142
230 Ga0207669_10041595 3300025937 Bacteria 2676
231 Ga0207669_11043730 3300025937 Unclassified 688
232 Ga0207669_11424731 3300025937 Unclassified 590
233 Ga0207704_10783182 3300025938 Bacteria 795
234 Ga0207704_11449669 3300025938 Unclassified 589
235 Ga0207691_10081263 3300025940 Bacteria 2913
236 Ga0207691_10082838 3300025940 Bacteria 2881
237 Ga0207691_10125171 3300025940 Bacteria 2275
238 Ga0207691_10272908 3300025940 Bacteria 1456
239 Ga0207711_10060575 3300025941 Bacteria 3262
240 Ga0207711_10135354 3300025941 Bacteria 2213
241 Ga0207711_11047060 3300025941 Bacteria 756
242 Ga0207711_11849211 3300025941 Unclassified 547
243 Ga0207689_10000643 3300025942 Bacteria 33304
244 Ga0207689_10513945 3300025942 Bacteria 1004
245 Ga0207679_10064471 3300025945 Bacteria 2738
246 Ga0207679_11091523 3300025945 Bacteria 732
247 Ga0207651_10096829 3300025960 Bacteria 2177
248 Ga0207651_10323443 3300025960 Bacteria 1290
249 Ga0207651_10607246 3300025960 Bacteria 957
250 Ga0207651_11059725 3300025960 Bacteria 726
251 Ga0207712_11655201 3300025961 Unclassified 574
252 Ga0207668_10265147 3300025972 Bacteria 1402
253 Ga0207640_10079787 3300025981 Bacteria 2232
254 Ga0207658_11037112 3300025986 Bacteria 749
255 Ga0207703_10023282 3300026035 Bacteria 4865
256 Ga0207703_10113685 3300026035 Bacteria 2314
257 Ga0207703_10155935 3300026035 Bacteria 1995
258 Ga0207708_10005948 3300026075 Bacteria 9028
259 Ga0207708_10220139 3300026075 Bacteria 1521
260 Ga0207641_10923645 3300026088 Unclassified 867
261 Ga0207648_10002125 3300026089 Bacteria 21549
262 Ga0207648_10476346 3300026089 Bacteria 1140
263 Ga0207648_11748344 3300026089 Unclassified 583
264 Ga0207676_10140125 3300026095 Bacteria 2069
265 Ga0207674_10203724 3300026116 Bacteria 1928
266 Ga0207675_100012811 3300026118 Bacteria 7835
267 Ga0207675_100062040 3300026118 Bacteria 3490
268 Ga0207683_10077400 3300026121 Bacteria 2946
269 Ga0207683_10243994 3300026121 Bacteria 1639
270 Ga0207683_11361879 3300026121 Bacteria 656
271 Ga0207698_10291150 3300026142 Bacteria 1515
272 Ga0207428_10002111 3300027907 Bacteria 20033
273 Ga0207428_10007686 3300027907 Bacteria 9813
274 Ga0268266_11317080 3300028379 Bacteria 698
275 Ga0268265_10183455 3300028380 Bacteria 1800
276 Ga0268265_10486900 3300028380 Bacteria 1160
277 Ga0268265_10721150 3300028380 Bacteria 965
278 Ga0268264_11276716 3300028381 Bacteria 744
279 Ga0265338_10691826 3300028800 Unclassified 704
280 Ga0307408_100172529 3300031548 Bacteria 1728
281 Ga0307408_100304260 3300031548 Bacteria 1337
282 Ga0307408_100363059 3300031548 Bacteria 1232
283 Ga0307405_10212534 3300031731 Bacteria 1413
284 Ga0307405_10707322 3300031731 Bacteria 835
285 Ga0307413_10434770 3300031824 Bacteria 1037
286 Ga0307410_10421342 3300031852 Bacteria 1083
287 Ga0307412_10153792 3300031911 Bacteria 1701
288 Ga0307412_10747269 3300031911 Bacteria 844
289 Ga0307409_100055472 3300031995 Bacteria 3060
290 Ga0307409_100136910 3300031995 Bacteria 2103
291 Ga0307409_100980397 3300031995 Bacteria 862
292 Ga0307409_101253629 3300031995 Unclassified 766
293 Ga0307409_102184583 3300031995 Bacteria 583
294 Ga0307416_100159060 3300032002 Bacteria 2085
295 Ga0307416_100401815 3300032002 Bacteria 1408
296 Ga0307416_100493302 3300032002 Bacteria 1287
297 Ga0307416_101167172 3300032002 Bacteria 875
298 Ga0307411_10009304 3300032005 Bacteria 5157
299 Ga0307411_10038411 3300032005 Bacteria 3020
300 Ga0307415_100612796 3300032126 Bacteria 970
301 Ga0439439_0043856 3300041406 Bacteria 1164
302 Ga0451800_0168694 3300041459 Bacteria 743
303 Ga0451807_2423788 3300041486 Bacteria 797
304 Ga0451849_0533260 3300041505 Unclassified 584
305 Ga0451853_0013313 3300041512 Bacteria 1361
306 Ga0439441_018735 3300042001 Bacteria 1254
307 Ga0439457_022169 3300042014 Bacteria 1406
308 Ga0439457_045010 3300042014 Bacteria 986
309 Ga0450920_021211 3300042122 Bacteria 1255
310 Ga0450923_149005 3300042125 Bacteria 565
311 Ga0439435_0020524 3300042436 Bacteria 1705
312 Ga0439435_0021516 3300042436 Bacteria 1675
313 Ga0439444_0015788 3300042437 Unclassified 1279
314 Ga0439464_0004488 3300042439 Bacteria 3572
315 Ga0450893_0058583 3300042532 Bacteria 732
316 Ga0450893_0080819 3300042532 Bacteria 642
317 Ga0451576_0037028 3300045051 Bacteria 5170
318 Ga0451576_1564446 3300045051 Unclassified 684
319 Ga0495629_0008521 3300046459 Bacteria 7549
320 Ga0495580_0556980 3300046472 Bacteria 761
321 Ga0495643_0009813 3300046522 Bacteria 5922
322 Ga0495644_0397724 3300046523 Bacteria 545
323 Ga0495598_0148005 3300046537 Bacteria 817
324 Ga0495621_0020441 3300046539 Bacteria 2173
325 Ga0495621_0103163 3300046539 Bacteria 1087
326 Ga0495656_0165674 3300046615 Bacteria 1077
327 Ga0495658_0317547 3300046683 Bacteria 987
328 Ga0495669_0106519 3300046684 Bacteria 1306
329 Ga0495624_0627088 3300046690 Unclassified 640
330 Ga0495676_0068649 3300047321 Bacteria 2738
331 Ga0496100_0159915 3300048903 Bacteria 1614
332 Ga0496104_0199848 3300048907 Unclassified 1911
333 Ga0496106_0103582 3300048909 Bacteria 2209
334 Ga0496112_0411113 3300048915 Bacteria 1292
335 Ga0496114_0637556 3300048917 Bacteria 938
336 Ga0501298_041850 3300049521 Bacteria 930
337 Ga0501031_0479754 3300049568 Bacteria 803
338 Ga0501034_1045596 3300049571 Bacteria 699
339 Ga0501036_0087143 3300049572 Bacteria 2639
340 Ga0501037_0318077 3300049573 Bacteria 1078
341 Ga0501038_0359946 3300049574 Bacteria 1132
342 Ga0501040_0013458 3300049576 Bacteria 5378
343 Ga0501040_0362699 3300049576 Bacteria 1038
344 Ga0501041_0048777 3300049577 Bacteria 2579
345 Ga0501042_0017386 3300049578 Bacteria 4959
346 Ga0501042_0884021 3300049578 Bacteria 651
347 Ga0501043_0199422 3300049579 Bacteria 1554
348 Ga0501046_0176535 3300049580 Bacteria 1600
349 Ga0501048_0085150 3300049582 Bacteria 2229
350 Ga0501048_0135129 3300049582 Bacteria 1743
351 Ga0501067_0068249 3300049583 Bacteria 1968
352 Ga0501068_0089981 3300049584 Bacteria 1893
353 Ga0501069_0366678 3300049585 Bacteria 850
354 Ga0501071_0365759 3300049587 Bacteria 1099
355 Ga0501071_0693255 3300049587 Unclassified 784
356 Ga0501072_0004494 3300049588 Bacteria 10599
357 Ga0501074_0457603 3300049590 Bacteria 905
358 Ga0501075_0131485 3300049591 Bacteria 1907
359 Ga0501075_0292314 3300049591 Bacteria 1241
360 Ga0501076_1435781 3300049592 Unclassified 567
361 Ga0501230_077625 3300049667 Bacteria 691
362 Ga0501249_021039 3300049679 Bacteria 1422
363 Ga0501253_110182 3300049683 Bacteria 656
364 Ga0501079_0011258 3300049741 Bacteria 6825
365 Ga0501080_0803380 3300049742 Unclassified 825
366 Ga0501080_1073950 3300049742 Bacteria 696
367 Ga0501081_0107230 3300049743 Unclassified 1981
368 Ga0501272_015692 3300049769 Bacteria 883
369 Ga0501044_0889570 3300049823 Bacteria 766
370 Ga0501045_0866716 3300049824 Bacteria 664
371 nmdc:mga05p37_110519_c1 3300050507 Bacteria 3381
372 nmdc:mga05p37_20793_c1 3300050507 Bacteria 7943
373 nmdc:mga05p37_699823_c1 3300050507 Bacteria 1126
374 nmdc:mga05p37_715492_c1 3300050507 Unclassified 1110
375 nmdc:mga05p37_740842_c1 3300050507 Bacteria 1085
376 nmdc:mga05p37_88358_c1 3300050507 Bacteria 3820
377 nmdc:mga09592_1553261_c1 3300050508 Bacteria 537
378 nmdc:mga09592_187934_c1 3300050508 Bacteria 1788
379 nmdc:mga09592_33360_c1 3300050508 Bacteria 4296
380 nmdc:mga09592_6224_c1 3300050508 Bacteria 9715
381 nmdc:mga09592_8561_c1 3300050508 Bacteria 8320
382 nmdc:mga0qj67_11568_c1 3300050509 Bacteria 6617
383 nmdc:mga0qj67_18284_c1 3300050509 Bacteria 5342
384 nmdc:mga0qj67_202994_c1 3300050509 Bacteria 1610
385 nmdc:mga0qj67_607_c1 3300050509 Bacteria 24529
386 nmdc:mga06r32_30603_c1 3300050510 Bacteria 5051
387 nmdc:mga06r32_39649_c1 3300050510 Bacteria 4470
388 nmdc:mga08y16_1014_c1 3300050511 Bacteria 27498
389 nmdc:mga08y16_1158385_c1 3300050511 Bacteria 746
390 nmdc:mga08y16_144742_c1 3300050511 Bacteria 2470
391 nmdc:mga08y16_349_c1 3300050511 Bacteria 41563
392 nmdc:mga08y16_3704_c1 3300050511 Bacteria 15912
393 nmdc:mga08y16_588368_c1 3300050511 Bacteria 1123
394 nmdc:mga08y16_983442_c1 3300050511 Unclassified 825
395 nmdc:mga0n895_11477_c1 3300050512 Bacteria 7906
396 nmdc:mga0n895_124686_c1 3300050512 Bacteria 2599
397 nmdc:mga0n895_1588398_c1 3300050512 Unclassified 619
398 nmdc:mga0n895_1761_c1 3300050512 Bacteria 16394
399 nmdc:mga0rr50_223656_c1 3300050513 Bacteria 1555
400 nmdc:mga0rr50_32976_c1 3300050513 Bacteria 3696
401 nmdc:mga0a205_117756_c1 3300050515 Bacteria 2555
402 nmdc:mga0a205_119_c1 3300050515 Bacteria 47408
403 nmdc:mga0a205_137171_c1 3300050515 Bacteria 2347
404 nmdc:mga0a205_563_c1 3300050515 Bacteria 29491
405 Ga0501084_0074188 3300054114 Bacteria 2849
406 Ga0590071_046534 3300059421 Bacteria 1048
407 Ga0590075_014918 3300059424 Bacteria 1903
408 Ga0590077_009079 3300059426 Bacteria 2036
409 Ga0530510_0028623 3300061734 Bacteria 3996
410 nmdc:mga06r32_75146_c1
411 Ga0058862_12748644
412 Ga0065715_10246074
413 Ga0065715_10347248
414 Ga0065707_10177164
415 Ga0070676_10004645
416 Ga0070676_10449698
417 Ga0070676_10599510
418 Ga0070683_100625022
419 Ga0070690_100123041
420 Ga0070690_100383895
421 Ga0070670_100001976
422 Ga0070670_100938034
423 Ga0070677_10199217
424 Ga0070677_10350014
425 Ga0068869_100003381
426 Ga0068869_100705596
427 Ga0070666_10204664
428 Ga0068868_101006237
429 Ga0070689_100112979
430 Ga0070687_101515243
431 Ga0070661_100495772
432 Ga0070669_100083542
433 Ga0070669_100397736
434 Ga0070669_101134795
435 Ga0070675_100005569
436 Ga0070675_100396881
437 Ga0070675_100604814
438 Ga0070675_100758332
439 Ga0070675_101620298
440 Ga0070675_101984878
441 Ga0070674_100201123
442 Ga0070674_100210906
443 Ga0070674_100227974
444 Ga0070673_100065056
445 Ga0070673_100341116
446 Ga0070688_100304024
447 Ga0070688_101777933
448 Ga0070659_101610344
449 Ga0070701_10078171
450 Ga0070700_100004253
451 Ga0070700_100894290
452 Ga0070694_100334185
453 Ga0070663_100226443
454 Ga0070678_100085575
455 Ga0070678_100085839
456 Ga0070678_100233548
457 Ga0070662_101093795
458 Ga0070681_10036647
459 Ga0068867_100006782
460 Ga0068867_100311215
461 Ga0068867_102020896
462 Ga0070685_10075886
463 Ga0070698_100734668
464 Ga0070672_100062654
465 Ga0070672_100105418
466 Ga0070672_100165608
467 Ga0070672_100388428
468 Ga0070672_100444870
469 Ga0070672_100456853
470 Ga0070672_100904602
471 Ga0070686_100047013
472 Ga0070686_100100277
473 Ga0070696_101935660
474 Ga0070693_100767791
475 Ga0070665_100390080
476 Ga0068855_101114982
477 Ga0070664_100002860
478 Ga0070664_100084580
479 Ga0070664_100684161
480 Ga0068857_100367607
481 Ga0070702_100265662
482 Ga0070702_101481470
483 Ga0070702_101487691
484 Ga0068859_100114599
485 Ga0068859_100193416
486 Ga0068859_100512352
487 Ga0068864_100714928
488 Ga0068864_100746621
489 Ga0068864_101451260
490 Ga0068866_10428679
491 Ga0068861_101054802
492 Ga0068870_10145538
493 Ga0068870_10604478
494 Ga0068863_100788257
495 Ga0068858_100572029
496 Ga0068860_100289031
497 Ga0068860_100306568
498 Ga0068860_100898836
499 Ga0068862_100835781
500 Ga0068862_101930479
501 Ga0097621_100369780
502 Ga0097621_100732996
503 Ga0097621_100866175
504 Ga0068871_100242396
505 Ga0068871_100350046
506 Ga0075428_100078228
507 Ga0075428_100087118
508 Ga0075428_100155451
509 Ga0075428_100390712
510 Ga0075430_100011544
511 Ga0075430_100058799
512 Ga0075430_100105915
513 Ga0075431_100033445
514 Ga0075431_100043497
515 Ga0075431_100135443
516 Ga0075431_101044691
517 Ga0075431_101084343
518 Ga0075433_10052160
519 Ga0075433_10766037
520 Ga0075434_100086344
521 Ga0075429_100002500
522 Ga0075429_100028238
523 Ga0075429_100191044
524 Ga0075429_100439213
525 Ga0075429_101970470
526 Ga0068865_100010155
527 Ga0068865_100052028
528 Ga0068865_100192029
529 Ga0068865_101111308
530 Ga0097620_100114604
531 Ga0097620_100193430
532 Ga0097620_100512307
533 Ga0105244_10182622
534 Ga0111539_10000301
535 Ga0111539_10003762
536 Ga0111539_10091263
537 Ga0111539_10609984
538 Ga0111539_10658993
539 Ga0111539_11455687
540 Ga0111539_12979935
541 Ga0105245_11399504
542 Ga0114129_10005797
543 Ga0114129_10066644
544 Ga0114129_10103315
545 Ga0114129_10123588
546 Ga0114129_10307894
547 Ga0114129_10315698
548 Ga0114129_10335094
549 Ga0114129_10516236
550 Ga0114129_11014279
551 Ga0114129_11520283
552 Ga0105243_10477156
553 Ga0105243_11142002
554 Ga0105243_12778241
555 Ga0105242_10453873
556 Ga0105242_10505320
557 Ga0105242_10929783
558 Ga0105242_11027133
559 Ga0105248_10115039
560 Ga0105248_10137757
561 Ga0105248_10506386
562 Ga0105248_12617766
563 Ga0105249_10701095
564 Ga0105249_10993259
565 Ga0105246_10342986
566 Ga0105246_12031626
567 Ga0157374_10143898
568 Ga0157374_11060704
569 Ga0157378_10225466
570 Ga0163162_10830555
571 Ga0163162_11044353
572 Ga0163162_11939143
573 Ga0157372_10782204
574 Ga0157375_10212333
575 Ga0157375_10460365
576 Ga0157375_10498964
577 Ga0157375_10551261
578 Ga0157375_10747396
579 Ga0157375_10977811
580 Ga0163163_10063738
581 Ga0163163_10247655
582 Ga0163163_11255252
583 Ga0163163_11606028
584 Ga0157380_10010374
585 Ga0157380_10025464
586 Ga0157380_10089793
587 Ga0157380_10099269
588 Ga0157380_10391936
589 Ga0157380_10651681
590 Ga0157380_10761604
591 Ga0157380_11640142
592 Ga0157376_10624957
593 Ga0157376_11139824
594 Ga0157376_11228575
595 Ga0157376_11704296
596 Ga0163161_10168199
597 Ga0163161_10478307
598 Ga0206356_11913046
599 Ga0206355_1160654
600 Ga0206351_10118725
601 Ga0206352_10327221
602 Ga0206350_10258056
603 Ga0206353_10999076
604 Ga0207682_10046973
605 Ga0207642_10005695
606 Ga0207688_10088110
607 Ga0207680_10107922
608 Ga0207645_10007084
609 Ga0207643_10615128
610 Ga0207705_11230769
611 Ga0207707_10087976
612 Ga0207662_10121727
613 Ga0207657_10652305
614 Ga0207649_10074960
615 Ga0207649_10232296
616 Ga0207681_10062348
617 Ga0207650_10003641
618 Ga0207650_10595339
619 Ga0207650_10826351
620 Ga0207650_10837970
621 Ga0207659_10010252
622 Ga0207659_10021753
623 Ga0207659_10322751
624 Ga0207659_10520442
625 Ga0207659_10826596
626 Ga0207659_10926230
627 Ga0207659_11395132
628 Ga0207687_10753841
629 Ga0207644_10150848
630 Ga0207644_11750537
631 Ga0207690_10377745
632 Ga0207706_10068362
633 Ga0207706_10314363
634 Ga0207706_10388676
635 Ga0207706_10661471
636 Ga0207686_10066206
637 Ga0207686_10402022
638 Ga0207709_10076589
639 Ga0207669_10041595
640 Ga0207669_11043730
641 Ga0207669_11424731
642 Ga0207704_10783182
643 Ga0207704_11449669
644 Ga0207691_10081263
645 Ga0207691_10082838
646 Ga0207691_10125171
647 Ga0207691_10272908
648 Ga0207711_10060575
649 Ga0207711_10135354
650 Ga0207711_11047060
651 Ga0207711_11849211
652 Ga0207689_10000643
653 Ga0207689_10513945
654 Ga0207679_10064471
655 Ga0207679_11091523
656 Ga0207651_10096829
657 Ga0207651_10323443
658 Ga0207651_10607246
659 Ga0207651_11059725
660 Ga0207712_11655201
661 Ga0207668_10265147
662 Ga0207640_10079787
663 Ga0207658_11037112
664 Ga0207703_10023282
665 Ga0207703_10113685
666 Ga0207703_10155935
667 Ga0207708_10005948
668 Ga0207708_10220139
669 Ga0207641_10923645
670 Ga0207648_10002125
671 Ga0207648_10476346
672 Ga0207648_11748344
673 Ga0207676_10140125
674 Ga0207674_10203724
675 Ga0207675_100012811
676 Ga0207675_100062040
677 Ga0207683_10077400
678 Ga0207683_10243994
679 Ga0207683_11361879
680 Ga0207698_10291150
681 Ga0207428_10002111
682 Ga0207428_10007686
683 Ga0268266_11317080
684 Ga0268265_10183455
685 Ga0268265_10486900
686 Ga0268265_10721150
687 Ga0268264_11276716
688 Ga0265338_10691826
689 Ga0307408_100172529
690 Ga0307408_100304260
691 Ga0307408_100363059
692 Ga0307405_10212534
693 Ga0307405_10707322
694 Ga0307413_10434770
695 Ga0307410_10421342
696 Ga0307412_10153792
697 Ga0307412_10747269
698 Ga0307409_100055472
699 Ga0307409_100136910
700 Ga0307409_100980397
701 Ga0307409_101253629
702 Ga0307409_102184583
703 Ga0307416_100159060
704 Ga0307416_100401815
705 Ga0307416_100493302
706 Ga0307416_101167172
707 Ga0307411_10009304
708 Ga0307411_10038411
709 Ga0307415_100612796
710 Ga0439439_0043856
711 Ga0451800_0168694
712 Ga0451807_2423788
713 Ga0451849_0533260
714 Ga0451853_0013313
715 Ga0439441_018735
716 Ga0439457_022169
717 Ga0439457_045010
718 Ga0450920_021211
719 Ga0450923_149005
720 Ga0439435_0020524
721 Ga0439435_0021516
722 Ga0439444_0015788
723 Ga0439464_0004488
724 Ga0450893_0058583
725 Ga0450893_0080819
726 Ga0451576_0037028
727 Ga0451576_1564446
728 Ga0495629_0008521
729 Ga0495580_0556980
730 Ga0495643_0009813
731 Ga0495644_0397724
732 Ga0495598_0148005
733 Ga0495621_0020441
734 Ga0495621_0103163
735 Ga0495656_0165674
736 Ga0495658_0317547
737 Ga0495669_0106519
738 Ga0495624_0627088
739 Ga0495676_0068649
740 Ga0496100_0159915
741 Ga0496104_0199848
742 Ga0496106_0103582
743 Ga0496112_0411113
744 Ga0496114_0637556
745 Ga0501298_041850
746 Ga0501031_0479754
747 Ga0501034_1045596
748 Ga0501036_0087143
749 Ga0501037_0318077
750 Ga0501038_0359946
751 Ga0501040_0013458
752 Ga0501040_0362699
753 Ga0501041_0048777
754 Ga0501042_0017386
755 Ga0501042_0884021
756 Ga0501043_0199422
757 Ga0501046_0176535
758 Ga0501048_0085150
759 Ga0501048_0135129
760 Ga0501067_0068249
761 Ga0501068_0089981
762 Ga0501069_0366678
763 Ga0501071_0365759
764 Ga0501071_0693255
765 Ga0501072_0004494
766 Ga0501074_0457603
767 Ga0501075_0131485
768 Ga0501075_0292314
769 Ga0501076_1435781
770 Ga0501230_077625
771 Ga0501249_021039
772 Ga0501253_110182
773 Ga0501079_0011258
774 Ga0501080_0803380
775 Ga0501080_1073950
776 Ga0501081_0107230
777 Ga0501272_015692
778 Ga0501044_0889570
779 Ga0501045_0866716
780 nmdc:mga05p37_110519_c1
781 nmdc:mga05p37_20793_c1
782 nmdc:mga05p37_699823_c1
783 nmdc:mga05p37_715492_c1
784 nmdc:mga05p37_740842_c1
785 nmdc:mga05p37_88358_c1
786 nmdc:mga09592_1553261_c1
787 nmdc:mga09592_187934_c1
788 nmdc:mga09592_33360_c1
789 nmdc:mga09592_6224_c1
790 nmdc:mga09592_8561_c1
791 nmdc:mga0qj67_11568_c1
792 nmdc:mga0qj67_18284_c1
793 nmdc:mga0qj67_202994_c1
794 nmdc:mga0qj67_607_c1
795 nmdc:mga06r32_30603_c1
796 nmdc:mga06r32_39649_c1
797 nmdc:mga08y16_1014_c1
798 nmdc:mga08y16_1158385_c1
799 nmdc:mga08y16_144742_c1
800 nmdc:mga08y16_349_c1
801 nmdc:mga08y16_3704_c1
802 nmdc:mga08y16_588368_c1
803 nmdc:mga08y16_983442_c1
804 nmdc:mga0n895_11477_c1
805 nmdc:mga0n895_124686_c1
806 nmdc:mga0n895_1588398_c1
807 nmdc:mga0n895_1761_c1
808 nmdc:mga0rr50_223656_c1
809 nmdc:mga0rr50_32976_c1
810 nmdc:mga0a205_117756_c1
811 nmdc:mga0a205_119_c1
812 nmdc:mga0a205_137171_c1
813 nmdc:mga0a205_563_c1
814 Ga0501084_0074188
815 Ga0590071_046534
816 Ga0590075_014918
817 Ga0590077_009079
818 Ga0530510_0028623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14464

Prok-JAB

Prokaryotic homologs of the JAB domain

15

136

0.88

PF01398

JAB

JAB1/Mov34/MPN/PAD-1 ubiquitin protease

4

117

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.8841 27 165
5cw4-assembly1.cif.gz_A structure of cfbrcc36-cfkiaa0157 complex (selenium edge) 0.8546 25 166
5ld9-assembly1.cif.gz_A structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8424 26 165
5ld9-assembly1.cif.gz_B structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8381 24 165
5ld9-assembly1.cif.gz_B structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.832 24 165
ID Description Score Start End Superfamily
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8841 27 165 3.40.140.10
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8162 27 165 3.40.140.10
af_K7UWW6_1_160_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8082 26 165 3.40.140.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8036 25 163 3.40.140.10
af_Q4CMJ7_9_214_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.7994 27 166 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A7V9CNM7-F1-model_v4 Mov34/MPN/PAD-1 family protein 0.9933 91 166 GO:0006508
GO:0008235
GO:0008270
AF-A0A7H4NKM8-F1-model_v4 deleted 0.9907 105 166
AF-A0A3D4JCX9-F1-model_v4 JAB domain-containing protein 0.985 108 165 GO:0006508
GO:0008235
GO:0008270
AF-A0A1F2RPD5-F1-model_v4 JAB domain-containing protein 0.9738 84 169 GO:0006508
GO:0008235
GO:0008270
AF-A0A7V9CNM7-F1-model_v4 Mov34/MPN/PAD-1 family protein 0.968 91 166 GO:0006508
GO:0008235
GO:0008270

Map