F437083

General Info

Members Datasets Scaffolds Average Seq Length
409 159 390 338

Family's Representative Sequence

Representative Sequence 3300048091|Ga0495626_0006690|Ga0495626_0006690_4947_6101
Length 384
Sequence MGAPTLNVSGWAHRARNAAPSNGATLSPAGNDKLPVGWAPRAHAAIRTLRTAALAIPVAITLTAGANASQVSIHDPVMAKEGNKYYLFSTGPGITFYSSADMLNWKPEGRIFPGQPTWAKQAAPTFNDHIWAPDIQYHNGKYLLYYSVSGFGKNTSGIGVTANATLDPRAPNYRWEDQGMVLQSVPGRDLWNAIDSNVAEDDKGNGWMAFGSFWTGIKLVKLDANWTRLAEPQEWHTIARRERPAFTPDESAGPAEIEGPFIFKKNGWYFLFVSFGKCCQGPNSTYNVVVGRAKAITGPYLDRQGRDMALGGGSLVIEGDKDWKALGHNSAYTLAGXXXLVLHAYETADKYKQKLKVLEMKWDKDGWPVVDPADLNRYVSKQIP

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221684 Massilia sp. Root133 Isolate Unclassified
6 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
7 2738541297 Duganella sp. GV083 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543026 Duganella sp. GV089 Isolate Unclassified
11 2738543029 Duganella sp. GV039 Isolate Unclassified
12 2842711865 Duganella sp. R-73148 Isolate Unclassified
13 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
14 2857553236 Duganella sp. R-74557 Isolate Unclassified
15 2857564685 Duganella sp. R-74599 Isolate Unclassified
16 2904424332 Duganella sp. 1411 Isolate Rhizosphere
17 2919476304 Duganella sp. 3397 Isolate Unclassified
18 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
25 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
78 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
89 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
135 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
156 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
159 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.35
Metatranscriptomes 0
Isolates 4.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.58
Nodule 0
Rhizoplane 1.71
Rhizosphere 71.64
Stem 0
Stem Tuber 0
Unclassified 8.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001403 3300002739 Bacteria 4242
2 JGI25158J39367_1001942 3300002739 Bacteria 3480
3 JGI25152J39213_1000026 3300002773 Bacteria 101759
4 JGI25150J39212_1000478 3300002774 Bacteria 16992
5 JGI25150J39212_1003471 3300002774 Bacteria 3682
6 JGI25159J45721_1002211 3300002987 Bacteria 7540
7 JGI25159J45721_1005987 3300002987 Bacteria 3720
8 rootL2_10025456 3300003322 Bacteria 2438
9 rootL2_10048043 3300003322 Bacteria 4943
10 rootL2_10098644 3300003322 Bacteria 1863
11 rootH1_10276412 3300003323 Bacteria 1166
12 JGI25161J50226_1000886 3300003374 Bacteria 10945
13 Ga0055525_1000006 3300003759 Bacteria 642912
14 Ga0055542_1010174 3300003762 Bacteria 1733
15 Ga0055529_1000032 3300003763 Bacteria 255895
16 Ga0055526_1001212 3300003771 Bacteria 18573
17 Ga0055526_1005606 3300003771 Bacteria 7149
18 Ga0055526_1007349 3300003771 Bacteria 5751
19 Ga0055537_1000191 3300003773 Bacteria 45803
20 Ga0055537_1008977 3300003773 Bacteria 2250
21 Ga0055524_1000297 3300003775 Bacteria 47728
22 Ga0055524_1002730 3300003775 Bacteria 8915
23 Ga0055524_1003872 3300003775 Bacteria 7098
24 Ga0055534_1000051 3300003784 Bacteria 92183
25 Ga0055534_1000588 3300003784 Bacteria 18995
26 Ga0055528_1000731 3300003790 Bacteria 23155
27 Ga0055530_10001347 3300003791 Bacteria 18338
28 Ga0055530_10011975 3300003791 Bacteria 3061
29 Ga0055531_10010616 3300003794 Bacteria 4552
30 Ga0055531_10026481 3300003794 Bacteria 2066
31 Ga0055543_1000103 3300004625 Bacteria 73828
32 Ga0055543_1002182 3300004625 Bacteria 6727
33 Ga0065165_1001082 3300005262 Bacteria 32470
34 Ga0065165_1001148 3300005262 Bacteria 30990
35 Ga0070661_100086119 3300005344 Bacteria 2323
36 Ga0068857_100345719 3300005577 Bacteria 1377
37 Ga0105244_10001201 3300009036 Bacteria 21301
38 Ga0105242_10110682 3300009176 Bacteria 2340
39 Ga0105238_10226208 3300009551 Bacteria 1847
40 Ga0157371_10000014 3300013102 Bacteria 347490
41 Ga0157372_10138912 3300013307 Bacteria 2798
42 Ga0157372_10303287 3300013307 Bacteria 1858
43 Ga0182005_1000051 3300015265 Bacteria 114808
44 Ga0163161_10024251 3300017792 Bacteria 4284
45 Ga0209436_100723 3300025208 Bacteria 13795
46 Ga0209436_109881 3300025208 Bacteria 1782
47 Ga0209436_115510 3300025208 Bacteria 1174
48 Ga0209563_100022 3300025230 Bacteria 643318
49 Ga0207425_1000017 3300025245 Bacteria 423851
50 Ga0207425_1000085 3300025245 Bacteria 95577
51 Ga0207425_1000326 3300025245 Bacteria 33697
52 Ga0207425_1000347 3300025245 Bacteria 32216
53 Ga0209148_1000678 3300025254 Bacteria 28482
54 Ga0209129_1000162 3300025258 Bacteria 101248
55 Ga0209129_1001298 3300025258 Bacteria 14248
56 Ga0209565_1000017 3300025263 Bacteria 462438
57 Ga0209565_1001634 3300025263 Bacteria 9444
58 Ga0209565_1001892 3300025263 Bacteria 8299
59 Ga0209565_1005735 3300025263 Bacteria 3576
60 Ga0209455_1000043 3300025272 Bacteria 413928
61 Ga0209673_1000007 3300025273 Bacteria 634477
62 Ga0209673_1036968 3300025273 Bacteria 1440
63 Ga0209130_1000078 3300025284 Bacteria 169374
64 Ga0209130_1000188 3300025284 Bacteria 86963
65 Ga0209130_1007631 3300025284 Bacteria 3311
66 Ga0209675_1000009 3300025291 Bacteria 562872
67 Ga0209675_1010902 3300025291 Bacteria 3062
68 Ga0209025_1001273 3300025294 Bacteria 34682
69 Ga0209564_1000036 3300025295 Bacteria 423455
70 Ga0209564_1000055 3300025295 Bacteria 343782
71 Ga0209564_1000343 3300025295 Bacteria 89036
72 Ga0209564_1004142 3300025295 Bacteria 9092
73 Ga0209564_1022150 3300025295 Bacteria 2255
74 Ga0209758_1000250 3300025297 Bacteria 109992
75 Ga0209758_1007417 3300025297 Bacteria 7474
76 Ga0209050_1000316 3300025298 Bacteria 98257
77 Ga0209050_1000612 3300025298 Bacteria 56207
78 Ga0209050_1003682 3300025298 Bacteria 11054
79 Ga0209256_1000167 3300025299 Bacteria 133419
80 Ga0209256_1000184 3300025299 Bacteria 121336
81 Ga0209256_1000841 3300025299 Bacteria 38507
82 Ga0209256_1001411 3300025299 Bacteria 24981
83 Ga0207426_1005222 3300025302 Bacteria 6018
84 Ga0207426_1013576 3300025302 Bacteria 3013
85 Ga0207426_1044299 3300025302 Bacteria 1360
86 Ga0209051_1011360 3300025303 Bacteria 4402
87 Ga0209257_1000123 3300025304 Bacteria 219092
88 Ga0209257_1007114 3300025304 Bacteria 6897
89 Ga0207657_10107071 3300025919 Bacteria 2313
90 Ga0207678_10036505 3300026067 Bacteria 4278
91 Ga0207674_10446939 3300026116 Bacteria 1249
92 Ga0265334_10006335 3300028573 Bacteria 5105
93 Ga0265338_10022376 3300028800 Bacteria 6545
94 Ga0316182_1157731 3300030745 Bacteria 4308
95 Ga0307408_100000092 3300031548 Bacteria 98953
96 Ga0307408_100006382 3300031548 Bacteria 7823
97 Ga0307408_100020827 3300031548 Bacteria 4430
98 Ga0395899_0000293 3300037312 Bacteria 64438
99 Ga0395899_0017471 3300037312 Bacteria 5465
100 Ga0395899_0022029 3300037312 Bacteria 4832
101 Ga0395899_0028389 3300037312 Bacteria 4214
102 Ga0395899_0060585 3300037312 Bacteria 2788
103 Ga0395899_0073288 3300037312 Bacteria 2504
104 Ga0395899_0219744 3300037312 Bacteria 1316
105 Ga0395900_0117935 3300037418 Bacteria 2723
106 Ga0395900_0119754 3300037418 Bacteria 2701
107 Ga0395900_0252041 3300037418 Bacteria 1766
108 Ga0395900_0434574 3300037418 Bacteria 1271
109 Ga0395898_0050686 3300037466 Bacteria 4062
110 Ga0395898_0117876 3300037466 Bacteria 2543
111 Ga0395905_0027441 3300037471 Bacteria 5369
112 Ga0395905_0099144 3300037471 Bacteria 2736
113 Ga0395905_0119449 3300037471 Bacteria 2477
114 Ga0395905_0263010 3300037471 Bacteria 1610
115 Ga0395901_0000019 3300038443 Bacteria 317063
116 Ga0395901_0034364 3300038443 Bacteria 5235
117 Ga0395901_0077275 3300038443 Bacteria 3474
118 Ga0395901_0130795 3300038443 Bacteria 2637
119 Ga0395901_0172446 3300038443 Bacteria 2269
120 Ga0436361_0441859 3300039447 Bacteria 17533
121 Ga0439448_0027704 3300042005 Bacteria 1787
122 Ga0439450_017647 3300042008 Bacteria 1491
123 Ga0466965_0019824 3300044683 Bacteria 3229
124 Ga0466966_0021462 3300044684 Bacteria 4240
125 Ga0466966_0029151 3300044684 Bacteria 3593
126 Ga0466966_0029206 3300044684 Bacteria 3589
127 Ga0466966_0052911 3300044684 Bacteria 2577
128 Ga0466966_0101277 3300044684 Bacteria 1781
129 Ga0466966_0139566 3300044684 Bacteria 1481
130 Ga0466971_0032954 3300044719 Bacteria 2321
131 Ga0466971_0144065 3300044719 Bacteria 1110
132 Ga0466968_0000207 3300044735 Bacteria 18092
133 Ga0466957_0001886 3300044842 Bacteria 11096
134 Ga0466959_0006411 3300045049 Bacteria 8144
135 Ga0466959_0086968 3300045049 Bacteria 2248
136 Ga0466958_0020436 3300045836 Bacteria 3860
137 Ga0495617_000208 3300046452 Bacteria 36937
138 Ga0495627_000008 3300046453 Bacteria 572150
139 Ga0495590_0000001 3300046457 Bacteria 762984
140 Ga0495590_0000512 3300046457 Bacteria 18985
141 Ga0495591_017432 3300046458 Bacteria 2466
142 Ga0495638_0000017 3300046460 Bacteria 391117
143 Ga0495638_0030190 3300046460 Bacteria 3491
144 Ga0495650_0000001 3300046471 Bacteria 1085492
145 Ga0495650_0000019 3300046471 Bacteria 533849
146 Ga0495650_0000072 3300046471 Bacteria 257886
147 Ga0495650_0000427 3300046471 Bacteria 68283
148 Ga0495650_0000434 3300046471 Bacteria 67282
149 Ga0495650_0001400 3300046471 Bacteria 23592
150 Ga0495650_0013930 3300046471 Bacteria 4221
151 Ga0495650_0016876 3300046471 Bacteria 3677
152 Ga0495605_0000065 3300046474 Bacteria 139441
153 Ga0495605_0000103 3300046474 Bacteria 105879
154 Ga0495605_0006006 3300046474 Bacteria 7019
155 Ga0495605_0023242 3300046474 Bacteria 3263
156 Ga0495639_0104061 3300046475 Bacteria 1342
157 Ga0495584_0000009 3300046491 Bacteria 236318
158 Ga0495584_0001765 3300046491 Bacteria 12597
159 Ga0495584_0002700 3300046491 Bacteria 9971
160 Ga0495584_0004981 3300046491 Bacteria 7074
161 Ga0495584_0010538 3300046491 Bacteria 4749
162 Ga0495584_0034316 3300046491 Bacteria 2567
163 Ga0495585_0000077 3300046492 Bacteria 100338
164 Ga0495585_0000094 3300046492 Bacteria 94735
165 Ga0495585_0000154 3300046492 Bacteria 73681
166 Ga0495585_0001952 3300046492 Bacteria 15409
167 Ga0495585_0004193 3300046492 Bacteria 9412
168 Ga0495585_0004285 3300046492 Bacteria 9285
169 Ga0495585_0004564 3300046492 Bacteria 8957
170 Ga0495585_0006546 3300046492 Bacteria 7209
171 Ga0495585_0020890 3300046492 Bacteria 3761
172 Ga0495585_0046294 3300046492 Bacteria 2426
173 Ga0495596_0002214 3300046500 Bacteria 10597
174 Ga0495596_0002311 3300046500 Bacteria 10349
175 Ga0495596_0029421 3300046500 Bacteria 2202
176 Ga0495607_0002416 3300046501 Bacteria 15240
177 Ga0495607_0002798 3300046501 Bacteria 13876
178 Ga0495607_0004384 3300046501 Bacteria 10404
179 Ga0495607_0005983 3300046501 Bacteria 8624
180 Ga0495607_0006334 3300046501 Bacteria 8339
181 Ga0495607_0008222 3300046501 Bacteria 7140
182 Ga0495607_0017148 3300046501 Bacteria 4659
183 Ga0495583_0000008 3300046506 Bacteria 411092
184 Ga0495583_0000050 3300046506 Bacteria 213627
185 Ga0495583_0000064 3300046506 Bacteria 192380
186 Ga0495583_0000485 3300046506 Bacteria 58196
187 Ga0495583_0002249 3300046506 Bacteria 16985
188 Ga0495583_0029807 3300046506 Bacteria 2665
189 Ga0495583_0036288 3300046506 Bacteria 2347
190 Ga0495583_0038233 3300046506 Bacteria 2268
191 Ga0495583_0060025 3300046506 Bacteria 1702
192 Ga0495606_0000001 3300046507 Bacteria 592123
193 Ga0495606_0000282 3300046507 Bacteria 88450
194 Ga0495606_0012104 3300046507 Bacteria 6958
195 Ga0495606_0017261 3300046507 Bacteria 5466
196 Ga0495606_0083449 3300046507 Bacteria 1981
197 Ga0495610_0000003 3300046512 Bacteria 1203910
198 Ga0495610_0026927 3300046512 Bacteria 3063
199 Ga0495610_0050927 3300046512 Bacteria 2019
200 Ga0495616_0000952 3300046513 Bacteria 20798
201 Ga0495616_0002444 3300046513 Bacteria 12326
202 Ga0495616_0005936 3300046513 Bacteria 7447
203 Ga0495616_0006825 3300046513 Bacteria 6877
204 Ga0495616_0008348 3300046513 Bacteria 6142
205 Ga0495616_0048037 3300046513 Bacteria 2146
206 Ga0495616_0061061 3300046513 Bacteria 1849
207 Ga0495620_0001344 3300046515 Bacteria 14927
208 Ga0495631_0000214 3300046518 Bacteria 39867
209 Ga0495631_0002741 3300046518 Bacteria 9762
210 Ga0495631_0010999 3300046518 Bacteria 4467
211 Ga0495631_0011387 3300046518 Bacteria 4374
212 Ga0495632_0000117 3300046519 Bacteria 81479
213 Ga0495632_0000151 3300046519 Bacteria 71855
214 Ga0495632_0000367 3300046519 Bacteria 42974
215 Ga0495632_0009928 3300046519 Bacteria 5687
216 Ga0495632_0024734 3300046519 Bacteria 3185
217 Ga0495632_0050221 3300046519 Bacteria 2058
218 Ga0495643_0000028 3300046522 Bacteria 262886
219 Ga0495643_0000285 3300046522 Bacteria 72233
220 Ga0495643_0002751 3300046522 Bacteria 13492
221 Ga0495643_0003603 3300046522 Bacteria 11255
222 Ga0495643_0053880 3300046522 Bacteria 2155
223 Ga0495643_0062379 3300046522 Bacteria 1973
224 Ga0495644_0021092 3300046523 Bacteria 2485
225 Ga0495648_0000001 3300046524 Bacteria 696872
226 Ga0495648_0000079 3300046524 Bacteria 126099
227 Ga0495648_0001299 3300046524 Bacteria 24837
228 Ga0495648_0002750 3300046524 Bacteria 15879
229 Ga0495648_0004722 3300046524 Bacteria 11543
230 Ga0495648_0005039 3300046524 Bacteria 11090
231 Ga0495648_0010212 3300046524 Bacteria 7172
232 Ga0495648_0023730 3300046524 Bacteria 4192
233 Ga0495648_0099337 3300046524 Bacteria 1610
234 Ga0495642_0000846 3300046528 Bacteria 14565
235 Ga0495642_0001666 3300046528 Bacteria 9627
236 Ga0495642_0004824 3300046528 Bacteria 5212
237 Ga0495642_0013192 3300046528 Bacteria 3192
238 Ga0495642_0051885 3300046528 Bacteria 1688
239 Ga0495654_0012862 3300046530 Bacteria 4487
240 Ga0495654_0039904 3300046530 Bacteria 2341
241 Ga0495587_0045810 3300046536 Bacteria 2598
242 Ga0495609_0000026 3300046538 Bacteria 251973
243 Ga0495609_0000110 3300046538 Bacteria 96998
244 Ga0495609_0001294 3300046538 Bacteria 17071
245 Ga0495609_0012571 3300046538 Bacteria 4014
246 Ga0495609_0030944 3300046538 Bacteria 2435
247 Ga0495609_0056605 3300046538 Bacteria 1737
248 Ga0495597_0000705 3300046542 Bacteria 26750
249 Ga0495597_0000785 3300046542 Bacteria 25063
250 Ga0495597_0001532 3300046542 Bacteria 16422
251 Ga0495597_0008085 3300046542 Bacteria 5292
252 Ga0495645_0092229 3300046543 Bacteria 2163
253 Ga0495622_0000131 3300046557 Bacteria 64280
254 Ga0495633_0000106 3300046558 Bacteria 113381
255 Ga0495633_0001613 3300046558 Bacteria 17048
256 Ga0495633_0002681 3300046558 Bacteria 12370
257 Ga0495633_0070056 3300046558 Bacteria 1637
258 Ga0495633_0080719 3300046558 Bacteria 1513
259 Ga0495656_0006043 3300046615 Bacteria 4218
260 Ga0495668_0000190 3300046616 Bacteria 91473
261 Ga0495668_0000666 3300046616 Bacteria 41285
262 Ga0495668_0000686 3300046616 Bacteria 40735
263 Ga0495668_0001065 3300046616 Bacteria 29015
264 Ga0495668_0001873 3300046616 Bacteria 18839
265 Ga0495668_0001982 3300046616 Bacteria 17930
266 Ga0495668_0002041 3300046616 Bacteria 17578
267 Ga0495668_0009824 3300046616 Bacteria 5840
268 Ga0495668_0038986 3300046616 Bacteria 2653
269 Ga0495668_0040232 3300046616 Bacteria 2607
270 Ga0495611_0000151 3300046648 Bacteria 49625
271 Ga0495611_0001337 3300046648 Bacteria 12510
272 Ga0495625_0000035 3300046660 Bacteria 224323
273 Ga0495625_0000391 3300046660 Bacteria 66888
274 Ga0495625_0005766 3300046660 Bacteria 11198
275 Ga0495625_0007938 3300046660 Bacteria 9122
276 Ga0495625_0040179 3300046660 Bacteria 3414
277 Ga0495625_0114509 3300046660 Bacteria 1841
278 Ga0495625_0127453 3300046660 Bacteria 1726
279 Ga0495625_0137897 3300046660 Bacteria 1647
280 Ga0495659_0002208 3300046664 Bacteria 6341
281 Ga0495661_0003064 3300046665 Bacteria 12568
282 Ga0495661_0004266 3300046665 Bacteria 10393
283 Ga0495661_0017888 3300046665 Bacteria 4672
284 Ga0495661_0019155 3300046665 Bacteria 4490
285 Ga0495661_0033843 3300046665 Bacteria 3220
286 Ga0495661_0038869 3300046665 Bacteria 2961
287 Ga0495661_0072287 3300046665 Bacteria 2012
288 Ga0495661_0148195 3300046665 Bacteria 1269
289 Ga0495588_0000139 3300046674 Bacteria 109955
290 Ga0495588_0021466 3300046674 Bacteria 3181
291 Ga0495646_0086797 3300046680 Bacteria 1814
292 Ga0495669_0004413 3300046684 Bacteria 5809
293 Ga0495669_0014777 3300046684 Bacteria 3339
294 Ga0495670_0003991 3300046691 Bacteria 7239
295 Ga0495670_0068333 3300046691 Bacteria 1795
296 Ga0495671_0000010 3300046692 Bacteria 368641
297 Ga0495671_0014788 3300046692 Bacteria 4193
298 Ga0495671_0016122 3300046692 Bacteria 3996
299 Ga0495671_0058894 3300046692 Bacteria 1899
300 Ga0495649_0005212 3300046694 Bacteria 8320
301 Ga0495649_0037107 3300046694 Bacteria 2675
302 Ga0495589_0000073 3300046794 Bacteria 94125
303 Ga0495589_0000100 3300046794 Bacteria 83307
304 Ga0495589_0007312 3300046794 Bacteria 5786
305 Ga0495589_0044221 3300046794 Bacteria 2215
306 Ga0495660_0000027 3300046810 Bacteria 254331
307 Ga0495660_0000335 3300046810 Bacteria 41632
308 Ga0495660_0000555 3300046810 Bacteria 30632
309 Ga0495660_0012559 3300046810 Bacteria 4918
310 Ga0495660_0015764 3300046810 Bacteria 4363
311 Ga0495660_0029246 3300046810 Bacteria 3110
312 Ga0495660_0053090 3300046810 Bacteria 2201
313 Ga0495660_0099014 3300046810 Bacteria 1503
314 Ga0495672_0000165 3300047320 Bacteria 96215
315 Ga0495672_0002015 3300047320 Bacteria 19155
316 Ga0495672_0002622 3300047320 Bacteria 16258
317 Ga0495672_0020441 3300047320 Bacteria 4340
318 Ga0495683_0000064 3300047323 Bacteria 112558
319 Ga0495683_0006529 3300047323 Bacteria 6369
320 Ga0495683_0022784 3300047323 Bacteria 3220
321 Ga0495683_0031744 3300047323 Bacteria 2691
322 Ga0495683_0064610 3300047323 Bacteria 1807
323 Ga0495687_000012 3300047443 Bacteria 391586
324 Ga0495687_000037 3300047443 Bacteria 252363
325 Ga0495687_000122 3300047443 Bacteria 119372
326 Ga0495687_001859 3300047443 Bacteria 18393
327 Ga0495687_002318 3300047443 Bacteria 15517
328 Ga0495687_002590 3300047443 Bacteria 14240
329 Ga0495687_017344 3300047443 Bacteria 3595
330 Ga0495687_020589 3300047443 Bacteria 3211
331 Ga0495677_0000014 3300047445 Bacteria 136236
332 Ga0495677_0000880 3300047445 Bacteria 12142
333 Ga0495677_0020392 3300047445 Bacteria 2403
334 Ga0495677_0032411 3300047445 Bacteria 1903
335 Ga0495679_000603 3300047446 Bacteria 24373
336 Ga0495679_005303 3300047446 Bacteria 5737
337 Ga0495673_0000016 3300047469 Bacteria 580643
338 Ga0495673_0000035 3300047469 Bacteria 316861
339 Ga0495681_0000412 3300047470 Bacteria 33092
340 Ga0495681_0003306 3300047470 Bacteria 11231
341 Ga0495681_0015762 3300047470 Bacteria 4267
342 Ga0495681_0016596 3300047470 Bacteria 4118
343 Ga0495681_0076115 3300047470 Bacteria 1509
344 Ga0495686_0000047 3300047472 Bacteria 280086
345 Ga0495626_0000222 3300048091 Bacteria 67304
346 Ga0495626_0004015 3300048091 Bacteria 9180
347 Ga0495626_0004268 3300048091 Bacteria 8824
348 Ga0495626_0006302 3300048091 Bacteria 6767
349 Ga0495626_0006690 3300048091 Bacteria 6532
350 Ga0495626_0007695 3300048091 Bacteria 5970
351 Ga0495626_0008927 3300048091 Bacteria 5442
352 Ga0495626_0009889 3300048091 Bacteria 5126
353 Ga0495626_0032550 3300048091 Bacteria 2503
354 Ga0495626_0050971 3300048091 Bacteria 1910
355 Ga0495626_0068431 3300048091 Bacteria 1601
356 Ga0495626_0088994 3300048091 Bacteria 1360
357 Ga0496102_0044838 3300048905 Bacteria 4013
358 Ga0496106_0024736 3300048909 Bacteria 4465
359 Ga0496107_0048122 3300048910 Bacteria 3071
360 Ga0496110_0000026 3300048913 Bacteria 71385
361 Ga0496112_0445245 3300048915 Bacteria 1233
362 Ga0496113_0016368 3300048916 Bacteria 5121
363 Ga0496120_0026089 3300048923 Bacteria 3615
364 Ga0496121_0335119 3300048924 Bacteria 1013
365 Ga0496122_0016187 3300048925 Bacteria 7082
366 Ga0496122_0042899 3300048925 Bacteria 3552
367 Ga0496122_0054457 3300048925 Bacteria 3004
368 Ga0496122_0097972 3300048925 Bacteria 1971
369 Ga0496123_0003516 3300048926 Bacteria 17450
370 Ga0496123_0016636 3300048926 Bacteria 5957
371 Ga0496123_0027615 3300048926 Bacteria 4223
372 Ga0496124_0021381 3300048927 Bacteria 5963
373 Ga0496124_0024036 3300048927 Bacteria 5548
374 Ga0496124_0036499 3300048927 Bacteria 4286
375 Ga0496124_0317899 3300048927 Bacteria 1116
376 Ga0496125_0082716 3300048928 Bacteria 2446
377 Ga0495678_000002 3300049459 Bacteria 999613
378 Ga0495678_000029 3300049459 Bacteria 219803
379 Ga0495678_000045 3300049459 Bacteria 171880
380 Ga0495678_001464 3300049459 Bacteria 18513
381 Ga0495678_005823 3300049459 Bacteria 6683
382 Ga0495678_010132 3300049459 Bacteria 4597
383 Ga0495678_047451 3300049459 Bacteria 1681
384 Ga0495682_0000082 3300049460 Bacteria 83453
385 Ga0495682_0012721 3300049460 Bacteria 3219
386 Ga0501035_0003225 3300049822 Bacteria 15630
387 Ga0501044_0191840 3300049823 Bacteria 2006
388 Ga0500618_000068 3300053125 Bacteria 88668
389 Ga0500586_000133 3300053145 Bacteria 13666
390 Ga0466962_0068182 3300061719 Bacteria 1698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0000001 Ga0495606_0000001_303793_304806 304
2 3300046512 Ga0495610_0026927 Ga0495610_0026927_1997_3010 304
3 3300046558 Ga0495633_0070056 Ga0495633_0070056_89_1102 304
4 3300046616 Ga0495668_0000190 Ga0495668_0000190_65222_66235 304
5 3300003323 rootH1_10276412 rootH1_102764121 305
6 3300046471 Ga0495650_0013930 Ga0495650_0013930_588_1601 309
7 3300046512 Ga0495610_0000003 Ga0495610_0000003_965233_966246 309
8 3300046524 Ga0495648_0001299 Ga0495648_0001299_17867_18880 309
9 3300046530 Ga0495654_0012862 Ga0495654_0012862_2601_3614 309
10 3300046616 Ga0495668_0001065 Ga0495668_0001065_3178_4191 309
11 3300046692 Ga0495671_0000010 Ga0495671_0000010_219457_220470 309
12 3300046692 Ga0495671_0058894 Ga0495671_0058894_116_1129 309
13 3300048925 Ga0496122_0097972 Ga0496122_0097972_778_1791 309
14 3300046471 Ga0495650_0000434 Ga0495650_0000434_2301_3320 311
15 3300046513 Ga0495616_0048037 Ga0495616_0048037_280_1239 314
16 3300046694 Ga0495649_0037107 Ga0495649_0037107_1579_2538 314
17 iso_pu_bacteria 2643221556 2643801492 314
18 iso_pu_bacteria 2643221684 2644471446 314
19 3300037418 Ga0395900_0252041 Ga0395900_0252041_583_1560 316
20 3300046512 Ga0495610_0050927 Ga0495610_0050927_580_1602 316
21 3300046536 Ga0495587_0045810 Ga0495587_0045810_468_1472 316
22 3300046543 Ga0495645_0092229 Ga0495645_0092229_846_1850 316
23 3300046665 Ga0495661_0148195 Ga0495661_0148195_180_1157 316
24 3300048091 Ga0495626_0068431 Ga0495626_0068431_605_1576 316
25 3300048924 Ga0496121_0335119 Ga0496121_0335119_26_1003 316
26 3300048925 Ga0496122_0054457 Ga0496122_0054457_853_1830 316
27 3300048926 Ga0496123_0003516 Ga0496123_0003516_13926_14903 316
28 3300013307 Ga0157372_10138912 Ga0157372_101389122 317
29 3300042005 Ga0439448_0027704 Ga0439448_0027704_603_1577 317
30 3300046519 Ga0495632_0000117 Ga0495632_0000117_28375_29349 317
31 3300046665 Ga0495661_0019155 Ga0495661_0019155_2471_3445 317
32 3300046492 Ga0495585_0004285 Ga0495585_0004285_3125_4132 318
33 3300046528 Ga0495642_0051885 Ga0495642_0051885_298_1275 318
34 3300046524 Ga0495648_0023730 Ga0495648_0023730_1360_2346 320
35 3300046810 Ga0495660_0053090 Ga0495660_0053090_738_1724 320
36 iso_pu_bacteria 8047673197 8047677204 320
37 3300046457 Ga0495590_0000512 Ga0495590_0000512_1742_2728 321
38 3300046491 Ga0495584_0000009 Ga0495584_0000009_208691_209713 321
39 3300046506 Ga0495583_0002249 Ga0495583_0002249_9957_10943 321
40 3300046507 Ga0495606_0012104 Ga0495606_0012104_4018_5040 321
41 3300046513 Ga0495616_0005936 Ga0495616_0005936_4348_5334 321
42 3300046518 Ga0495631_0000214 Ga0495631_0000214_25896_26882 321
43 3300046522 Ga0495643_0002751 Ga0495643_0002751_4078_5112 321
44 3300046524 Ga0495648_0099337 Ga0495648_0099337_402_1388 321
45 3300046616 Ga0495668_0009824 Ga0495668_0009824_13_999 321
46 3300046660 Ga0495625_0007938 Ga0495625_0007938_5488_6474 321
47 3300046692 Ga0495671_0014788 Ga0495671_0014788_2514_3500 321
48 3300048091 Ga0495626_0032550 Ga0495626_0032550_1085_2107 321
49 3300048091 Ga0495626_0050971 Ga0495626_0050971_182_1216 321
50 3300045836 Ga0466958_0020436 Ga0466958_0020436_1371_2399 322
51 3300013102 Ga0157371_10000014 Ga0157371_10000014255 323
52 3300044684 Ga0466966_0021462 Ga0466966_0021462_315_1319 323
53 3300044684 Ga0466966_0052911 Ga0466966_0052911_500_1504 323
54 3300044719 Ga0466971_0032954 Ga0466971_0032954_211_1236 323
55 3300045049 Ga0466959_0006411 Ga0466959_0006411_6146_7150 323
56 3300046500 Ga0495596_0002311 Ga0495596_0002311_5877_6869 323
57 3300046538 Ga0495609_0056605 Ga0495609_0056605_272_1300 323
58 3300046660 Ga0495625_0114509 Ga0495625_0114509_577_1605 323
59 3300046680 Ga0495646_0086797 Ga0495646_0086797_114_1172 323
60 3300048927 Ga0496124_0021381 Ga0496124_0021381_1220_2284 323
61 3300061719 Ga0466962_0068182 Ga0466962_0068182_522_1547 323
62 iso_pu_bacteria 8054357960 8054358012 323
63 3300002987 JGI25159J45721_1002211 JGI25159J45721_10022115 324
64 3300004625 Ga0055543_1002182 Ga0055543_10021825 324
65 3300005262 Ga0065165_1001148 Ga0065165_100114817 324
66 3300025208 Ga0209436_109881 Ga0209436_1098812 324
67 3300025284 Ga0209130_1000078 Ga0209130_1000078147 324
68 3300025302 Ga0207426_1013576 Ga0207426_10135762 324
69 3300037312 Ga0395899_0017471 Ga0395899_0017471_970_1998 324
70 3300037418 Ga0395900_0117935 Ga0395900_0117935_937_1965 324
71 3300037466 Ga0395898_0050686 Ga0395898_0050686_1066_2094 324
72 3300037471 Ga0395905_0119449 Ga0395905_0119449_87_1115 324
73 3300038443 Ga0395901_0172446 Ga0395901_0172446_937_1965 324
74 3300044684 Ga0466966_0101277 Ga0466966_0101277_418_1419 324
75 3300046522 Ga0495643_0053880 Ga0495643_0053880_786_1781 324
76 3300046542 Ga0495597_0001532 Ga0495597_0001532_7240_8235 324
77 3300046616 Ga0495668_0000666 Ga0495668_0000666_8001_8999 324
78 3300046660 Ga0495625_0127453 Ga0495625_0127453_430_1443 324
79 3300046665 Ga0495661_0033843 Ga0495661_0033843_2071_3099 324
80 3300047443 Ga0495687_020589 Ga0495687_020589_1175_2203 324
81 3300048927 Ga0496124_0024036 Ga0496124_0024036_1346_2347 324
82 3300037312 Ga0395899_0028389 Ga0395899_0028389_93_1121 325
83 3300037312 Ga0395899_0219744 Ga0395899_0219744_196_1224 325
84 3300037418 Ga0395900_0119754 Ga0395900_0119754_288_1316 325
85 3300046471 Ga0495650_0016876 Ga0495650_0016876_812_1810 325
86 3300046500 Ga0495596_0029421 Ga0495596_0029421_93_1127 325
87 3300046506 Ga0495583_0060025 Ga0495583_0060025_98_1096 325
88 3300046523 Ga0495644_0021092 Ga0495644_0021092_627_1661 325
89 3300047323 Ga0495683_0006529 Ga0495683_0006529_161_1195 325
90 3300047323 Ga0495683_0022784 Ga0495683_0022784_871_1869 325
91 3300047443 Ga0495687_001859 Ga0495687_001859_8400_9398 325
92 3300047470 Ga0495681_0003306 Ga0495681_0003306_4966_6045 325
93 3300049459 Ga0495678_005823 Ga0495678_005823_366_1445 325
94 3300049460 Ga0495682_0000082 Ga0495682_0000082_8375_9454 325
95 iso_pu_bacteria 2738541297 2738829893 325
96 iso_pu_bacteria 2738541357 2739153689 325
97 iso_pu_bacteria 2738543003 2739195609 325
98 iso_pu_bacteria 2738543026 2739322085 325
99 iso_pu_bacteria 2738543029 2739340326 325
100 iso_pu_bacteria 2842711865 2842715527 325
101 iso_pu_bacteria 2857553236 2857555912 325
102 iso_pu_bacteria 2857564685 2857566928 325
103 iso_pu_bacteria 2904424332 2904425711 325
104 iso_pu_bacteria 2919476304 2919478246 325
105 3300013307 Ga0157372_10303287 Ga0157372_103032872 326
106 3300003322 rootL2_10025456 rootL2_100254562 327
107 3300003759 Ga0055525_1000006 Ga0055525_1000006542 327
108 3300005344 Ga0070661_100086119 Ga0070661_1000861192 327
109 3300005577 Ga0068857_100345719 Ga0068857_1003457192 327
110 3300009176 Ga0105242_10110682 Ga0105242_101106822 327
111 3300009551 Ga0105238_10226208 Ga0105238_102262082 327
112 3300025230 Ga0209563_100022 Ga0209563_100022540 327
113 3300025919 Ga0207657_10107071 Ga0207657_101070711 327
114 3300026067 Ga0207678_10036505 Ga0207678_100365052 327
115 3300026116 Ga0207674_10446939 Ga0207674_104469392 327
116 3300037312 Ga0395899_0060585 Ga0395899_0060585_778_1803 327
117 3300037312 Ga0395899_0073288 Ga0395899_0073288_933_1961 327
118 3300037418 Ga0395900_0434574 Ga0395900_0434574_161_1174 327
119 3300037466 Ga0395898_0117876 Ga0395898_0117876_104_1108 327
120 3300037471 Ga0395905_0027441 Ga0395905_0027441_1721_2749 327
121 3300038443 Ga0395901_0034364 Ga0395901_0034364_1336_2364 327
122 3300038443 Ga0395901_0077275 Ga0395901_0077275_1473_2477 327
123 3300038443 Ga0395901_0130795 Ga0395901_0130795_410_1423 327
124 3300042008 Ga0439450_017647 Ga0439450_017647_203_1216 327
125 3300044684 Ga0466966_0029206 Ga0466966_0029206_901_1905 327
126 3300044684 Ga0466966_0139566 Ga0466966_0139566_172_1182 327
127 3300044719 Ga0466971_0144065 Ga0466971_0144065_37_1041 327
128 3300044842 Ga0466957_0001886 Ga0466957_0001886_3986_4996 327
129 3300045049 Ga0466959_0086968 Ga0466959_0086968_321_1331 327
130 3300046474 Ga0495605_0006006 Ga0495605_0006006_2798_3802 327
131 3300046491 Ga0495584_0001765 Ga0495584_0001765_8006_9010 327
132 3300046492 Ga0495585_0001952 Ga0495585_0001952_8148_9227 327
133 3300046501 Ga0495607_0005983 Ga0495607_0005983_3220_4224 327
134 3300046501 Ga0495607_0017148 Ga0495607_0017148_1995_3074 327
135 3300046506 Ga0495583_0029807 Ga0495583_0029807_575_1579 327
136 3300046513 Ga0495616_0006825 Ga0495616_0006825_4282_5286 327
137 3300046518 Ga0495631_0002741 Ga0495631_0002741_168_1247 327
138 3300046519 Ga0495632_0000151 Ga0495632_0000151_49208_50212 327
139 3300046519 Ga0495632_0050221 Ga0495632_0050221_564_1643 327
140 3300046524 Ga0495648_0002750 Ga0495648_0002750_8338_9378 327
141 3300046528 Ga0495642_0004824 Ga0495642_0004824_2088_3092 327
142 3300046528 Ga0495642_0013192 Ga0495642_0013192_964_1968 327
143 3300046538 Ga0495609_0000026 Ga0495609_0000026_85399_86403 327
144 3300046615 Ga0495656_0006043 Ga0495656_0006043_3054_4058 327
145 3300046648 Ga0495611_0000151 Ga0495611_0000151_26429_27508 327
146 3300046665 Ga0495661_0003064 Ga0495661_0003064_7336_8340 327
147 3300046674 Ga0495588_0000139 Ga0495588_0000139_30589_31617 327
148 3300046794 Ga0495589_0000073 Ga0495589_0000073_89903_90907 327
149 3300046810 Ga0495660_0012559 Ga0495660_0012559_1012_2016 327
150 3300047443 Ga0495687_000037 Ga0495687_000037_85399_86403 327
151 3300047445 Ga0495677_0000014 Ga0495677_0000014_49834_50838 327
152 3300047446 Ga0495679_000603 Ga0495679_000603_12309_13388 327
153 3300047446 Ga0495679_005303 Ga0495679_005303_4204_5244 327
154 3300047470 Ga0495681_0015762 Ga0495681_0015762_1043_2122 327
155 3300048091 Ga0495626_0004015 Ga0495626_0004015_152_1156 327
156 3300048905 Ga0496102_0044838 Ga0496102_0044838_2484_3509 327
157 3300048913 Ga0496110_0000026 Ga0496110_0000026_46589_47596 327
158 3300049459 Ga0495678_000045 Ga0495678_000045_89018_90058 327
159 3300049459 Ga0495678_010132 Ga0495678_010132_3153_4157 327
160 iso_pu_bacteria 2738541276 2738713378 327
161 3300046471 Ga0495650_0000001 Ga0495650_0000001_483680_484687 328
162 3300003322 rootL2_10048043 rootL2_100480433 329
163 3300003322 rootL2_10098644 rootL2_100986442 329
164 3300003763 Ga0055529_1000032 Ga0055529_1000032222 329
165 3300009036 Ga0105244_10001201 Ga0105244_100012014 329
166 3300015265 Ga0182005_1000051 Ga0182005_100005125 329
167 3300025245 Ga0207425_1000326 Ga0207425_100032613 329
168 3300025272 Ga0209455_1000043 Ga0209455_1000043314 329
169 3300025294 Ga0209025_1001273 Ga0209025_100127324 329
170 3300025297 Ga0209758_1007417 Ga0209758_10074172 329
171 3300031548 Ga0307408_100006382 Ga0307408_1000063822 329
172 3300039447 Ga0436361_0441859 Ga0436361_0441859_5453_6463 329
173 3300044683 Ga0466965_0019824 Ga0466965_0019824_1842_2858 329
174 3300044684 Ga0466966_0029151 Ga0466966_0029151_426_1442 329
175 3300046453 Ga0495627_000008 Ga0495627_000008_24484_25515 329
176 3300046457 Ga0495590_0000001 Ga0495590_0000001_189238_190257 329
177 3300046458 Ga0495591_017432 Ga0495591_017432_702_1712 329
178 3300046460 Ga0495638_0000017 Ga0495638_0000017_175250_176269 329
179 3300046471 Ga0495650_0000072 Ga0495650_0000072_156580_157593 329
180 3300046471 Ga0495650_0000427 Ga0495650_0000427_65940_66953 329
181 3300046471 Ga0495650_0001400 Ga0495650_0001400_13776_14795 329
182 3300046474 Ga0495605_0000065 Ga0495605_0000065_43356_44372 329
183 3300046474 Ga0495605_0000103 Ga0495605_0000103_12241_13254 329
184 3300046475 Ga0495639_0104061 Ga0495639_0104061_74_1093 329
185 3300046491 Ga0495584_0010538 Ga0495584_0010538_1720_2736 329
186 3300046492 Ga0495585_0006546 Ga0495585_0006546_1029_2042 329
187 3300046501 Ga0495607_0002416 Ga0495607_0002416_2998_4008 329
188 3300046501 Ga0495607_0004384 Ga0495607_0004384_7633_8649 329
189 3300046501 Ga0495607_0006334 Ga0495607_0006334_7143_8156 329
190 3300046501 Ga0495607_0008222 Ga0495607_0008222_1653_2669 329
191 3300046506 Ga0495583_0000050 Ga0495583_0000050_95361_96380 329
192 3300046507 Ga0495606_0017261 Ga0495606_0017261_2385_3401 329
193 3300046522 Ga0495643_0000028 Ga0495643_0000028_56989_58011 329
194 3300046522 Ga0495643_0000285 Ga0495643_0000285_53476_54495 329
195 3300046522 Ga0495643_0003603 Ga0495643_0003603_6796_7812 329
196 3300046522 Ga0495643_0062379 Ga0495643_0062379_412_1428 329
197 3300046524 Ga0495648_0000001 Ga0495648_0000001_662559_663578 329
198 3300046524 Ga0495648_0004722 Ga0495648_0004722_6207_7229 329
199 3300046524 Ga0495648_0005039 Ga0495648_0005039_4249_5265 329
200 3300046542 Ga0495597_0000705 Ga0495597_0000705_22877_23896 329
201 3300046542 Ga0495597_0000785 Ga0495597_0000785_966_1988 329
202 3300046557 Ga0495622_0000131 Ga0495622_0000131_17638_18657 329
203 3300046558 Ga0495633_0000106 Ga0495633_0000106_22929_23948 329
204 3300046558 Ga0495633_0001613 Ga0495633_0001613_9128_10150 329
205 3300046616 Ga0495668_0000686 Ga0495668_0000686_34053_35072 329
206 3300046616 Ga0495668_0001873 Ga0495668_0001873_14842_15855 329
207 3300046616 Ga0495668_0038986 Ga0495668_0038986_48_1058 329
208 3300046660 Ga0495625_0000035 Ga0495625_0000035_124115_125134 329
209 3300046660 Ga0495625_0000391 Ga0495625_0000391_21341_22354 329
210 3300046660 Ga0495625_0005766 Ga0495625_0005766_1863_2885 329
211 3300046660 Ga0495625_0040179 Ga0495625_0040179_1254_2276 329
212 3300046665 Ga0495661_0038869 Ga0495661_0038869_111_1127 329
213 3300046665 Ga0495661_0072287 Ga0495661_0072287_846_1856 329
214 3300046694 Ga0495649_0005212 Ga0495649_0005212_5435_6457 329
215 3300046794 Ga0495589_0000100 Ga0495589_0000100_69676_70692 329
216 3300046794 Ga0495589_0044221 Ga0495589_0044221_1034_2044 329
217 3300046810 Ga0495660_0000027 Ga0495660_0000027_197584_198600 329
218 3300046810 Ga0495660_0000335 Ga0495660_0000335_4600_5631 329
219 3300046810 Ga0495660_0099014 Ga0495660_0099014_21_1040 329
220 3300047320 Ga0495672_0002015 Ga0495672_0002015_11385_12401 329
221 3300047320 Ga0495672_0002622 Ga0495672_0002622_9301_10323 329
222 3300047443 Ga0495687_000012 Ga0495687_000012_221580_222596 329
223 3300047443 Ga0495687_000122 Ga0495687_000122_27928_28944 329
224 3300047443 Ga0495687_002318 Ga0495687_002318_2719_3735 329
225 3300047443 Ga0495687_002590 Ga0495687_002590_947_1966 329
226 3300047445 Ga0495677_0000880 Ga0495677_0000880_4381_5397 329
227 3300047469 Ga0495673_0000016 Ga0495673_0000016_232098_233111 329
228 3300047469 Ga0495673_0000035 Ga0495673_0000035_180407_181429 329
229 3300048091 Ga0495626_0000222 Ga0495626_0000222_42221_43237 329
230 3300048923 Ga0496120_0026089 Ga0496120_0026089_2416_3429 329
231 3300048925 Ga0496122_0042899 Ga0496122_0042899_785_1798 329
232 3300048926 Ga0496123_0016636 Ga0496123_0016636_2052_3065 329
233 3300048927 Ga0496124_0036499 Ga0496124_0036499_2761_3774 329
234 3300048927 Ga0496124_0317899 Ga0496124_0317899_19_1032 329
235 3300049459 Ga0495678_000002 Ga0495678_000002_945262_946284 329
236 3300049459 Ga0495678_000029 Ga0495678_000029_178970_179992 329
237 3300049459 Ga0495678_001464 Ga0495678_001464_646_1665 329
238 3300049459 Ga0495678_047451 Ga0495678_047451_17_1036 329
239 3300053125 Ga0500618_000068 Ga0500618_000068_60150_61163 329
240 3300053145 Ga0500586_000133 Ga0500586_000133_11801_12823 329
241 iso_pu_bacteria 2643221638 2644216065 329
242 3300044735 Ga0466968_0000207 Ga0466968_0000207_5997_7016 330
243 3300046538 Ga0495609_0001294 Ga0495609_0001294_9214_10233 330
244 3300046810 Ga0495660_0000555 Ga0495660_0000555_10789_11808 330
245 3300047472 Ga0495686_0000047 Ga0495686_0000047_93180_94187 330
246 3300030745 Ga0316182_1157731 Ga0316182_11577313 331
247 3300046452 Ga0495617_000208 Ga0495617_000208_12904_13926 331
248 3300046471 Ga0495650_0000019 Ga0495650_0000019_125973_126998 331
249 3300046491 Ga0495584_0002700 Ga0495584_0002700_820_1842 331
250 3300046492 Ga0495585_0000077 Ga0495585_0000077_7885_8907 331
251 3300046492 Ga0495585_0000094 Ga0495585_0000094_10049_11071 331
252 3300046492 Ga0495585_0000154 Ga0495585_0000154_56118_57140 331
253 3300046492 Ga0495585_0004193 Ga0495585_0004193_4746_5768 331
254 3300046492 Ga0495585_0020890 Ga0495585_0020890_2660_3682 331
255 3300046492 Ga0495585_0046294 Ga0495585_0046294_372_1394 331
256 3300046500 Ga0495596_0002214 Ga0495596_0002214_2957_3979 331
257 3300046506 Ga0495583_0000008 Ga0495583_0000008_227307_228323 331
258 3300046506 Ga0495583_0000064 Ga0495583_0000064_170900_171916 331
259 3300046507 Ga0495606_0000282 Ga0495606_0000282_45934_46959 331
260 3300046513 Ga0495616_0000952 Ga0495616_0000952_6524_7546 331
261 3300046513 Ga0495616_0002444 Ga0495616_0002444_2972_3994 331
262 3300046515 Ga0495620_0001344 Ga0495620_0001344_5326_6348 331
263 3300046524 Ga0495648_0000079 Ga0495648_0000079_60988_62010 331
264 3300046528 Ga0495642_0001666 Ga0495642_0001666_3956_4978 331
265 3300046538 Ga0495609_0012571 Ga0495609_0012571_1996_3018 331
266 3300046558 Ga0495633_0002681 Ga0495633_0002681_3246_4268 331
267 3300046616 Ga0495668_0002041 Ga0495668_0002041_7340_8362 331
268 3300046691 Ga0495670_0003991 Ga0495670_0003991_2003_3025 331
269 3300046691 Ga0495670_0068333 Ga0495670_0068333_321_1343 331
270 3300046810 Ga0495660_0015764 Ga0495660_0015764_550_1572 331
271 3300047323 Ga0495683_0000064 Ga0495683_0000064_55760_56782 331
272 3300047323 Ga0495683_0031744 Ga0495683_0031744_1117_2139 331
273 3300047323 Ga0495683_0064610 Ga0495683_0064610_160_1182 331
274 3300047470 Ga0495681_0016596 Ga0495681_0016596_1719_2741 331
275 3300047470 Ga0495681_0076115 Ga0495681_0076115_452_1474 331
276 3300048091 Ga0495626_0088994 Ga0495626_0088994_71_1093 331
277 3300048915 Ga0496112_0445245 Ga0496112_0445245_194_1216 331
278 3300048916 Ga0496113_0016368 Ga0496113_0016368_1007_2053 331
279 3300048925 Ga0496122_0016187 Ga0496122_0016187_4052_5098 331
280 3300048926 Ga0496123_0027615 Ga0496123_0027615_252_1298 331
281 3300048928 Ga0496125_0082716 Ga0496125_0082716_89_1135 331
282 iso_pu_bacteria 2857547612 2857548855 331
283 3300037312 Ga0395899_0000293 Ga0395899_0000293_60783_61802 332
284 3300046460 Ga0495638_0030190 Ga0495638_0030190_235_1260 332
285 3300046491 Ga0495584_0034316 Ga0495584_0034316_112_1137 332
286 3300046513 Ga0495616_0008348 Ga0495616_0008348_1565_2590 332
287 3300046513 Ga0495616_0061061 Ga0495616_0061061_419_1447 332
288 3300046518 Ga0495631_0011387 Ga0495631_0011387_1167_2186 332
289 3300046538 Ga0495609_0000110 Ga0495609_0000110_90373_91398 332
290 3300046558 Ga0495633_0080719 Ga0495633_0080719_320_1348 332
291 3300046660 Ga0495625_0137897 Ga0495625_0137897_151_1176 332
292 3300046664 Ga0495659_0002208 Ga0495659_0002208_3606_4631 332
293 3300046665 Ga0495661_0017888 Ga0495661_0017888_2508_3536 332
294 3300046684 Ga0495669_0014777 Ga0495669_0014777_1719_2747 332
295 3300046692 Ga0495671_0016122 Ga0495671_0016122_1287_2312 332
296 3300047443 Ga0495687_017344 Ga0495687_017344_163_1188 332
297 3300047445 Ga0495677_0020392 Ga0495677_0020392_949_1977 332
298 3300047470 Ga0495681_0000412 Ga0495681_0000412_504_1529 332
299 iso_pu_bacteria 2643221554 2643789477 332
300 3300003762 Ga0055542_1010174 Ga0055542_10101742 333
301 3300003771 Ga0055526_1001212 Ga0055526_10012126 333
302 3300003775 Ga0055524_1002730 Ga0055524_10027302 333
303 3300003791 Ga0055530_10001347 Ga0055530_100013476 333
304 3300025254 Ga0209148_1000678 Ga0209148_100067814 333
305 3300025263 Ga0209565_1005735 Ga0209565_10057352 333
306 3300025273 Ga0209673_1036968 Ga0209673_10369681 333
307 3300025291 Ga0209675_1010902 Ga0209675_10109023 333
308 3300025295 Ga0209564_1000343 Ga0209564_100034369 333
309 3300025295 Ga0209564_1004142 Ga0209564_10041422 333
310 3300025298 Ga0209050_1000316 Ga0209050_100031665 333
311 3300025299 Ga0209256_1000841 Ga0209256_100084129 333
312 3300037312 Ga0395899_0022029 Ga0395899_0022029_1004_2032 333
313 3300037471 Ga0395905_0099144 Ga0395905_0099144_894_1922 333
314 3300037471 Ga0395905_0263010 Ga0395905_0263010_471_1499 333
315 3300038443 Ga0395901_0000019 Ga0395901_0000019_222897_223922 333
316 3300046491 Ga0495584_0004981 Ga0495584_0004981_5453_6514 333
317 3300046501 Ga0495607_0002798 Ga0495607_0002798_8657_9679 333
318 3300046506 Ga0495583_0000485 Ga0495583_0000485_7024_8046 333
319 3300046506 Ga0495583_0036288 Ga0495583_0036288_472_1545 333
320 3300046518 Ga0495631_0010999 Ga0495631_0010999_2909_3952 333
321 3300046519 Ga0495632_0000367 Ga0495632_0000367_8429_9472 333
322 3300046519 Ga0495632_0009928 Ga0495632_0009928_1069_2091 333
323 3300046524 Ga0495648_0010212 Ga0495648_0010212_3243_4316 333
324 3300046528 Ga0495642_0000846 Ga0495642_0000846_6009_7052 333
325 3300046530 Ga0495654_0039904 Ga0495654_0039904_714_1757 333
326 3300046542 Ga0495597_0008085 Ga0495597_0008085_78_1136 333
327 3300046616 Ga0495668_0001982 Ga0495668_0001982_16357_17418 333
328 3300046665 Ga0495661_0004266 Ga0495661_0004266_6618_7640 333
329 3300046674 Ga0495588_0021466 Ga0495588_0021466_1636_2679 333
330 3300046684 Ga0495669_0004413 Ga0495669_0004413_746_1789 333
331 3300046794 Ga0495589_0007312 Ga0495589_0007312_4078_5139 333
332 3300046810 Ga0495660_0029246 Ga0495660_0029246_826_1848 333
333 3300047320 Ga0495672_0020441 Ga0495672_0020441_3114_4175 333
334 3300047445 Ga0495677_0032411 Ga0495677_0032411_396_1421 333
335 3300048091 Ga0495626_0004268 Ga0495626_0004268_7420_8442 333
336 3300048091 Ga0495626_0006690 Ga0495626_0006690_4947_6101 333
337 3300048091 Ga0495626_0007695 Ga0495626_0007695_569_1591 333
338 3300048091 Ga0495626_0008927 Ga0495626_0008927_596_1618 333
339 3300048091 Ga0495626_0009889 Ga0495626_0009889_273_1370 333
340 3300048909 Ga0496106_0024736 Ga0496106_0024736_2355_3383 333
341 3300048910 Ga0496107_0048122 Ga0496107_0048122_1925_2953 333
342 3300049822 Ga0501035_0003225 Ga0501035_0003225_7476_8501 333
343 3300049823 Ga0501044_0191840 Ga0501044_0191840_442_1467 333
344 3300002773 JGI25152J39213_1000026 JGI25152J39213_100002660 334
345 3300002774 JGI25150J39212_1000478 JGI25150J39212_100047811 334
346 3300003775 Ga0055524_1000297 Ga0055524_100029739 334
347 3300025245 Ga0207425_1000017 Ga0207425_100001737 334
348 3300025258 Ga0209129_1000162 Ga0209129_100016258 334
349 3300025263 Ga0209565_1001634 Ga0209565_10016347 334
350 3300025297 Ga0209758_1000250 Ga0209758_100025068 334
351 3300025299 Ga0209256_1000184 Ga0209256_100018458 334
352 3300046474 Ga0495605_0023242 Ga0495605_0023242_1579_2643 334
353 3300046492 Ga0495585_0004564 Ga0495585_0004564_2593_3657 334
354 3300046506 Ga0495583_0038233 Ga0495583_0038233_790_1854 334
355 3300046507 Ga0495606_0083449 Ga0495606_0083449_426_1490 334
356 3300046538 Ga0495609_0030944 Ga0495609_0030944_591_1655 334
357 3300046616 Ga0495668_0040232 Ga0495668_0040232_1152_2216 334
358 3300046648 Ga0495611_0001337 Ga0495611_0001337_2246_3310 334
359 3300048091 Ga0495626_0006302 Ga0495626_0006302_3666_4730 334
360 3300049460 Ga0495682_0012721 Ga0495682_0012721_522_1586 334
361 3300003771 Ga0055526_1005606 Ga0055526_10056064 335
362 3300003773 Ga0055537_1000191 Ga0055537_100019134 335
363 3300003775 Ga0055524_1003872 Ga0055524_10038722 335
364 3300003784 Ga0055534_1000051 Ga0055534_100005146 335
365 3300003790 Ga0055528_1000731 Ga0055528_100073113 335
366 3300025263 Ga0209565_1000017 Ga0209565_1000017217 335
367 3300025273 Ga0209673_1000007 Ga0209673_1000007212 335
368 3300025291 Ga0209675_1000009 Ga0209675_1000009306 335
369 3300025295 Ga0209564_1000036 Ga0209564_1000036212 335
370 3300025295 Ga0209564_1000055 Ga0209564_1000055241 335
371 3300025299 Ga0209256_1000167 Ga0209256_100016727 335
372 3300028800 Ga0265338_10022376 Ga0265338_100223762 335
373 3300002739 JGI25158J39367_1001942 JGI25158J39367_10019422 336
374 3300002987 JGI25159J45721_1005987 JGI25159J45721_10059872 336
375 3300003374 JGI25161J50226_1000886 JGI25161J50226_10008867 336
376 3300004625 Ga0055543_1000103 Ga0055543_100010325 336
377 3300005262 Ga0065165_1001082 Ga0065165_10010829 336
378 3300017792 Ga0163161_10024251 Ga0163161_100242512 336
379 3300025208 Ga0209436_100723 Ga0209436_1007233 336
380 3300025284 Ga0209130_1000188 Ga0209130_100018860 336
381 3300025302 Ga0207426_1044299 Ga0207426_10442991 336
382 3300028573 Ga0265334_10006335 Ga0265334_100063352 336
383 3300046519 Ga0495632_0024734 Ga0495632_0024734_869_1930 336
384 3300047320 Ga0495672_0000165 Ga0495672_0000165_90164_91225 336
385 iso_pu_bacteria 2600255292 2601671305 336
386 3300003791 Ga0055530_10011975 Ga0055530_100119752 337
387 3300003794 Ga0055531_10026481 Ga0055531_100264812 337
388 3300025298 Ga0209050_1003682 Ga0209050_10036826 337
389 3300025304 Ga0209257_1007114 Ga0209257_10071142 337
390 3300031548 Ga0307408_100000092 Ga0307408_10000009271 337
391 3300002739 JGI25158J39367_1001403 JGI25158J39367_10014032 338
392 3300002774 JGI25150J39212_1003471 JGI25150J39212_10034713 338
393 3300003771 Ga0055526_1007349 Ga0055526_10073492 338
394 3300003773 Ga0055537_1008977 Ga0055537_10089773 338
395 3300003784 Ga0055534_1000588 Ga0055534_10005882 338
396 3300003794 Ga0055531_10010616 Ga0055531_100106162 338
397 3300025208 Ga0209436_115510 Ga0209436_1155101 338
398 3300025245 Ga0207425_1000085 Ga0207425_100008531 338
399 3300025245 Ga0207425_1000347 Ga0207425_100034721 338
400 3300025258 Ga0209129_1001298 Ga0209129_10012986 338
401 3300025263 Ga0209565_1001892 Ga0209565_10018922 338
402 3300025284 Ga0209130_1007631 Ga0209130_10076312 338
403 3300025295 Ga0209564_1022150 Ga0209564_10221502 338
404 3300025298 Ga0209050_1000612 Ga0209050_100061218 338
405 3300025299 Ga0209256_1001411 Ga0209256_10014113 338
406 3300025302 Ga0207426_1005222 Ga0207426_10052224 338
407 3300025303 Ga0209051_1011360 Ga0209051_10113603 338
408 3300025304 Ga0209257_1000123 Ga0209257_1000123147 338
409 3300031548 Ga0307408_100020827 Ga0307408_1000208272 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

68

368

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gye-assembly1.cif.gz_B structure of cellvibrio cellulosa alpha-l-arabinanase complexed with arabinohexaose 0.9841 24 335
1gyd-assembly1.cif.gz_B structure of cellvibrio cellulosa alpha-l-arabinanase 0.9834 25 335
1gyh-assembly4.cif.gz_D structure of d158a cellvibrio cellulosa alpha-l-arabinanase mutant 0.9813 23 335
1gye-assembly1.cif.gz_B structure of cellvibrio cellulosa alpha-l-arabinanase complexed with arabinohexaose 0.9718 24 335
1gyh-assembly4.cif.gz_D structure of d158a cellvibrio cellulosa alpha-l-arabinanase mutant 0.9691 23 335
ID Description Score Start End Superfamily
1gyeB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9841 24 335 2.115.10.20
1gyeB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9718 24 335 2.115.10.20
1wl7A00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9519 26 321 2.115.10.20
4kcbB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9413 23 323 2.115.10.20
4kcbB00 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.9174 23 323 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A7Z2W1E0-F1-model_v4 Arabinan endo-1,5-alpha-L-arabinosidase 0.994 33 335 GO:0031222
GO:0046558
AF-A0A377RJW0-F1-model_v4 Beta-xylosidase 0.9894 263 332
AF-A0A5C5U688-F1-model_v4 Extracellular exo-alpha-(1->5)-L-arabinofuranosidase (EC 3.2.1.55) 0.9872 25 328 GO:0031222
GO:0046556
GO:0046558
AF-A0A7X9DMK2-F1-model_v4 Arabinan endo-1,5-alpha-L-arabinosidase 0.9864 215 323 GO:0004553
GO:0005975
AF-A0A5D4XVE3-F1-model_v4 Extracellular exo-alpha-(1->5)-L-arabinofuranosidase (EC 3.2.1.55) 0.986 25 327 GO:0031222
GO:0046556
GO:0046558

Feature Viewer

pLDDT pTM Quality
88.68 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map