F437075

General Info

Members Datasets Scaffolds Average Seq Length
409 181 409 184

Family's Representative Sequence

Representative Sequence 3300046537|Ga0495598_0048939|Ga0495598_0048939_569_1174
Length 201
Sequence LRYKFEKARLKAELQTKIMISEPERIVTIFGGAKCGEEDPEYDQARRVGQLLADAGFTICTGGYLGVMEAASRGAHERGGRVLGIVMNQFKAEPNRYLTDKVATPHFYERLQRLITRSVGFVAIRGGMGTVTELSLVWNKIQTRVIGPRPLVLLGECWPPIVREWQKHLAVSDADVAVLDFANTPEEAVAIINEKSQGVTI

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 0.24
Rhizosphere 97.56
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_14395186 2162886012 Bacteria 2801
2 MBSR1b_contig_356884 2162886012 Bacteria 2805
3 MBSR1b_contig_8674724 2162886012 Bacteria 2223
4 Ga0065704_10580545 3300005289 Unclassified 612
5 Ga0065712_10079165 3300005290 Bacteria 3251
6 Ga0065712_10155890 3300005290 Bacteria 1292
7 Ga0065715_10275224 3300005293 Bacteria 1100
8 Ga0065715_10317781 3300005293 Bacteria 1008
9 Ga0065707_10137944 3300005295 Bacteria 1813
10 Ga0070676_10242019 3300005328 Unclassified 1200
11 Ga0070683_100716507 3300005329 Unclassified 958
12 Ga0070690_100001424 3300005330 Bacteria 12484
13 Ga0070690_100004111 3300005330 Bacteria 8055
14 Ga0070690_100007832 3300005330 Bacteria 6126
15 Ga0070690_100042343 3300005330 Bacteria 2884
16 Ga0070690_100236649 3300005330 Bacteria 1286
17 Ga0070670_100139539 3300005331 Unclassified 2096
18 Ga0070670_100196771 3300005331 Unclassified 1751
19 Ga0070670_100413293 3300005331 Bacteria 1192
20 Ga0070670_100460120 3300005331 Unclassified 1128
21 Ga0068869_100020456 3300005334 Bacteria 4538
22 Ga0068869_100021498 3300005334 Bacteria 4439
23 Ga0068869_100044058 3300005334 Bacteria 3208
24 Ga0068869_100156626 3300005334 Bacteria 1770
25 Ga0068869_100552541 3300005334 Unclassified 967
26 Ga0070666_10086971 3300005335 Bacteria 2142
27 Ga0070680_100164390 3300005336 Bacteria 1866
28 Ga0070682_100000068 3300005337 Bacteria 96186
29 Ga0068868_100073919 3300005338 Bacteria 2722
30 Ga0070691_10184688 3300005341 Unclassified 1087
31 Ga0070687_100075229 3300005343 Bacteria 1825
32 Ga0070687_100076671 3300005343 Bacteria 1811
33 Ga0070687_100205196 3300005343 Unclassified 1197
34 Ga0070692_10011735 3300005345 Bacteria 4033
35 Ga0070692_10092747 3300005345 Bacteria 1644
36 Ga0070692_10181282 3300005345 Bacteria 1221
37 Ga0070669_100002485 3300005353 Bacteria 13352
38 Ga0070669_100027277 3300005353 Bacteria 4110
39 Ga0070669_100186930 3300005353 Unclassified 1623
40 Ga0070675_100065933 3300005354 Bacteria 2994
41 Ga0070671_100007324 3300005355 Bacteria 8814
42 Ga0070671_100119831 3300005355 Bacteria 2214
43 Ga0070671_100307112 3300005355 Unclassified 1351
44 Ga0070671_100387571 3300005355 Bacteria 1194
45 Ga0070673_100004290 3300005364 Bacteria 9002
46 Ga0070673_100069418 3300005364 Bacteria 2824
47 Ga0070673_100156953 3300005364 Unclassified 1932
48 Ga0070688_100071892 3300005365 Bacteria 2215
49 Ga0070667_100040802 3300005367 Bacteria 3893
50 Ga0070667_100171797 3300005367 Bacteria 1914
51 Ga0070703_10000145 3300005406 Bacteria 36771
52 Ga0070709_10415421 3300005434 Unclassified 1007
53 Ga0070701_10447497 3300005438 Unclassified 828
54 Ga0070705_100106944 3300005440 Bacteria 1779
55 Ga0070705_100221451 3300005440 Bacteria 1310
56 Ga0070705_100535499 3300005440 Unclassified 895
57 Ga0070705_100645078 3300005440 Bacteria 825
58 Ga0070700_100020097 3300005441 Bacteria 3863
59 Ga0070700_100033005 3300005441 Bacteria 3116
60 Ga0070700_100183732 3300005441 Unclassified 1457
61 Ga0070700_100330938 3300005441 Bacteria 1122
62 Ga0070694_100032046 3300005444 Bacteria 3449
63 Ga0070694_100068990 3300005444 Bacteria 2431
64 Ga0070694_100165376 3300005444 Bacteria 1626
65 Ga0070694_100211886 3300005444 Unclassified 1449
66 Ga0070694_100847003 3300005444 Unclassified 752
67 Ga0070708_100000002 3300005445 Bacteria 195857
68 Ga0070708_100048829 3300005445 Unclassified 3743
69 Ga0070708_100176903 3300005445 Unclassified 1994
70 Ga0070708_100235571 3300005445 Bacteria 1718
71 Ga0070708_100276793 3300005445 Bacteria 1579
72 Ga0070708_100332978 3300005445 Bacteria 1430
73 Ga0070708_100463931 3300005445 Unclassified 1195
74 Ga0070678_100281155 3300005456 Bacteria 1407
75 Ga0070662_100135433 3300005457 Bacteria 1904
76 Ga0070681_10000041 3300005458 Bacteria 89178
77 Ga0068867_100030162 3300005459 Bacteria 3911
78 Ga0068867_100390473 3300005459 Bacteria 1171
79 Ga0070685_10106145 3300005466 Bacteria 1723
80 Ga0070706_100007540 3300005467 Bacteria 10195
81 Ga0070706_100112381 3300005467 Unclassified 2536
82 Ga0070706_100545410 3300005467 Unclassified 1079
83 Ga0070706_100749646 3300005467 Unclassified 905
84 Ga0070707_100007291 3300005468 Bacteria 10269
85 Ga0070707_100035995 3300005468 Bacteria 4723
86 Ga0070707_100365499 3300005468 Bacteria 1402
87 Ga0070698_100000916 3300005471 Bacteria 32268
88 Ga0070698_100002314 3300005471 Bacteria 21075
89 Ga0070698_100005272 3300005471 Bacteria 14142
90 Ga0070698_100042628 3300005471 Unclassified 4655
91 Ga0070698_100050816 3300005471 Bacteria 4224
92 Ga0070699_100011662 3300005518 Bacteria 7587
93 Ga0070699_100018154 3300005518 Bacteria 6044
94 Ga0070699_100181603 3300005518 Bacteria 1867
95 Ga0070699_100216615 3300005518 Unclassified 1706
96 Ga0070699_100765068 3300005518 Unclassified 883
97 Ga0070679_100000074 3300005530 Bacteria 74890
98 Ga0070684_100432092 3300005535 Bacteria 1216
99 Ga0070697_100000071 3300005536 Bacteria 80945
100 Ga0070697_100006651 3300005536 Bacteria 8962
101 Ga0070697_100075319 3300005536 Bacteria 2774
102 Ga0070697_100140368 3300005536 Bacteria 2032
103 Ga0070697_100226171 3300005536 Bacteria 1595
104 Ga0070697_100252461 3300005536 Unclassified 1508
105 Ga0070697_100285516 3300005536 Bacteria 1416
106 Ga0070697_100335471 3300005536 Bacteria 1304
107 Ga0070697_100519618 3300005536 Bacteria 1042
108 Ga0070697_100770114 3300005536 Unclassified 851
109 Ga0070672_100021978 3300005543 Bacteria 4677
110 Ga0070672_100032540 3300005543 Unclassified 3937
111 Ga0070686_100005759 3300005544 Bacteria 6873
112 Ga0070686_100016818 3300005544 Bacteria 4260
113 Ga0070686_100029631 3300005544 Bacteria 3332
114 Ga0070686_100105706 3300005544 Bacteria 1909
115 Ga0070695_100345395 3300005545 Unclassified 1113
116 Ga0070695_100351848 3300005545 Unclassified 1104
117 Ga0070695_100386449 3300005545 Bacteria 1057
118 Ga0070696_100060790 3300005546 Bacteria 2642
119 Ga0070696_100071249 3300005546 Bacteria 2446
120 Ga0070696_100071466 3300005546 Bacteria 2442
121 Ga0070696_100211509 3300005546 Unclassified 1452
122 Ga0070693_100065285 3300005547 Bacteria 2127
123 Ga0070665_100258414 3300005548 Bacteria 1743
124 Ga0070704_100100443 3300005549 Bacteria 2178
125 Ga0070704_100606208 3300005549 Unclassified 963
126 Ga0070704_100951420 3300005549 Bacteria 775
127 Ga0068855_101416440 3300005563 Unclassified 716
128 Ga0070664_100187820 3300005564 Bacteria 1840
129 Ga0070664_100381354 3300005564 Bacteria 1287
130 Ga0068854_100077785 3300005578 Bacteria 2442
131 Ga0068854_100147850 3300005578 Bacteria 1809
132 Ga0068854_100212375 3300005578 Unclassified 1527
133 Ga0068854_100385877 3300005578 Unclassified 1155
134 Ga0068854_100758493 3300005578 Bacteria 842
135 Ga0068856_100013250 3300005614 Bacteria 7985
136 Ga0070702_100042787 3300005615 Bacteria 2549
137 Ga0068859_100028077 3300005617 Bacteria 5642
138 Ga0068859_100079642 3300005617 Unclassified 3316
139 Ga0068859_100728523 3300005617 Unclassified 1081
140 Ga0068864_100251425 3300005618 Bacteria 1641
141 Ga0068864_100318356 3300005618 Bacteria 1460
142 Ga0068866_10261723 3300005718 Unclassified 1063
143 Ga0068861_100013999 3300005719 Bacteria 5624
144 Ga0068861_100055690 3300005719 Unclassified 3016
145 Ga0068861_100249459 3300005719 Bacteria 1514
146 Ga0068870_10098560 3300005840 Bacteria 1647
147 Ga0068863_100028034 3300005841 Bacteria 5376
148 Ga0068863_100478932 3300005841 Bacteria 1224
149 Ga0068863_100636707 3300005841 Bacteria 1057
150 Ga0068863_100831340 3300005841 Bacteria 922
151 Ga0068858_100045664 3300005842 Bacteria 4060
152 Ga0068858_100084999 3300005842 Bacteria 2943
153 Ga0068858_100361476 3300005842 Bacteria 1391
154 Ga0068860_100006276 3300005843 Bacteria 11937
155 Ga0068860_100107735 3300005843 Bacteria 2663
156 Ga0068860_100115075 3300005843 Bacteria 2572
157 Ga0068860_100117071 3300005843 Bacteria 2549
158 Ga0068860_100379420 3300005843 Unclassified 1395
159 Ga0068860_100379617 3300005843 Unclassified 1395
160 Ga0068862_100032058 3300005844 Bacteria 4440
161 Ga0068862_100290844 3300005844 Unclassified 1500
162 Ga0068862_100367878 3300005844 Bacteria 1338
163 Ga0081539_10001415 3300005985 Bacteria 41285
164 Ga0070715_10000022 3300006163 Bacteria 118193
165 Ga0070716_100000123 3300006173 Bacteria 30539
166 Ga0070716_100094982 3300006173 Unclassified 1814
167 Ga0097621_100011865 3300006237 Bacteria 6441
168 Ga0097621_100022610 3300006237 Bacteria 4883
169 Ga0068871_100010687 3300006358 Bacteria 6712
170 Ga0068871_100022870 3300006358 Bacteria 4825
171 Ga0068871_100373837 3300006358 Unclassified 1265
172 Ga0075431_100522440 3300006847 Bacteria 1176
173 Ga0075433_10002948 3300006852 Bacteria 13060
174 Ga0075434_100828586 3300006871 Bacteria 941
175 Ga0075429_100109162 3300006880 Bacteria 2418
176 Ga0075429_100631099 3300006880 Bacteria 939
177 Ga0075436_100000011 3300006914 Bacteria 208094
178 Ga0097620_100028077 3300006931 Bacteria 5642
179 Ga0097620_100079643 3300006931 Unclassified 3316
180 Ga0097620_100728467 3300006931 Unclassified 1081
181 Ga0075435_100000558 3300007076 Bacteria 22876
182 Ga0099794_10218206 3300007265 Bacteria 979
183 Ga0105240_11208479 3300009093 Bacteria 800
184 Ga0111539_10520216 3300009094 Unclassified 1386
185 Ga0111539_11757965 3300009094 Unclassified 719
186 Ga0105245_10272219 3300009098 Bacteria 1652
187 Ga0105245_10456559 3300009098 Bacteria 1287
188 Ga0105245_11334259 3300009098 Bacteria 767
189 Ga0114129_10008181 3300009147 Bacteria 14903
190 Ga0114129_10021892 3300009147 Bacteria 9073
191 Ga0114129_10080221 3300009147 Bacteria 4536
192 Ga0114129_10197743 3300009147 Bacteria 2725
193 Ga0114129_10636529 3300009147 Unclassified 1378
194 Ga0114129_11778120 3300009147 Bacteria 750
195 Ga0105243_10232352 3300009148 Bacteria 1637
196 Ga0105243_10324199 3300009148 Unclassified 1405
197 Ga0105241_10211319 3300009174 Bacteria 1626
198 Ga0105242_10009157 3300009176 Bacteria 7601
199 Ga0105242_10030109 3300009176 Bacteria 4334
200 Ga0105242_10121809 3300009176 Bacteria 2240
201 Ga0105242_10301414 3300009176 Bacteria 1463
202 Ga0105242_10477536 3300009176 Bacteria 1181
203 Ga0105242_10833089 3300009176 Bacteria 916
204 Ga0105248_10008438 3300009177 Bacteria 11304
205 Ga0105248_10190085 3300009177 Bacteria 2314
206 Ga0105248_10694571 3300009177 Unclassified 1148
207 Ga0105248_11208667 3300009177 Bacteria 855
208 Ga0105248_11420404 3300009177 Unclassified 785
209 Ga0105237_10063432 3300009545 Unclassified 3692
210 Ga0105249_10000142 3300009553 Bacteria 92745
211 Ga0105249_10024441 3300009553 Bacteria 5430
212 Ga0105249_10048500 3300009553 Unclassified 3871
213 Ga0105249_12049162 3300009553 Unclassified 645
214 Ga0105239_10221325 3300010375 Bacteria 2123
215 Ga0105239_10291794 3300010375 Bacteria 1837
216 Ga0105246_10041384 3300011119 Bacteria 3114
217 Ga0105246_11098233 3300011119 Bacteria 726
218 Ga0157374_10136566 3300013296 Bacteria 2378
219 Ga0157374_10233032 3300013296 Bacteria 1809
220 Ga0157378_10053534 3300013297 Bacteria 3593
221 Ga0157378_10095293 3300013297 Bacteria 2711
222 Ga0157378_10097277 3300013297 Bacteria 2683
223 Ga0157378_10170491 3300013297 Bacteria 2041
224 Ga0157378_10242189 3300013297 Unclassified 1723
225 Ga0157378_10415353 3300013297 Unclassified 1329
226 Ga0157378_11984058 3300013297 Unclassified 632
227 Ga0163162_10000553 3300013306 Bacteria 34596
228 Ga0163162_10006608 3300013306 Bacteria 11234
229 Ga0163162_10015662 3300013306 Bacteria 7410
230 Ga0163162_10041375 3300013306 Bacteria 4611
231 Ga0163162_10050405 3300013306 Unclassified 4175
232 Ga0163162_10114428 3300013306 Bacteria 2797
233 Ga0157372_10090306 3300013307 Bacteria 3482
234 Ga0157375_10068333 3300013308 Bacteria 3555
235 Ga0157375_10227599 3300013308 Unclassified 2023
236 Ga0157375_10466303 3300013308 Bacteria 1428
237 Ga0157375_10605430 3300013308 Unclassified 1255
238 Ga0157375_10697456 3300013308 Unclassified 1169
239 Ga0157375_10774428 3300013308 Unclassified 1109
240 Ga0157375_10936268 3300013308 Bacteria 1009
241 Ga0157375_11535392 3300013308 Unclassified 786
242 Ga0157375_12514428 3300013308 Bacteria 615
243 Ga0163163_10012830 3300014325 Bacteria 7646
244 Ga0163163_10033980 3300014325 Bacteria 4936
245 Ga0163163_10061428 3300014325 Bacteria 3723
246 Ga0163163_10110403 3300014325 Bacteria 2778
247 Ga0163163_10345002 3300014325 Unclassified 1545
248 Ga0163163_10749763 3300014325 Bacteria 1040
249 Ga0157380_10023479 3300014326 Bacteria 4652
250 Ga0157380_10029893 3300014326 Unclassified 4168
251 Ga0157380_10115305 3300014326 Bacteria 2265
252 Ga0157380_10160816 3300014326 Bacteria 1952
253 Ga0157380_10439751 3300014326 Bacteria 1249
254 Ga0157380_10679056 3300014326 Unclassified 1032
255 Ga0157377_10058432 3300014745 Bacteria 2196
256 Ga0157379_10244711 3300014968 Bacteria 1627
257 Ga0157376_10043828 3300014969 Bacteria 3673
258 Ga0157376_10138178 3300014969 Bacteria 2183
259 Ga0163161_10022277 3300017792 Bacteria 4459
260 Ga0163161_10087218 3300017792 Bacteria 2305
261 Ga0213876_10000043 3300021384 Bacteria 162257
262 Ga0213876_10049691 3300021384 Bacteria 2216
263 Ga0207653_10000008 3300025885 Bacteria 197323
264 Ga0207688_10059929 3300025901 Bacteria 2143
265 Ga0207680_10146344 3300025903 Bacteria 1571
266 Ga0207685_10000015 3300025905 Bacteria 170813
267 Ga0207699_10352148 3300025906 Unclassified 1040
268 Ga0207645_10056112 3300025907 Bacteria 2514
269 Ga0207645_10128991 3300025907 Bacteria 1645
270 Ga0207684_10030131 3300025910 Bacteria 4620
271 Ga0207684_10084792 3300025910 Bacteria 2698
272 Ga0207684_10126882 3300025910 Bacteria 2190
273 Ga0207654_10051495 3300025911 Bacteria 2370
274 Ga0207707_10000077 3300025912 Bacteria 100255
275 Ga0207671_10119782 3300025914 Bacteria 2011
276 Ga0207660_10253140 3300025917 Unclassified 1390
277 Ga0207662_10027550 3300025918 Unclassified 3280
278 Ga0207662_10409882 3300025918 Bacteria 920
279 Ga0207657_10556000 3300025919 Bacteria 897
280 Ga0207652_10000096 3300025921 Bacteria 96047
281 Ga0207646_10011439 3300025922 Bacteria 8599
282 Ga0207646_10138770 3300025922 Bacteria 2189
283 Ga0207646_10706726 3300025922 Bacteria 901
284 Ga0207646_10977675 3300025922 Bacteria 749
285 Ga0207681_10017230 3300025923 Bacteria 4533
286 Ga0207681_10030405 3300025923 Unclassified 3521
287 Ga0207681_10040427 3300025923 Bacteria 3103
288 Ga0207681_10534066 3300025923 Unclassified 964
289 Ga0207650_10105231 3300025925 Unclassified 2178
290 Ga0207650_10393503 3300025925 Unclassified 1146
291 Ga0207650_10415294 3300025925 Bacteria 1116
292 Ga0207659_10856529 3300025926 Unclassified 781
293 Ga0207687_10509362 3300025927 Bacteria 1005
294 Ga0207644_10010294 3300025931 Bacteria 6164
295 Ga0207644_10071763 3300025931 Bacteria 2534
296 Ga0207686_10000449 3300025934 Bacteria 27318
297 Ga0207686_10068720 3300025934 Bacteria 2270
298 Ga0207686_10146977 3300025934 Bacteria 1636
299 Ga0207686_10191339 3300025934 Bacteria 1459
300 Ga0207709_10046386 3300025935 Bacteria 2637
301 Ga0207709_10182799 3300025935 Unclassified 1482
302 Ga0207670_10205935 3300025936 Bacteria 1497
303 Ga0207670_10398847 3300025936 Bacteria 1099
304 Ga0207704_10070767 3300025938 Bacteria 2210
305 Ga0207704_10214614 3300025938 Bacteria 1419
306 Ga0207665_10000048 3300025939 Bacteria 76446
307 Ga0207691_10001740 3300025940 Bacteria 21468
308 Ga0207691_10472915 3300025940 Unclassified 1065
309 Ga0207711_10156941 3300025941 Unclassified 2057
310 Ga0207711_10632015 3300025941 Bacteria 999
311 Ga0207689_10005052 3300025942 Bacteria 11893
312 Ga0207689_10010994 3300025942 Bacteria 7781
313 Ga0207689_10056506 3300025942 Bacteria 3230
314 Ga0207689_10128587 3300025942 Bacteria 2084
315 Ga0207679_10021708 3300025945 Bacteria 4358
316 Ga0207667_10340563 3300025949 Unclassified 1530
317 Ga0207651_10003530 3300025960 Bacteria 7688
318 Ga0207651_10074282 3300025960 Bacteria 2421
319 Ga0207651_10136763 3300025960 Bacteria 1886
320 Ga0207712_10000106 3300025961 Bacteria 94950
321 Ga0207712_10013267 3300025961 Bacteria 5281
322 Ga0207712_10042221 3300025961 Bacteria 3139
323 Ga0207712_10146465 3300025961 Bacteria 1819
324 Ga0207640_10039822 3300025981 Unclassified 2978
325 Ga0207640_10420306 3300025981 Bacteria 1094
326 Ga0207640_10640193 3300025981 Bacteria 905
327 Ga0207658_10159373 3300025986 Bacteria 1848
328 Ga0207658_10163121 3300025986 Bacteria 1828
329 Ga0207677_10084686 3300026023 Bacteria 2286
330 Ga0207677_10118870 3300026023 Bacteria 1984
331 Ga0207677_10204204 3300026023 Bacteria 1573
332 Ga0207677_10301905 3300026023 Unclassified 1323
333 Ga0207703_10035805 3300026035 Bacteria 3946
334 Ga0207639_10227631 3300026041 Bacteria 1614
335 Ga0207708_10060610 3300026075 Unclassified 2888
336 Ga0207708_10174756 3300026075 Bacteria 1703
337 Ga0207708_10260590 3300026075 Bacteria 1399
338 Ga0207708_10263332 3300026075 Bacteria 1392
339 Ga0207708_10380758 3300026075 Bacteria 1163
340 Ga0207702_10022880 3300026078 Bacteria 5185
341 Ga0207641_10213052 3300026088 Bacteria 1787
342 Ga0207641_10419283 3300026088 Bacteria 1288
343 Ga0207641_10995312 3300026088 Bacteria 835
344 Ga0207648_10023665 3300026089 Bacteria 5498
345 Ga0207648_10269713 3300026089 Bacteria 1520
346 Ga0207648_10401550 3300026089 Unclassified 1242
347 Ga0207676_10023874 3300026095 Bacteria 4518
348 Ga0207676_10078360 3300026095 Bacteria 2676
349 Ga0207676_10094409 3300026095 Bacteria 2465
350 Ga0207674_10422033 3300026116 Bacteria 1289
351 Ga0207675_100005444 3300026118 Bacteria 12201
352 Ga0207675_100127388 3300026118 Unclassified 2413
353 Ga0207675_100642039 3300026118 Unclassified 1067
354 Ga0207675_100984978 3300026118 Bacteria 861
355 Ga0207683_10246568 3300026121 Bacteria 1630
356 Ga0268266_10185622 3300028379 Bacteria 1896
357 Ga0268265_10003630 3300028380 Bacteria 11011
358 Ga0268265_10043193 3300028380 Unclassified 3349
359 Ga0268264_10042957 3300028381 Bacteria 3744
360 Ga0268264_10058478 3300028381 Bacteria 3229
361 Ga0268264_10086944 3300028381 Bacteria 2687
362 Ga0268264_10291641 3300028381 Bacteria 1532
363 Ga0268264_10401839 3300028381 Unclassified 1317
364 Ga0307513_10131146 3300031456 Bacteria 2451
365 Ga0307513_10159296 3300031456 Bacteria 2152
366 Ga0307405_10445948 3300031731 Bacteria 1025
367 Ga0307410_10121313 3300031852 Unclassified 1907
368 Ga0307406_10251255 3300031901 Bacteria 1332
369 Ga0307411_10340840 3300032005 Bacteria 1218
370 Ga0307415_100945689 3300032126 Bacteria 797
371 Ga0373937_0046462 3300036401 Unclassified 3971
372 Ga0395900_0064836 3300037418 Bacteria 3753
373 Ga0395900_0895936 3300037418 Bacteria 811
374 Ga0395905_0299174 3300037471 Unclassified 1496
375 Ga0395901_1093291 3300038443 Unclassified 768
376 Ga0436365_0013216 3300039437 Bacteria 44926
377 Ga0436365_0421852 3300039437 Bacteria 162876
378 Ga0436365_1223237 3300039437 Bacteria 5854
379 Ga0436365_1630108 3300039437 Bacteria 1015
380 Ga0436362_0696948 3300039453 Bacteria 1773
381 Ga0439462_0122746 3300042015 Unclassified 723
382 Ga0439434_0030665 3300042435 Bacteria 1633
383 Ga0451576_0251625 3300045051 Bacteria 1847
384 Ga0451576_0546701 3300045051 Bacteria 1217
385 Ga0451576_1366041 3300045051 Bacteria 738
386 Ga0451576_1870788 3300045051 Bacteria 620
387 Ga0495630_0575652 3300046517 Unclassified 863
388 Ga0495663_0000433 3300046525 Bacteria 15293
389 Ga0495598_0048939 3300046537 Bacteria 1265
390 Ga0495621_0004254 3300046539 Bacteria 4006
391 Ga0495621_0093799 3300046539 Bacteria 1134
392 Ga0495613_0182936 3300046689 Bacteria 1484
393 Ga0495636_0048166 3300047318 Bacteria 1781
394 Ga0495684_0214374 3300047471 Unclassified 1414
395 Ga0496104_0112091 3300048907 Bacteria 2616
396 Ga0501234_048326 3300049707 Bacteria 705
397 nmdc:mga05p37_456520_c1 3300050507 Bacteria 1477
398 nmdc:mga05p37_52843_c1 3300050507 Unclassified 4996
399 nmdc:mga05p37_717934_c1 3300050507 Bacteria 1107
400 nmdc:mga05p37_78354_c1 3300050507 Bacteria 4069
401 nmdc:mga09592_459974_c1 3300050508 Bacteria 1097
402 nmdc:mga08y16_695877_c1 3300050511 Unclassified 1017
403 nmdc:mga0n895_1139214_c1 3300050512 Bacteria 756
404 nmdc:mga0rr50_671_c1 3300050513 Bacteria 18316
405 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
406 nmdc:mga0a205_282919_c1 3300050515 Bacteria 1534
407 nmdc:mga0a205_283284_c1 3300050515 Bacteria 1533
408 Ga0495655_0176537 3300053083 Unclassified 686
409 Ga0500616_0000675 3300053153 Bacteria 40054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10090306 Ga0157372_100903063 166
2 3300025914 Ga0207671_10119782 Ga0207671_101197822 169
3 3300025981 Ga0207640_10640193 Ga0207640_106401932 170
4 3300005434 Ga0070709_10415421 Ga0070709_104154211 174
5 3300006914 Ga0075436_100000011 Ga0075436_100000011127 174
6 3300007076 Ga0075435_100000558 Ga0075435_10000055813 174
7 3300025906 Ga0207699_10352148 Ga0207699_103521482 174
8 3300006173 Ga0070716_100094982 Ga0070716_1000949822 175
9 3300050513 nmdc:mga0rr50_671_c1 nmdc:mga0rr50_671_c1_6743_7294 175
10 3300050514 nmdc:mga08x19_13_c1 nmdc:mga08x19_13_c1_131899_132450 175
11 3300039437 Ga0436365_1630108 Ga0436365_1630108_274_822 176
12 3300005445 Ga0070708_100463931 Ga0070708_1004639311 179
13 3300005467 Ga0070706_100007540 Ga0070706_1000075406 179
14 3300005985 Ga0081539_10001415 Ga0081539_1000141512 179
15 3300021384 Ga0213876_10000043 Ga0213876_1000004311 179
16 3300031731 Ga0307405_10445948 Ga0307405_104459482 179
17 3300039437 Ga0436365_0013216 Ga0436365_0013216_29639_30178 179
18 3300039437 Ga0436365_0421852 Ga0436365_0421852_9967_10506 179
19 3300005355 Ga0070671_100119831 Ga0070671_1001198312 180
20 3300005445 Ga0070708_100276793 Ga0070708_1002767932 181
21 3300005458 Ga0070681_10000041 Ga0070681_1000004127 181
22 3300005530 Ga0070679_100000074 Ga0070679_10000007470 181
23 3300005547 Ga0070693_100065285 Ga0070693_1000652852 181
24 3300005614 Ga0068856_100013250 Ga0068856_1000132509 181
25 3300009553 Ga0105249_10048500 Ga0105249_100485002 181
26 3300010375 Ga0105239_10221325 Ga0105239_102213252 181
27 3300025912 Ga0207707_10000077 Ga0207707_1000007735 181
28 3300025918 Ga0207662_10409882 Ga0207662_104098822 181
29 3300025921 Ga0207652_10000096 Ga0207652_1000009633 181
30 3300005289 Ga0065704_10580545 Ga0065704_105805451 182
31 3300005290 Ga0065712_10079165 Ga0065712_100791654 182
32 3300005290 Ga0065712_10155890 Ga0065712_101558902 182
33 3300005293 Ga0065715_10275224 Ga0065715_102752242 182
34 3300005293 Ga0065715_10317781 Ga0065715_103177812 182
35 3300005295 Ga0065707_10137944 Ga0065707_101379442 182
36 3300005329 Ga0070683_100716507 Ga0070683_1007165072 182
37 3300005330 Ga0070690_100004111 Ga0070690_1000041113 182
38 3300005330 Ga0070690_100007832 Ga0070690_1000078328 182
39 3300005330 Ga0070690_100236649 Ga0070690_1002366492 182
40 3300005331 Ga0070670_100139539 Ga0070670_1001395392 182
41 3300005331 Ga0070670_100196771 Ga0070670_1001967713 182
42 3300005331 Ga0070670_100413293 Ga0070670_1004132932 182
43 3300005331 Ga0070670_100460120 Ga0070670_1004601202 182
44 3300005334 Ga0068869_100020456 Ga0068869_1000204562 182
45 3300005334 Ga0068869_100021498 Ga0068869_1000214984 182
46 3300005334 Ga0068869_100044058 Ga0068869_1000440584 182
47 3300005334 Ga0068869_100156626 Ga0068869_1001566262 182
48 3300005334 Ga0068869_100552541 Ga0068869_1005525411 182
49 3300005335 Ga0070666_10086971 Ga0070666_100869713 182
50 3300005336 Ga0070680_100164390 Ga0070680_1001643902 182
51 3300005337 Ga0070682_100000068 Ga0070682_10000006871 182
52 3300005338 Ga0068868_100073919 Ga0068868_1000739192 182
53 3300005341 Ga0070691_10184688 Ga0070691_101846882 182
54 3300005343 Ga0070687_100075229 Ga0070687_1000752292 182
55 3300005343 Ga0070687_100205196 Ga0070687_1002051962 182
56 3300005345 Ga0070692_10092747 Ga0070692_100927472 182
57 3300005353 Ga0070669_100027277 Ga0070669_1000272774 182
58 3300005353 Ga0070669_100186930 Ga0070669_1001869303 182
59 3300005354 Ga0070675_100065933 Ga0070675_1000659332 182
60 3300005355 Ga0070671_100007324 Ga0070671_1000073243 182
61 3300005355 Ga0070671_100307112 Ga0070671_1003071122 182
62 3300005355 Ga0070671_100387571 Ga0070671_1003875712 182
63 3300005364 Ga0070673_100004290 Ga0070673_1000042909 182
64 3300005364 Ga0070673_100156953 Ga0070673_1001569532 182
65 3300005365 Ga0070688_100071892 Ga0070688_1000718923 182
66 3300005367 Ga0070667_100040802 Ga0070667_1000408022 182
67 3300005367 Ga0070667_100171797 Ga0070667_1001717972 182
68 3300005406 Ga0070703_10000145 Ga0070703_1000014539 182
69 3300005438 Ga0070701_10447497 Ga0070701_104474971 182
70 3300005440 Ga0070705_100106944 Ga0070705_1001069442 182
71 3300005440 Ga0070705_100221451 Ga0070705_1002214512 182
72 3300005440 Ga0070705_100535499 Ga0070705_1005354991 182
73 3300005440 Ga0070705_100645078 Ga0070705_1006450781 182
74 3300005441 Ga0070700_100020097 Ga0070700_1000200974 182
75 3300005441 Ga0070700_100033005 Ga0070700_1000330053 182
76 3300005441 Ga0070700_100330938 Ga0070700_1003309381 182
77 3300005444 Ga0070694_100032046 Ga0070694_1000320464 182
78 3300005444 Ga0070694_100068990 Ga0070694_1000689903 182
79 3300005444 Ga0070694_100165376 Ga0070694_1001653761 182
80 3300005444 Ga0070694_100847003 Ga0070694_1008470031 182
81 3300005445 Ga0070708_100000002 Ga0070708_100000002130 182
82 3300005445 Ga0070708_100048829 Ga0070708_1000488293 182
83 3300005445 Ga0070708_100176903 Ga0070708_1001769032 182
84 3300005445 Ga0070708_100235571 Ga0070708_1002355712 182
85 3300005445 Ga0070708_100332978 Ga0070708_1003329783 182
86 3300005456 Ga0070678_100281155 Ga0070678_1002811552 182
87 3300005457 Ga0070662_100135433 Ga0070662_1001354332 182
88 3300005459 Ga0068867_100030162 Ga0068867_1000301624 182
89 3300005459 Ga0068867_100390473 Ga0068867_1003904732 182
90 3300005466 Ga0070685_10106145 Ga0070685_101061452 182
91 3300005467 Ga0070706_100112381 Ga0070706_1001123813 182
92 3300005467 Ga0070706_100545410 Ga0070706_1005454102 182
93 3300005468 Ga0070707_100007291 Ga0070707_10000729110 182
94 3300005468 Ga0070707_100035995 Ga0070707_1000359951 182
95 3300005468 Ga0070707_100365499 Ga0070707_1003654992 182
96 3300005471 Ga0070698_100000916 Ga0070698_10000091620 182
97 3300005471 Ga0070698_100002314 Ga0070698_10000231414 182
98 3300005471 Ga0070698_100005272 Ga0070698_10000527211 182
99 3300005471 Ga0070698_100042628 Ga0070698_1000426281 182
100 3300005471 Ga0070698_100050816 Ga0070698_1000508165 182
101 3300005518 Ga0070699_100011662 Ga0070699_1000116628 182
102 3300005518 Ga0070699_100018154 Ga0070699_1000181548 182
103 3300005518 Ga0070699_100181603 Ga0070699_1001816032 182
104 3300005518 Ga0070699_100216615 Ga0070699_1002166153 182
105 3300005518 Ga0070699_100765068 Ga0070699_1007650681 182
106 3300005535 Ga0070684_100432092 Ga0070684_1004320922 182
107 3300005536 Ga0070697_100000071 Ga0070697_1000000713 182
108 3300005536 Ga0070697_100006651 Ga0070697_1000066513 182
109 3300005536 Ga0070697_100075319 Ga0070697_1000753192 182
110 3300005536 Ga0070697_100140368 Ga0070697_1001403682 182
111 3300005536 Ga0070697_100226171 Ga0070697_1002261711 182
112 3300005536 Ga0070697_100252461 Ga0070697_1002524612 182
113 3300005536 Ga0070697_100285516 Ga0070697_1002855161 182
114 3300005536 Ga0070697_100335471 Ga0070697_1003354712 182
115 3300005536 Ga0070697_100519618 Ga0070697_1005196181 182
116 3300005536 Ga0070697_100770114 Ga0070697_1007701142 182
117 3300005543 Ga0070672_100021978 Ga0070672_1000219783 182
118 3300005544 Ga0070686_100016818 Ga0070686_1000168184 182
119 3300005544 Ga0070686_100029631 Ga0070686_1000296313 182
120 3300005545 Ga0070695_100345395 Ga0070695_1003453951 182
121 3300005545 Ga0070695_100351848 Ga0070695_1003518481 182
122 3300005545 Ga0070695_100386449 Ga0070695_1003864491 182
123 3300005546 Ga0070696_100060790 Ga0070696_1000607903 182
124 3300005546 Ga0070696_100071249 Ga0070696_1000712492 182
125 3300005546 Ga0070696_100071466 Ga0070696_1000714663 182
126 3300005546 Ga0070696_100211509 Ga0070696_1002115092 182
127 3300005548 Ga0070665_100258414 Ga0070665_1002584142 182
128 3300005549 Ga0070704_100100443 Ga0070704_1001004432 182
129 3300005549 Ga0070704_100606208 Ga0070704_1006062082 182
130 3300005549 Ga0070704_100951420 Ga0070704_1009514201 182
131 3300005563 Ga0068855_101416440 Ga0068855_1014164402 182
132 3300005564 Ga0070664_100187820 Ga0070664_1001878202 182
133 3300005564 Ga0070664_100381354 Ga0070664_1003813541 182
134 3300005578 Ga0068854_100077785 Ga0068854_1000777852 182
135 3300005578 Ga0068854_100212375 Ga0068854_1002123752 182
136 3300005578 Ga0068854_100385877 Ga0068854_1003858772 182
137 3300005578 Ga0068854_100758493 Ga0068854_1007584931 182
138 3300005615 Ga0070702_100042787 Ga0070702_1000427872 182
139 3300005617 Ga0068859_100028077 Ga0068859_1000280772 182
140 3300005617 Ga0068859_100079642 Ga0068859_1000796424 182
141 3300005617 Ga0068859_100728523 Ga0068859_1007285232 182
142 3300005618 Ga0068864_100251425 Ga0068864_1002514252 182
143 3300005618 Ga0068864_100318356 Ga0068864_1003183562 182
144 3300005719 Ga0068861_100013999 Ga0068861_1000139996 182
145 3300005719 Ga0068861_100055690 Ga0068861_1000556904 182
146 3300005840 Ga0068870_10098560 Ga0068870_100985602 182
147 3300005841 Ga0068863_100028034 Ga0068863_1000280345 182
148 3300005841 Ga0068863_100478932 Ga0068863_1004789322 182
149 3300005841 Ga0068863_100636707 Ga0068863_1006367072 182
150 3300005841 Ga0068863_100831340 Ga0068863_1008313402 182
151 3300005842 Ga0068858_100045664 Ga0068858_1000456643 182
152 3300005842 Ga0068858_100084999 Ga0068858_1000849993 182
153 3300005842 Ga0068858_100361476 Ga0068858_1003614762 182
154 3300005843 Ga0068860_100006276 Ga0068860_10000627610 182
155 3300005843 Ga0068860_100107735 Ga0068860_1001077353 182
156 3300005843 Ga0068860_100117071 Ga0068860_1001170713 182
157 3300005843 Ga0068860_100379617 Ga0068860_1003796172 182
158 3300005844 Ga0068862_100290844 Ga0068862_1002908442 182
159 3300005844 Ga0068862_100367878 Ga0068862_1003678782 182
160 3300006163 Ga0070715_10000022 Ga0070715_1000002274 182
161 3300006173 Ga0070716_100000123 Ga0070716_10000012315 182
162 3300006237 Ga0097621_100011865 Ga0097621_1000118657 182
163 3300006237 Ga0097621_100022610 Ga0097621_1000226105 182
164 3300006358 Ga0068871_100010687 Ga0068871_1000106874 182
165 3300006358 Ga0068871_100022870 Ga0068871_1000228705 182
166 3300006358 Ga0068871_100373837 Ga0068871_1003738372 182
167 3300006847 Ga0075431_100522440 Ga0075431_1005224402 182
168 3300006852 Ga0075433_10002948 Ga0075433_1000294811 182
169 3300006871 Ga0075434_100828586 Ga0075434_1008285861 182
170 3300006880 Ga0075429_100109162 Ga0075429_1001091622 182
171 3300006880 Ga0075429_100631099 Ga0075429_1006310992 182
172 3300006931 Ga0097620_100028077 Ga0097620_1000280776 182
173 3300006931 Ga0097620_100079643 Ga0097620_1000796434 182
174 3300006931 Ga0097620_100728467 Ga0097620_1007284671 182
175 3300007265 Ga0099794_10218206 Ga0099794_102182062 182
176 3300009093 Ga0105240_11208479 Ga0105240_112084792 182
177 3300009094 Ga0111539_11757965 Ga0111539_117579651 182
178 3300009098 Ga0105245_10272219 Ga0105245_102722192 182
179 3300009098 Ga0105245_11334259 Ga0105245_113342592 182
180 3300009147 Ga0114129_10008181 Ga0114129_1000818111 182
181 3300009147 Ga0114129_10021892 Ga0114129_100218929 182
182 3300009147 Ga0114129_10080221 Ga0114129_100802215 182
183 3300009147 Ga0114129_10197743 Ga0114129_101977433 182
184 3300009147 Ga0114129_10636529 Ga0114129_106365292 182
185 3300009147 Ga0114129_11778120 Ga0114129_117781201 182
186 3300009148 Ga0105243_10232352 Ga0105243_102323522 182
187 3300009148 Ga0105243_10324199 Ga0105243_103241992 182
188 3300009174 Ga0105241_10211319 Ga0105241_102113191 182
189 3300009176 Ga0105242_10030109 Ga0105242_100301094 182
190 3300009176 Ga0105242_10121809 Ga0105242_101218092 182
191 3300009176 Ga0105242_10301414 Ga0105242_103014142 182
192 3300009177 Ga0105248_10008438 Ga0105248_100084387 182
193 3300009177 Ga0105248_10190085 Ga0105248_101900853 182
194 3300009177 Ga0105248_11208667 Ga0105248_112086672 182
195 3300009177 Ga0105248_11420404 Ga0105248_114204041 182
196 3300009545 Ga0105237_10063432 Ga0105237_100634323 182
197 3300009553 Ga0105249_10000142 Ga0105249_1000014225 182
198 3300009553 Ga0105249_12049162 Ga0105249_120491621 182
199 3300010375 Ga0105239_10291794 Ga0105239_102917942 182
200 3300011119 Ga0105246_10041384 Ga0105246_100413843 182
201 3300011119 Ga0105246_11098233 Ga0105246_110982331 182
202 3300013296 Ga0157374_10136566 Ga0157374_101365662 182
203 3300013296 Ga0157374_10233032 Ga0157374_102330322 182
204 3300013297 Ga0157378_10053534 Ga0157378_100535342 182
205 3300013297 Ga0157378_10095293 Ga0157378_100952931 182
206 3300013297 Ga0157378_10170491 Ga0157378_101704912 182
207 3300013297 Ga0157378_10242189 Ga0157378_102421892 182
208 3300013297 Ga0157378_10415353 Ga0157378_104153531 182
209 3300013297 Ga0157378_11984058 Ga0157378_119840581 182
210 3300013306 Ga0163162_10000553 Ga0163162_100005539 182
211 3300013306 Ga0163162_10006608 Ga0163162_100066089 182
212 3300013306 Ga0163162_10015662 Ga0163162_100156628 182
213 3300013306 Ga0163162_10041375 Ga0163162_100413755 182
214 3300013306 Ga0163162_10050405 Ga0163162_100504054 182
215 3300013308 Ga0157375_10068333 Ga0157375_100683332 182
216 3300013308 Ga0157375_10227599 Ga0157375_102275992 182
217 3300013308 Ga0157375_10605430 Ga0157375_106054302 182
218 3300013308 Ga0157375_10697456 Ga0157375_106974561 182
219 3300013308 Ga0157375_10774428 Ga0157375_107744282 182
220 3300013308 Ga0157375_10936268 Ga0157375_109362682 182
221 3300013308 Ga0157375_12514428 Ga0157375_125144281 182
222 3300014325 Ga0163163_10012830 Ga0163163_100128304 182
223 3300014325 Ga0163163_10033980 Ga0163163_100339802 182
224 3300014325 Ga0163163_10061428 Ga0163163_100614283 182
225 3300014325 Ga0163163_10110403 Ga0163163_101104033 182
226 3300014325 Ga0163163_10345002 Ga0163163_103450022 182
227 3300014325 Ga0163163_10749763 Ga0163163_107497632 182
228 3300014326 Ga0157380_10023479 Ga0157380_100234794 182
229 3300014326 Ga0157380_10029893 Ga0157380_100298932 182
230 3300014326 Ga0157380_10439751 Ga0157380_104397511 182
231 3300014326 Ga0157380_10679056 Ga0157380_106790562 182
232 3300014745 Ga0157377_10058432 Ga0157377_100584322 182
233 3300014968 Ga0157379_10244711 Ga0157379_102447112 182
234 3300014969 Ga0157376_10043828 Ga0157376_100438282 182
235 3300014969 Ga0157376_10138178 Ga0157376_101381782 182
236 3300017792 Ga0163161_10022277 Ga0163161_100222772 182
237 3300021384 Ga0213876_10049691 Ga0213876_100496913 182
238 3300025885 Ga0207653_10000008 Ga0207653_100000084 182
239 3300025901 Ga0207688_10059929 Ga0207688_100599291 182
240 3300025903 Ga0207680_10146344 Ga0207680_101463442 182
241 3300025905 Ga0207685_10000015 Ga0207685_1000001591 182
242 3300025907 Ga0207645_10056112 Ga0207645_100561123 182
243 3300025907 Ga0207645_10128991 Ga0207645_101289912 182
244 3300025910 Ga0207684_10030131 Ga0207684_100301312 182
245 3300025910 Ga0207684_10084792 Ga0207684_100847923 182
246 3300025910 Ga0207684_10126882 Ga0207684_101268822 182
247 3300025911 Ga0207654_10051495 Ga0207654_100514952 182
248 3300025917 Ga0207660_10253140 Ga0207660_102531402 182
249 3300025919 Ga0207657_10556000 Ga0207657_105560002 182
250 3300025922 Ga0207646_10011439 Ga0207646_100114394 182
251 3300025922 Ga0207646_10138770 Ga0207646_101387702 182
252 3300025922 Ga0207646_10706726 Ga0207646_107067262 182
253 3300025922 Ga0207646_10977675 Ga0207646_109776751 182
254 3300025923 Ga0207681_10017230 Ga0207681_100172303 182
255 3300025923 Ga0207681_10030405 Ga0207681_100304052 182
256 3300025923 Ga0207681_10534066 Ga0207681_105340662 182
257 3300025925 Ga0207650_10105231 Ga0207650_101052312 182
258 3300025925 Ga0207650_10393503 Ga0207650_103935032 182
259 3300025925 Ga0207650_10415294 Ga0207650_104152941 182
260 3300025926 Ga0207659_10856529 Ga0207659_108565292 182
261 3300025927 Ga0207687_10509362 Ga0207687_105093623 182
262 3300025931 Ga0207644_10010294 Ga0207644_100102947 182
263 3300025931 Ga0207644_10071763 Ga0207644_100717633 182
264 3300025934 Ga0207686_10068720 Ga0207686_100687202 182
265 3300025934 Ga0207686_10146977 Ga0207686_101469772 182
266 3300025934 Ga0207686_10191339 Ga0207686_101913392 182
267 3300025935 Ga0207709_10046386 Ga0207709_100463862 182
268 3300025935 Ga0207709_10182799 Ga0207709_101827992 182
269 3300025936 Ga0207670_10205935 Ga0207670_102059352 182
270 3300025936 Ga0207670_10398847 Ga0207670_103988472 182
271 3300025938 Ga0207704_10070767 Ga0207704_100707673 182
272 3300025939 Ga0207665_10000048 Ga0207665_1000004855 182
273 3300025940 Ga0207691_10001740 Ga0207691_1000174023 182
274 3300025940 Ga0207691_10472915 Ga0207691_104729152 182
275 3300025941 Ga0207711_10632015 Ga0207711_106320152 182
276 3300025942 Ga0207689_10005052 Ga0207689_100050524 182
277 3300025942 Ga0207689_10010994 Ga0207689_100109943 182
278 3300025942 Ga0207689_10056506 Ga0207689_100565064 182
279 3300025942 Ga0207689_10128587 Ga0207689_101285872 182
280 3300025945 Ga0207679_10021708 Ga0207679_100217085 182
281 3300025949 Ga0207667_10340563 Ga0207667_103405632 182
282 3300025960 Ga0207651_10003530 Ga0207651_100035306 182
283 3300025960 Ga0207651_10074282 Ga0207651_100742822 182
284 3300025960 Ga0207651_10136763 Ga0207651_101367633 182
285 3300025961 Ga0207712_10000106 Ga0207712_1000010610 182
286 3300025961 Ga0207712_10042221 Ga0207712_100422213 182
287 3300025961 Ga0207712_10146465 Ga0207712_101464653 182
288 3300025981 Ga0207640_10420306 Ga0207640_104203062 182
289 3300025986 Ga0207658_10159373 Ga0207658_101593732 182
290 3300025986 Ga0207658_10163121 Ga0207658_101631213 182
291 3300026023 Ga0207677_10084686 Ga0207677_100846862 182
292 3300026023 Ga0207677_10118870 Ga0207677_101188703 182
293 3300026035 Ga0207703_10035805 Ga0207703_100358053 182
294 3300026041 Ga0207639_10227631 Ga0207639_102276313 182
295 3300026075 Ga0207708_10060610 Ga0207708_100606102 182
296 3300026075 Ga0207708_10174756 Ga0207708_101747562 182
297 3300026075 Ga0207708_10263332 Ga0207708_102633322 182
298 3300026075 Ga0207708_10380758 Ga0207708_103807582 182
299 3300026078 Ga0207702_10022880 Ga0207702_100228805 182
300 3300026088 Ga0207641_10213052 Ga0207641_102130522 182
301 3300026088 Ga0207641_10419283 Ga0207641_104192832 182
302 3300026088 Ga0207641_10995312 Ga0207641_109953121 182
303 3300026089 Ga0207648_10023665 Ga0207648_100236655 182
304 3300026089 Ga0207648_10269713 Ga0207648_102697132 182
305 3300026095 Ga0207676_10023874 Ga0207676_100238742 182
306 3300026095 Ga0207676_10078360 Ga0207676_100783603 182
307 3300026095 Ga0207676_10094409 Ga0207676_100944092 182
308 3300026116 Ga0207674_10422033 Ga0207674_104220332 182
309 3300026118 Ga0207675_100005444 Ga0207675_1000054449 182
310 3300026118 Ga0207675_100642039 Ga0207675_1006420392 182
311 3300026118 Ga0207675_100984978 Ga0207675_1009849782 182
312 3300026121 Ga0207683_10246568 Ga0207683_102465682 182
313 3300028379 Ga0268266_10185622 Ga0268266_101856222 182
314 3300028380 Ga0268265_10043193 Ga0268265_100431933 182
315 3300028381 Ga0268264_10042957 Ga0268264_100429573 182
316 3300028381 Ga0268264_10058478 Ga0268264_100584783 182
317 3300028381 Ga0268264_10086944 Ga0268264_100869443 182
318 3300028381 Ga0268264_10401839 Ga0268264_104018392 182
319 3300031456 Ga0307513_10131146 Ga0307513_101311462 182
320 3300031456 Ga0307513_10159296 Ga0307513_101592961 182
321 3300031852 Ga0307410_10121313 Ga0307410_101213132 182
322 3300031901 Ga0307406_10251255 Ga0307406_102512551 182
323 3300032005 Ga0307411_10340840 Ga0307411_103408402 182
324 3300032126 Ga0307415_100945689 Ga0307415_1009456892 182
325 3300036401 Ga0373937_0046462 Ga0373937_0046462_2728_3279 182
326 3300037418 Ga0395900_0064836 Ga0395900_0064836_858_1409 182
327 3300037418 Ga0395900_0895936 Ga0395900_0895936_188_739 182
328 3300037471 Ga0395905_0299174 Ga0395905_0299174_415_966 182
329 3300038443 Ga0395901_1093291 Ga0395901_1093291_147_698 182
330 3300039437 Ga0436365_1223237 Ga0436365_1223237_4684_5235 182
331 3300039453 Ga0436362_0696948 Ga0436362_0696948_907_1458 182
332 3300042015 Ga0439462_0122746 Ga0439462_0122746_116_667 182
333 3300042435 Ga0439434_0030665 Ga0439434_0030665_79_630 182
334 3300045051 Ga0451576_0546701 Ga0451576_0546701_655_1206 182
335 3300045051 Ga0451576_1366041 Ga0451576_1366041_57_611 182
336 3300045051 Ga0451576_1870788 Ga0451576_1870788_30_581 182
337 3300046525 Ga0495663_0000433 Ga0495663_0000433_8302_8856 182
338 3300046537 Ga0495598_0048939 Ga0495598_0048939_569_1174 182
339 3300046539 Ga0495621_0004254 Ga0495621_0004254_1198_1749 182
340 3300046539 Ga0495621_0093799 Ga0495621_0093799_523_1077 182
341 3300047318 Ga0495636_0048166 Ga0495636_0048166_500_1054 182
342 3300048907 Ga0496104_0112091 Ga0496104_0112091_625_1176 182
343 3300049707 Ga0501234_048326 Ga0501234_048326_17_607 182
344 3300050507 nmdc:mga05p37_456520_c1 nmdc:mga05p37_456520_c1_785_1336 182
345 3300050507 nmdc:mga05p37_52843_c1 nmdc:mga05p37_52843_c1_2111_2662 182
346 3300050507 nmdc:mga05p37_717934_c1 nmdc:mga05p37_717934_c1_400_951 182
347 3300050507 nmdc:mga05p37_78354_c1 nmdc:mga05p37_78354_c1_778_1326 182
348 3300050508 nmdc:mga09592_459974_c1 nmdc:mga09592_459974_c1_22_573 182
349 3300050512 nmdc:mga0n895_1139214_c1 nmdc:mga0n895_1139214_c1_51_602 182
350 3300050515 nmdc:mga0a205_282919_c1 nmdc:mga0a205_282919_c1_288_839 182
351 3300050515 nmdc:mga0a205_283284_c1 nmdc:mga0a205_283284_c1_855_1406 182
352 3300053153 Ga0500616_0000675 Ga0500616_0000675_4234_4788 182
353 3300009176 Ga0105242_10009157 Ga0105242_100091574 183
354 3300009176 Ga0105242_10833089 Ga0105242_108330891 183
355 3300009177 Ga0105248_10694571 Ga0105248_106945712 183
356 3300013308 Ga0157375_11535392 Ga0157375_115353921 183
357 3300025934 Ga0207686_10000449 Ga0207686_1000044910 183
358 3300026023 Ga0207677_10301905 Ga0207677_103019052 183
359 3300045051 Ga0451576_0251625 Ga0451576_0251625_524_1075 183
360 3300046517 Ga0495630_0575652 Ga0495630_0575652_20_613 183
361 3300046689 Ga0495613_0182936 Ga0495613_0182936_422_982 183
362 3300047471 Ga0495684_0214374 Ga0495684_0214374_261_854 183
363 3300005330 Ga0070690_100042343 Ga0070690_1000423433 185
364 3300005444 Ga0070694_100211886 Ga0070694_1002118862 185
365 3300005544 Ga0070686_100105706 Ga0070686_1001057061 185
366 3300013297 Ga0157378_10097277 Ga0157378_100972774 185
367 2162886012 MBSR1b_contig_14395186 MBSR1b_0311.00005320 186
368 2162886012 MBSR1b_contig_356884 MBSR1b_0432.00005080 186
369 2162886012 MBSR1b_contig_8674724 MBSR1b_0526.00002440 186
370 3300005328 Ga0070676_10242019 Ga0070676_102420192 186
371 3300005330 Ga0070690_100001424 Ga0070690_1000014248 186
372 3300005343 Ga0070687_100076671 Ga0070687_1000766712 186
373 3300005345 Ga0070692_10011735 Ga0070692_100117353 186
374 3300005345 Ga0070692_10181282 Ga0070692_101812822 186
375 3300005353 Ga0070669_100002485 Ga0070669_1000024859 186
376 3300005364 Ga0070673_100069418 Ga0070673_1000694183 186
377 3300005441 Ga0070700_100183732 Ga0070700_1001837322 186
378 3300005467 Ga0070706_100749646 Ga0070706_1007496462 186
379 3300005543 Ga0070672_100032540 Ga0070672_1000325404 186
380 3300005544 Ga0070686_100005759 Ga0070686_1000057595 186
381 3300005578 Ga0068854_100147850 Ga0068854_1001478502 186
382 3300005718 Ga0068866_10261723 Ga0068866_102617232 186
383 3300005719 Ga0068861_100249459 Ga0068861_1002494592 186
384 3300005843 Ga0068860_100115075 Ga0068860_1001150752 186
385 3300005843 Ga0068860_100379420 Ga0068860_1003794202 186
386 3300005844 Ga0068862_100032058 Ga0068862_1000320583 186
387 3300009094 Ga0111539_10520216 Ga0111539_105202162 186
388 3300009098 Ga0105245_10456559 Ga0105245_104565592 186
389 3300009176 Ga0105242_10477536 Ga0105242_104775362 186
390 3300009553 Ga0105249_10024441 Ga0105249_100244413 186
391 3300013306 Ga0163162_10114428 Ga0163162_101144283 186
392 3300013308 Ga0157375_10466303 Ga0157375_104663031 186
393 3300014326 Ga0157380_10115305 Ga0157380_101153052 186
394 3300014326 Ga0157380_10160816 Ga0157380_101608162 186
395 3300017792 Ga0163161_10087218 Ga0163161_100872182 186
396 3300025918 Ga0207662_10027550 Ga0207662_100275503 186
397 3300025923 Ga0207681_10040427 Ga0207681_100404273 186
398 3300025938 Ga0207704_10214614 Ga0207704_102146142 186
399 3300025941 Ga0207711_10156941 Ga0207711_101569412 186
400 3300025961 Ga0207712_10013267 Ga0207712_100132673 186
401 3300025981 Ga0207640_10039822 Ga0207640_100398223 186
402 3300026023 Ga0207677_10204204 Ga0207677_102042042 186
403 3300026075 Ga0207708_10260590 Ga0207708_102605902 186
404 3300026089 Ga0207648_10401550 Ga0207648_104015502 186
405 3300026118 Ga0207675_100127388 Ga0207675_1001273883 186
406 3300028380 Ga0268265_10003630 Ga0268265_100036304 186
407 3300028381 Ga0268264_10291641 Ga0268264_102916412 186
408 3300050511 nmdc:mga08y16_695877_c1 nmdc:mga08y16_695877_c1_284_844 186
409 3300053083 Ga0495655_0176537 Ga0495655_0176537_16_603 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

68

192

0.89

PF18306

LDcluster4

SLOG cluster4 family

24

189

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wek-assembly1.cif.gz_B crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9495 5 174
5zi9-assembly1.cif.gz_A crystal structure of type-ii log from streptomyces coelicolor a3 0.9491 3 176
5zi9-assembly1.cif.gz_B crystal structure of type-ii log from streptomyces coelicolor a3 0.9437 3 176
5wq3-assembly1.cif.gz_C-3 crystal structure of type-ii log from corynebacterium glutamicum 0.9372 3 179
1wek-assembly1.cif.gz_F crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9266 5 175
ID Description Score Start End Superfamily
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9214 3 179 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9157 5 175 3.40.50.450
af_A4IB94_6_208_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9052 5 179 3.40.50.450
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9017 6 174 3.40.50.450
3sbxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9003 5 172 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A059X262-F1-model_v4 Putative lysine decarboxylase 0.9937 44 181 GO:0005829
AF-A0A059WYV7-F1-model_v4 Putative lysine decarboxylase 0.9909 11 176 GO:0005829
AF-A0A7W0JIZ7-F1-model_v4 LOG family protein 0.9865 2 136 GO:0005829
AF-A0A2V8MHB6-F1-model_v4 LOG family protein 0.9834 2 183 GO:0005829
AF-A0A059X262-F1-model_v4 Putative lysine decarboxylase 0.9795 44 181 GO:0005829

Feature Viewer

pLDDT pTM Quality
90.18 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map