F437040

General Info

Members Datasets Scaffolds Average Seq Length
409 184 818 207

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0110959|Ga0395899_0110959_1019_1687
Length 222
Sequence MVAVISSRSGWYKPNAVDLVDPRIEDYAERLTSPHEELLAELSAATVAELGHSSMLTGPVAGRLLELLVWSARPRRVLEIGTFSGHSALAMAAALPEGGRLDACELSPERAAFAQSWFDRSPHGSKITLHVGPALETVRGLEGDFDFVFVDADKGGYVDYYEAVLPRLSERGLIVADNTLASGEVLDGSAAVVRFNEHVAADPRSVQVLLSVRDGMTLIRHA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.56
Metatranscriptomes 2.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 10.76
Rhizosphere 88.26
Stem 0
Stem Tuber 0
Unclassified 6.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0110959 3300037312 Bacteria 1972
2 Ga0070658_10111997 3300005327 Bacteria 2262
3 Ga0070658_10122717 3300005327 Bacteria 2160
4 Ga0070658_10213799 3300005327 Bacteria 1629
5 Ga0070658_10409281 3300005327 Bacteria 1165
6 Ga0070658_10416894 3300005327 Bacteria 1154
7 Ga0070683_100030983 3300005329 Bacteria 4859
8 Ga0070683_100079871 3300005329 Bacteria 3061
9 Ga0070683_100231945 3300005329 Bacteria 1755
10 Ga0070670_100769699 3300005331 Bacteria 868
11 Ga0070680_100039266 3300005336 Bacteria 3831
12 Ga0070680_100270153 3300005336 Bacteria 1439
13 Ga0070680_100270944 3300005336 Bacteria 1437
14 Ga0070680_100327865 3300005336 Bacteria 1300
15 Ga0070682_100043156 3300005337 Bacteria 2787
16 Ga0070660_100001080 3300005339 Bacteria 18313
17 Ga0070660_100022868 3300005339 Bacteria 4628
18 Ga0070660_100024822 3300005339 Bacteria 4451
19 Ga0070660_100221363 3300005339 Bacteria 1538
20 Ga0070660_100473522 3300005339 Bacteria 1040
21 Ga0070691_10489350 3300005341 Bacteria 709
22 Ga0070661_100154762 3300005344 Bacteria 1734
23 Ga0070671_100005697 3300005355 Bacteria 9923
24 Ga0070674_100188137 3300005356 Unclassified 1586
25 Ga0070659_100230741 3300005366 Bacteria 1530
26 Ga0070659_100415850 3300005366 Bacteria 1136
27 Ga0070713_100700489 3300005436 Bacteria 967
28 Ga0070713_101016228 3300005436 Bacteria 800
29 Ga0070710_10470804 3300005437 Bacteria 855
30 Ga0070678_100057550 3300005456 Bacteria 2849
31 Ga0070681_10007094 3300005458 Bacteria 10909
32 Ga0070681_10031343 3300005458 Bacteria 5337
33 Ga0070681_10079880 3300005458 Bacteria 3227
34 Ga0070681_10137001 3300005458 Bacteria 2378
35 Ga0070681_10319777 3300005458 Bacteria 1461
36 Ga0070681_10568476 3300005458 Bacteria 1047
37 Ga0070706_100394743 3300005467 Bacteria 1288
38 Ga0070699_100475528 3300005518 Bacteria 1134
39 Ga0070679_100007403 3300005530 Bacteria 10259
40 Ga0070679_100157921 3300005530 Bacteria 2242
41 Ga0070679_100159493 3300005530 Bacteria 2230
42 Ga0070679_100472237 3300005530 Bacteria 1198
43 Ga0070679_100654274 3300005530 Bacteria 993
44 Ga0070684_100006199 3300005535 Bacteria 9227
45 Ga0070684_100102143 3300005535 Bacteria 2563
46 Ga0070684_100216585 3300005535 Bacteria 1746
47 Ga0070684_100279382 3300005535 Bacteria 1530
48 Ga0070684_100416399 3300005535 Unclassified 1240
49 Ga0068853_100034586 3300005539 Bacteria 4290
50 Ga0068853_100417518 3300005539 Bacteria 1258
51 Ga0068853_101040323 3300005539 Bacteria 789
52 Ga0070693_100090758 3300005547 Bacteria 1841
53 Ga0068855_100027550 3300005563 Bacteria 6796
54 Ga0068855_100070917 3300005563 Bacteria 4052
55 Ga0068855_100114810 3300005563 Bacteria 3087
56 Ga0068855_100190694 3300005563 Bacteria 2312
57 Ga0068855_100291716 3300005563 Bacteria 1808
58 Ga0068855_100955446 3300005563 Bacteria 902
59 Ga0068857_100052415 3300005577 Bacteria 3620
60 Ga0068857_100642123 3300005577 Bacteria 1005
61 Ga0068856_100027104 3300005614 Bacteria 5589
62 Ga0068856_100539513 3300005614 Bacteria 1188
63 Ga0068852_100610303 3300005616 Bacteria 1096
64 Ga0070717_10371141 3300006028 Bacteria 1282
65 Ga0070717_10578586 3300006028 Bacteria 1018
66 Ga0070715_10231435 3300006163 Bacteria 956
67 Ga0070712_100013496 3300006175 Bacteria 5223
68 Ga0097621_100531811 3300006237 Unclassified 1068
69 Ga0097621_100665062 3300006237 Bacteria 957
70 Ga0075428_100145408 3300006844 Bacteria 2577
71 Ga0075430_100022739 3300006846 Bacteria 5332
72 Ga0075434_100323334 3300006871 Bacteria 1563
73 Ga0075435_100000425 3300007076 Bacteria 25950
74 Ga0105240_10028411 3300009093 Bacteria 7306
75 Ga0105240_10446418 3300009093 Bacteria 1448
76 Ga0105240_10493159 3300009093 Bacteria 1363
77 Ga0105245_10437706 3300009098 Bacteria 1313
78 Ga0105237_10104446 3300009545 Bacteria 2825
79 Ga0105237_10847422 3300009545 Bacteria 921
80 Ga0105238_10152330 3300009551 Bacteria 2287
81 Ga0105239_10352272 3300010375 Bacteria 1662
82 Ga0105239_10617266 3300010375 Bacteria 1237
83 Ga0105239_11280759 3300010375 Bacteria 845
84 Ga0157373_10140206 3300013100 Bacteria 1700
85 Ga0157370_10028969 3300013104 Bacteria 5441
86 Ga0157370_10031810 3300013104 Bacteria 5158
87 Ga0157370_10041516 3300013104 Bacteria 4437
88 Ga0157370_10367540 3300013104 Bacteria 1325
89 Ga0157369_10001951 3300013105 Bacteria 24849
90 Ga0157369_10493157 3300013105 Unclassified 1267
91 Ga0157374_10587235 3300013296 Unclassified 1123
92 Ga0157378_10061002 3300013297 Bacteria 3365
93 Ga0157372_10107634 3300013307 Bacteria 3190
94 Ga0157372_10474669 3300013307 Bacteria 1458
95 Ga0157372_10485864 3300013307 Bacteria 1440
96 Ga0157375_10792575 3300013308 Bacteria 1097
97 Ga0157380_11475055 3300014326 Unclassified 733
98 Ga0157376_10068360 3300014969 Bacteria 3008
99 Ga0157376_10634139 3300014969 Unclassified 1067
100 Ga0182007_10050917 3300015262 Unclassified 1367
101 Ga0197907_11125714 3300020069 Bacteria 3162
102 Ga0197907_11203654 3300020069 Unclassified 817
103 Ga0197907_11237417 3300020069 Bacteria 920
104 Ga0206356_10611072 3300020070 Bacteria 1664
105 Ga0206354_10902424 3300020081 Bacteria 3296
106 Ga0206354_11344860 3300020081 Bacteria 2334
107 Ga0206353_10057273 3300020082 Bacteria 706
108 Ga0206353_10195264 3300020082 Unclassified 1463
109 Ga0206353_10509488 3300020082 Bacteria 3874
110 Ga0206353_11012385 3300020082 Bacteria 2079
111 Ga0207705_10025832 3300025909 Bacteria 4191
112 Ga0207705_10284715 3300025909 Bacteria 1266
113 Ga0207705_10306755 3300025909 Bacteria 1218
114 Ga0207707_10073750 3300025912 Bacteria 2976
115 Ga0207707_10544043 3300025912 Bacteria 987
116 Ga0207707_10592063 3300025912 Bacteria 939
117 Ga0207671_10243901 3300025914 Unclassified 1412
118 Ga0207693_10035715 3300025915 Bacteria 3918
119 Ga0207693_10251051 3300025915 Bacteria 1388
120 Ga0207663_10102177 3300025916 Bacteria 1928
121 Ga0207660_10007676 3300025917 Bacteria 6987
122 Ga0207660_10126180 3300025917 Bacteria 1943
123 Ga0207660_10482124 3300025917 Bacteria 1005
124 Ga0207657_10002431 3300025919 Bacteria 20110
125 Ga0207657_10006259 3300025919 Bacteria 12372
126 Ga0207657_10012680 3300025919 Bacteria 8307
127 Ga0207657_10047667 3300025919 Bacteria 3745
128 Ga0207657_10163158 3300025919 Bacteria 1809
129 Ga0207657_10388766 3300025919 Bacteria 1098
130 Ga0207649_10016140 3300025920 Bacteria 4207
131 Ga0207649_10065101 3300025920 Bacteria 2307
132 Ga0207649_10483664 3300025920 Bacteria 939
133 Ga0207652_10190925 3300025921 Bacteria 1842
134 Ga0207652_10216555 3300025921 Bacteria 1725
135 Ga0207652_10223344 3300025921 Bacteria 1697
136 Ga0207652_10230696 3300025921 Bacteria 1668
137 Ga0207652_10369010 3300025921 Bacteria 1296
138 Ga0207652_10591805 3300025921 Bacteria 995
139 Ga0207652_10655811 3300025921 Bacteria 938
140 Ga0207690_10425480 3300025932 Bacteria 1063
141 Ga0207686_10049254 3300025934 Bacteria 2614
142 Ga0207665_10185391 3300025939 Bacteria 1509
143 Ga0207661_10277154 3300025944 Bacteria 1498
144 Ga0207661_10362877 3300025944 Bacteria 1309
145 Ga0207667_10065155 3300025949 Bacteria 3801
146 Ga0207667_10076002 3300025949 Bacteria 3486
147 Ga0207667_10418060 3300025949 Bacteria 1364
148 Ga0207639_10408333 3300026041 Bacteria 1225
149 Ga0207639_10664504 3300026041 Bacteria 965
150 Ga0207678_10069369 3300026067 Bacteria 3022
151 Ga0207702_10069699 3300026078 Bacteria 3024
152 Ga0207674_10008299 3300026116 Bacteria 12023
153 Ga0207674_10665696 3300026116 Bacteria 1005
154 Ga0207698_10393708 3300026142 Bacteria 1322
155 Ga0265336_10047104 3300028666 Bacteria 1309
156 Ga0265338_10002043 3300028800 Bacteria 31202
157 Ga0265338_10044861 3300028800 Bacteria 4073
158 Ga0265325_10095466 3300031241 Bacteria 1461
159 Ga0265340_10173428 3300031247 Unclassified 976
160 Ga0265327_10016971 3300031251 Bacteria 4591
161 Ga0265327_10031682 3300031251 Bacteria 2967
162 Ga0265316_10012066 3300031344 Bacteria 7764
163 Ga0265314_10018779 3300031711 Bacteria 5374
164 Ga0316583_10042213 3300032133 Bacteria 1613
165 Ga0373944_0002287 3300035089 Bacteria 4872
166 Ga0373936_0078978 3300035113 Bacteria 1367
167 Ga0373945_0015311 3300035116 Bacteria 2578
168 Ga0373956_0070353 3300035119 Unclassified 1596
169 Ga0373943_0002743 3300035170 Bacteria 8011
170 Ga0373946_0018212 3300035171 Bacteria 2694
171 Ga0373955_0008672 3300035172 Bacteria 4732
172 Ga0373935_0026133 3300035692 Bacteria 3600
173 Ga0373935_0120342 3300035692 Bacteria 1753
174 Ga0373927_0038357 3300035695 Bacteria 3111
175 Ga0373933_0154089 3300035724 Bacteria 1457
176 Ga0373947_0000222 3300035725 Bacteria 31904
177 Ga0373947_0057356 3300035725 Bacteria 2356
178 Ga0373937_0000989 3300036401 Bacteria 24140
179 Ga0373937_0272049 3300036401 Bacteria 1599
180 Ga0373925_0008681 3300037068 Bacteria 7402
181 Ga0373925_0235799 3300037068 Bacteria 1464
182 Ga0395899_0058729 3300037312 Bacteria 2837
183 Ga0395899_0075485 3300037312 Bacteria 2461
184 Ga0395899_0269360 3300037312 Bacteria 1162
185 Ga0395900_0145449 3300037418 Bacteria 2424
186 Ga0395900_0734359 3300037418 Unclassified 919
187 Ga0395898_0008439 3300037466 Bacteria 10889
188 Ga0395898_0073696 3300037466 Bacteria 3298
189 Ga0395898_0090264 3300037466 Bacteria 2948
190 Ga0395898_0125891 3300037466 Bacteria 2455
191 Ga0395898_0192947 3300037466 Bacteria 1946
192 Ga0395905_0778753 3300037471 Bacteria 859
193 Ga0436364_0573647 3300037853 Bacteria 947
194 Ga0395901_0002091 3300038443 Bacteria 20489
195 Ga0395901_0003265 3300038443 Bacteria 16325
196 Ga0395901_0025507 3300038443 Bacteria 6069
197 Ga0395901_0312392 3300038443 Bacteria 1627
198 Ga0395901_0979735 3300038443 Bacteria 823
199 Ga0451853_2376429 3300041512 Bacteria 899
200 Ga0466966_0022518 3300044684 Bacteria 4133
201 Ga0466966_0078182 3300044684 Bacteria 2064
202 Ga0466961_0014319 3300044693 Bacteria 5091
203 Ga0466961_0020957 3300044693 Bacteria 4205
204 Ga0466963_0001799 3300044694 Bacteria 11666
205 Ga0466963_0003969 3300044694 Bacteria 8558
206 Ga0466963_0011306 3300044694 Bacteria 5431
207 Ga0466963_0056444 3300044694 Bacteria 2613
208 Ga0466963_0317288 3300044694 Bacteria 1096
209 Ga0466964_0000187 3300044706 Bacteria 17135
210 Ga0466964_0013002 3300044706 Bacteria 3153
211 Ga0466964_0069674 3300044706 Bacteria 1484
212 Ga0466964_0243646 3300044706 Bacteria 883
213 Ga0466971_0002136 3300044719 Bacteria 8374
214 Ga0466971_0049442 3300044719 Bacteria 1892
215 Ga0466971_0176230 3300044719 Bacteria 1004
216 Ga0466968_0003877 3300044735 Bacteria 5553
217 Ga0466968_0215697 3300044735 Unclassified 903
218 Ga0466957_0001589 3300044842 Bacteria 11934
219 Ga0466957_0014289 3300044842 Bacteria 4622
220 Ga0466957_0131296 3300044842 Bacteria 1605
221 Ga0466957_0150710 3300044842 Bacteria 1504
222 Ga0466957_0200936 3300044842 Bacteria 1309
223 Ga0466960_0041793 3300044901 Bacteria 2173
224 Ga0466959_0064948 3300045049 Bacteria 2649
225 Ga0466959_0069562 3300045049 Bacteria 2550
226 Ga0466959_0326606 3300045049 Bacteria 1048
227 Ga0466958_0001586 3300045836 Bacteria 10913
228 Ga0466958_0113503 3300045836 Bacteria 1692
229 Ga0466967_0000244 3300045976 Bacteria 23876
230 Ga0466967_0005446 3300045976 Bacteria 8825
231 Ga0466967_0007228 3300045976 Bacteria 7980
232 Ga0466967_0012355 3300045976 Bacteria 6527
233 Ga0466967_0017445 3300045976 Bacteria 5700
234 Ga0466967_0022522 3300045976 Bacteria 5143
235 Ga0466967_0035274 3300045976 Bacteria 4255
236 Ga0466967_0056893 3300045976 Bacteria 3450
237 Ga0466967_0088062 3300045976 Bacteria 2816
238 Ga0466967_0092630 3300045976 Bacteria 2748
239 Ga0466967_0274392 3300045976 Bacteria 1616
240 Ga0466967_0331004 3300045976 Bacteria 1471
241 Ga0466967_0360656 3300045976 Bacteria 1408
242 Ga0466967_0519129 3300045976 Bacteria 1170
243 Ga0466967_0763113 3300045976 Bacteria 959
244 Ga0495592_0000368 3300046454 Bacteria 35552
245 Ga0495592_0098964 3300046454 Bacteria 2081
246 Ga0495592_0279325 3300046454 Bacteria 1093
247 Ga0495603_0192801 3300046455 Bacteria 1178
248 Ga0495629_0000214 3300046459 Bacteria 52123
249 Ga0495629_0033925 3300046459 Bacteria 3609
250 Ga0495641_0000795 3300046461 Bacteria 26778
251 Ga0495651_0001115 3300046462 Bacteria 20765
252 Ga0495651_0059692 3300046462 Bacteria 2924
253 Ga0495651_0459454 3300046462 Unclassified 821
254 Ga0495653_0006467 3300046463 Bacteria 9609
255 Ga0495653_0032443 3300046463 Bacteria 4146
256 Ga0495653_0060399 3300046463 Bacteria 2872
257 Ga0495653_0229967 3300046463 Bacteria 1241
258 Ga0495582_0003147 3300046473 Bacteria 9259
259 Ga0495582_0127826 3300046473 Bacteria 1435
260 Ga0495639_0001167 3300046475 Bacteria 11875
261 Ga0495662_0009670 3300046476 Bacteria 4728
262 Ga0495664_0052255 3300046477 Bacteria 2428
263 Ga0495664_0090775 3300046477 Bacteria 1837
264 Ga0495608_0021247 3300046511 Bacteria 4455
265 Ga0495608_0027090 3300046511 Bacteria 3902
266 Ga0495608_0043599 3300046511 Bacteria 2997
267 Ga0495608_0343725 3300046511 Bacteria 919
268 Ga0495608_0380848 3300046511 Bacteria 865
269 Ga0495618_0019680 3300046514 Bacteria 4154
270 Ga0495628_0000650 3300046516 Bacteria 31811
271 Ga0495628_0046267 3300046516 Bacteria 3456
272 Ga0495628_0235297 3300046516 Bacteria 1372
273 Ga0495630_0004324 3300046517 Bacteria 9965
274 Ga0495630_0008144 3300046517 Bacteria 7529
275 Ga0495630_0839658 3300046517 Bacteria 701
276 Ga0495666_0015412 3300046526 Bacteria 3806
277 Ga0495652_0006220 3300046529 Bacteria 11132
278 Ga0495652_0053532 3300046529 Bacteria 3439
279 Ga0495652_0217915 3300046529 Bacteria 1436
280 Ga0495652_0255763 3300046529 Bacteria 1295
281 Ga0495665_0001846 3300046531 Bacteria 11445
282 Ga0495665_0268446 3300046531 Unclassified 877
283 Ga0495640_0019540 3300046533 Bacteria 4998
284 Ga0495640_0043470 3300046533 Bacteria 3128
285 Ga0495640_0140897 3300046533 Bacteria 1554
286 Ga0495587_0000469 3300046536 Bacteria 27940
287 Ga0495587_0009850 3300046536 Bacteria 6103
288 Ga0495645_0000456 3300046543 Bacteria 28144
289 Ga0495645_0185653 3300046543 Bacteria 1421
290 Ga0495667_0031766 3300046559 Bacteria 3541
291 Ga0495667_0038337 3300046559 Bacteria 3191
292 Ga0495667_0149081 3300046559 Unclassified 1506
293 Ga0495656_0189039 3300046615 Bacteria 1016
294 Ga0495634_0104555 3300046642 Bacteria 1826
295 Ga0495635_0080684 3300046663 Bacteria 2226
296 Ga0495635_0178999 3300046663 Bacteria 1441
297 Ga0495588_0295107 3300046674 Unclassified 854
298 Ga0495657_0019036 3300046675 Bacteria 4960
299 Ga0495657_0023596 3300046675 Bacteria 4393
300 Ga0495599_0000660 3300046678 Bacteria 19504
301 Ga0495623_0000123 3300046679 Bacteria 47116
302 Ga0495646_0001321 3300046680 Bacteria 14651
303 Ga0495646_0249903 3300046680 Bacteria 950
304 Ga0495647_0005497 3300046681 Bacteria 4152
305 Ga0495658_0000138 3300046683 Bacteria 40395
306 Ga0495613_0007232 3300046689 Bacteria 8265
307 Ga0495613_0128325 3300046689 Bacteria 1817
308 Ga0495624_0009211 3300046690 Bacteria 6841
309 Ga0495624_0273283 3300046690 Unclassified 1021
310 Ga0495581_0000807 3300047315 Bacteria 16642
311 Ga0495604_0001520 3300047317 Bacteria 19087
312 Ga0495674_0040524 3300047319 Bacteria 4166
313 Ga0495674_0042206 3300047319 Bacteria 4070
314 Ga0495674_0086743 3300047319 Bacteria 2679
315 Ga0495674_0302549 3300047319 Unclassified 1306
316 Ga0495676_0005351 3300047321 Bacteria 11755
317 Ga0495676_0140543 3300047321 Bacteria 1731
318 Ga0495676_0168580 3300047321 Bacteria 1543
319 Ga0495676_0322154 3300047321 Bacteria 1038
320 Ga0495676_0423057 3300047321 Archaea 881
321 Ga0495680_0000502 3300047322 Bacteria 44236
322 Ga0495680_0006055 3300047322 Bacteria 11307
323 Ga0495680_0010551 3300047322 Bacteria 8243
324 Ga0495680_0013016 3300047322 Bacteria 7278
325 Ga0495680_0052279 3300047322 Bacteria 3185
326 Ga0495680_0129619 3300047322 Bacteria 1855
327 Ga0495675_0001583 3300047444 Bacteria 13729
328 Ga0495675_0004653 3300047444 Bacteria 8337
329 Ga0495675_0081938 3300047444 Bacteria 2032
330 Ga0495684_0014988 3300047471 Bacteria 5970
331 Ga0495684_0272002 3300047471 Bacteria 1225
332 Ga0495593_0014056 3300047673 Bacteria 4557
333 Ga0495602_0011825 3300048088 Bacteria 9011
334 Ga0495602_0015411 3300048088 Bacteria 7716
335 Ga0495614_0015437 3300048089 Bacteria 3329
336 Ga0496100_0013634 3300048903 Bacteria 4695
337 Ga0496100_0032424 3300048903 Bacteria 3258
338 Ga0496100_0213195 3300048903 Bacteria 1413
339 Ga0496101_0007692 3300048904 Bacteria 7001
340 Ga0496101_0017717 3300048904 Bacteria 4831
341 Ga0496101_0050365 3300048904 Bacteria 2997
342 Ga0496101_0118889 3300048904 Bacteria 1996
343 Ga0496102_0011159 3300048905 Bacteria 7737
344 Ga0496102_0893932 3300048905 Bacteria 810
345 Ga0496104_0008579 3300048907 Bacteria 9091
346 Ga0496104_0008920 3300048907 Bacteria 8911
347 Ga0496104_0213778 3300048907 Bacteria 1840
348 Ga0496104_0414156 3300048907 Bacteria 1260
349 Ga0496105_0008156 3300048908 Bacteria 8141
350 Ga0496105_0021250 3300048908 Bacteria 5252
351 Ga0496105_0132078 3300048908 Bacteria 2058
352 Ga0496105_0409597 3300048908 Bacteria 1075
353 Ga0496106_0008219 3300048909 Bacteria 7715
354 Ga0496106_0067911 3300048909 Bacteria 2718
355 Ga0496107_0019343 3300048910 Bacteria 4805
356 Ga0496107_0021500 3300048910 Bacteria 4560
357 Ga0496107_0122676 3300048910 Bacteria 1914
358 Ga0496108_0395604 3300048911 Unclassified 1207
359 Ga0496109_0022226 3300048912 Bacteria 5616
360 Ga0496109_0042561 3300048912 Bacteria 4114
361 Ga0496110_0047116 3300048913 Bacteria 3773
362 Ga0496110_0128655 3300048913 Bacteria 2286
363 Ga0496111_0010692 3300048914 Bacteria 6174
364 Ga0496111_0134326 3300048914 Bacteria 1832
365 Ga0496112_0018429 3300048915 Bacteria 6573
366 Ga0496112_0031919 3300048915 Bacteria 5111
367 Ga0496112_0089601 3300048915 Bacteria 3044
368 Ga0496112_0157749 3300048915 Bacteria 2236
369 Ga0496112_0331558 3300048915 Bacteria 1465
370 Ga0496113_0104395 3300048916 Bacteria 2199
371 Ga0496113_0223030 3300048916 Bacteria 1502
372 Ga0496114_0026120 3300048917 Bacteria 4778
373 Ga0496114_0058212 3300048917 Bacteria 3226
374 Ga0496114_0102024 3300048917 Bacteria 2450
375 Ga0496114_0129081 3300048917 Bacteria 2181
376 Ga0496114_0263649 3300048917 Unclassified 1517
377 Ga0496115_0011339 3300048918 Bacteria 6681
378 Ga0496115_0025919 3300048918 Bacteria 4569
379 Ga0496115_0173865 3300048918 Unclassified 1781
380 Ga0501047_0052404 3300049581 Bacteria 3944
381 Ga0501067_0004067 3300049583 Bacteria 8068
382 Ga0501069_0003080 3300049585 Bacteria 8539
383 Ga0501069_0061840 3300049585 Bacteria 2091
384 Ga0501069_0079911 3300049585 Bacteria 1841
385 Ga0501070_0373996 3300049586 Bacteria 1155
386 Ga0501080_0009344 3300049742 Bacteria 8940
387 Ga0501080_0172951 3300049742 Bacteria 1991
388 nmdc:mga03683_89928_c1 3300050489 Bacteria 1337
389 nmdc:mga0yw44_306495_c1 3300050492 Bacteria 1065
390 nmdc:mga0qj67_69385_c1 3300050509 Bacteria 2811
391 nmdc:mga0n895_320594_c1 3300050512 Bacteria 1570
392 nmdc:mga0n895_614541_c1 3300050512 Unclassified 1088
393 nmdc:mga0n895_82181_c1 3300050512 Bacteria 3211
394 nmdc:mga0a205_221027_c1 3300050515 Bacteria 1779
395 nmdc:mga0a205_40569_c1 3300050515 Bacteria 2146
396 Ga0495601_0000612 3300053077 Bacteria 18978
397 Ga0495601_0020741 3300053077 Bacteria 4017
398 Ga0495601_0147839 3300053077 Bacteria 1534
399 Ga0495601_0225719 3300053077 Bacteria 1223
400 Ga0495655_0024863 3300053083 Bacteria 1395
401 Ga0495595_0018907 3300053084 Bacteria 2983
402 Ga0495619_0003218 3300053085 Bacteria 10571
403 Ga0495619_0028149 3300053085 Bacteria 3623
404 Ga0495619_0103407 3300053085 Bacteria 1940
405 Ga0495619_0237094 3300053085 Unclassified 1264
406 Ga0466962_0000486 3300061719 Bacteria 17214
407 Ga0466962_0100833 3300061719 Bacteria 1386
408 Ga0466962_0173272 3300061719 Bacteria 1051
409 Ga0530510_0025130 3300061734 Bacteria 4258
410 Ga0395899_0110959
411 Ga0070658_10111997
412 Ga0070658_10122717
413 Ga0070658_10213799
414 Ga0070658_10409281
415 Ga0070658_10416894
416 Ga0070683_100030983
417 Ga0070683_100079871
418 Ga0070683_100231945
419 Ga0070670_100769699
420 Ga0070680_100039266
421 Ga0070680_100270153
422 Ga0070680_100270944
423 Ga0070680_100327865
424 Ga0070682_100043156
425 Ga0070660_100001080
426 Ga0070660_100022868
427 Ga0070660_100024822
428 Ga0070660_100221363
429 Ga0070660_100473522
430 Ga0070691_10489350
431 Ga0070661_100154762
432 Ga0070671_100005697
433 Ga0070674_100188137
434 Ga0070659_100230741
435 Ga0070659_100415850
436 Ga0070713_100700489
437 Ga0070713_101016228
438 Ga0070710_10470804
439 Ga0070678_100057550
440 Ga0070681_10007094
441 Ga0070681_10031343
442 Ga0070681_10079880
443 Ga0070681_10137001
444 Ga0070681_10319777
445 Ga0070681_10568476
446 Ga0070706_100394743
447 Ga0070699_100475528
448 Ga0070679_100007403
449 Ga0070679_100157921
450 Ga0070679_100159493
451 Ga0070679_100472237
452 Ga0070679_100654274
453 Ga0070684_100006199
454 Ga0070684_100102143
455 Ga0070684_100216585
456 Ga0070684_100279382
457 Ga0070684_100416399
458 Ga0068853_100034586
459 Ga0068853_100417518
460 Ga0068853_101040323
461 Ga0070693_100090758
462 Ga0068855_100027550
463 Ga0068855_100070917
464 Ga0068855_100114810
465 Ga0068855_100190694
466 Ga0068855_100291716
467 Ga0068855_100955446
468 Ga0068857_100052415
469 Ga0068857_100642123
470 Ga0068856_100027104
471 Ga0068856_100539513
472 Ga0068852_100610303
473 Ga0070717_10371141
474 Ga0070717_10578586
475 Ga0070715_10231435
476 Ga0070712_100013496
477 Ga0097621_100531811
478 Ga0097621_100665062
479 Ga0075428_100145408
480 Ga0075430_100022739
481 Ga0075434_100323334
482 Ga0075435_100000425
483 Ga0105240_10028411
484 Ga0105240_10446418
485 Ga0105240_10493159
486 Ga0105245_10437706
487 Ga0105237_10104446
488 Ga0105237_10847422
489 Ga0105238_10152330
490 Ga0105239_10352272
491 Ga0105239_10617266
492 Ga0105239_11280759
493 Ga0157373_10140206
494 Ga0157370_10028969
495 Ga0157370_10031810
496 Ga0157370_10041516
497 Ga0157370_10367540
498 Ga0157369_10001951
499 Ga0157369_10493157
500 Ga0157374_10587235
501 Ga0157378_10061002
502 Ga0157372_10107634
503 Ga0157372_10474669
504 Ga0157372_10485864
505 Ga0157375_10792575
506 Ga0157380_11475055
507 Ga0157376_10068360
508 Ga0157376_10634139
509 Ga0182007_10050917
510 Ga0197907_11125714
511 Ga0197907_11203654
512 Ga0197907_11237417
513 Ga0206356_10611072
514 Ga0206354_10902424
515 Ga0206354_11344860
516 Ga0206353_10057273
517 Ga0206353_10195264
518 Ga0206353_10509488
519 Ga0206353_11012385
520 Ga0207705_10025832
521 Ga0207705_10284715
522 Ga0207705_10306755
523 Ga0207707_10073750
524 Ga0207707_10544043
525 Ga0207707_10592063
526 Ga0207671_10243901
527 Ga0207693_10035715
528 Ga0207693_10251051
529 Ga0207663_10102177
530 Ga0207660_10007676
531 Ga0207660_10126180
532 Ga0207660_10482124
533 Ga0207657_10002431
534 Ga0207657_10006259
535 Ga0207657_10012680
536 Ga0207657_10047667
537 Ga0207657_10163158
538 Ga0207657_10388766
539 Ga0207649_10016140
540 Ga0207649_10065101
541 Ga0207649_10483664
542 Ga0207652_10190925
543 Ga0207652_10216555
544 Ga0207652_10223344
545 Ga0207652_10230696
546 Ga0207652_10369010
547 Ga0207652_10591805
548 Ga0207652_10655811
549 Ga0207690_10425480
550 Ga0207686_10049254
551 Ga0207665_10185391
552 Ga0207661_10277154
553 Ga0207661_10362877
554 Ga0207667_10065155
555 Ga0207667_10076002
556 Ga0207667_10418060
557 Ga0207639_10408333
558 Ga0207639_10664504
559 Ga0207678_10069369
560 Ga0207702_10069699
561 Ga0207674_10008299
562 Ga0207674_10665696
563 Ga0207698_10393708
564 Ga0265336_10047104
565 Ga0265338_10002043
566 Ga0265338_10044861
567 Ga0265325_10095466
568 Ga0265340_10173428
569 Ga0265327_10016971
570 Ga0265327_10031682
571 Ga0265316_10012066
572 Ga0265314_10018779
573 Ga0316583_10042213
574 Ga0373944_0002287
575 Ga0373936_0078978
576 Ga0373945_0015311
577 Ga0373956_0070353
578 Ga0373943_0002743
579 Ga0373946_0018212
580 Ga0373955_0008672
581 Ga0373935_0026133
582 Ga0373935_0120342
583 Ga0373927_0038357
584 Ga0373933_0154089
585 Ga0373947_0000222
586 Ga0373947_0057356
587 Ga0373937_0000989
588 Ga0373937_0272049
589 Ga0373925_0008681
590 Ga0373925_0235799
591 Ga0395899_0058729
592 Ga0395899_0075485
593 Ga0395899_0269360
594 Ga0395900_0145449
595 Ga0395900_0734359
596 Ga0395898_0008439
597 Ga0395898_0073696
598 Ga0395898_0090264
599 Ga0395898_0125891
600 Ga0395898_0192947
601 Ga0395905_0778753
602 Ga0436364_0573647
603 Ga0395901_0002091
604 Ga0395901_0003265
605 Ga0395901_0025507
606 Ga0395901_0312392
607 Ga0395901_0979735
608 Ga0451853_2376429
609 Ga0466966_0022518
610 Ga0466966_0078182
611 Ga0466961_0014319
612 Ga0466961_0020957
613 Ga0466963_0001799
614 Ga0466963_0003969
615 Ga0466963_0011306
616 Ga0466963_0056444
617 Ga0466963_0317288
618 Ga0466964_0000187
619 Ga0466964_0013002
620 Ga0466964_0069674
621 Ga0466964_0243646
622 Ga0466971_0002136
623 Ga0466971_0049442
624 Ga0466971_0176230
625 Ga0466968_0003877
626 Ga0466968_0215697
627 Ga0466957_0001589
628 Ga0466957_0014289
629 Ga0466957_0131296
630 Ga0466957_0150710
631 Ga0466957_0200936
632 Ga0466960_0041793
633 Ga0466959_0064948
634 Ga0466959_0069562
635 Ga0466959_0326606
636 Ga0466958_0001586
637 Ga0466958_0113503
638 Ga0466967_0000244
639 Ga0466967_0005446
640 Ga0466967_0007228
641 Ga0466967_0012355
642 Ga0466967_0017445
643 Ga0466967_0022522
644 Ga0466967_0035274
645 Ga0466967_0056893
646 Ga0466967_0088062
647 Ga0466967_0092630
648 Ga0466967_0274392
649 Ga0466967_0331004
650 Ga0466967_0360656
651 Ga0466967_0519129
652 Ga0466967_0763113
653 Ga0495592_0000368
654 Ga0495592_0098964
655 Ga0495592_0279325
656 Ga0495603_0192801
657 Ga0495629_0000214
658 Ga0495629_0033925
659 Ga0495641_0000795
660 Ga0495651_0001115
661 Ga0495651_0059692
662 Ga0495651_0459454
663 Ga0495653_0006467
664 Ga0495653_0032443
665 Ga0495653_0060399
666 Ga0495653_0229967
667 Ga0495582_0003147
668 Ga0495582_0127826
669 Ga0495639_0001167
670 Ga0495662_0009670
671 Ga0495664_0052255
672 Ga0495664_0090775
673 Ga0495608_0021247
674 Ga0495608_0027090
675 Ga0495608_0043599
676 Ga0495608_0343725
677 Ga0495608_0380848
678 Ga0495618_0019680
679 Ga0495628_0000650
680 Ga0495628_0046267
681 Ga0495628_0235297
682 Ga0495630_0004324
683 Ga0495630_0008144
684 Ga0495630_0839658
685 Ga0495666_0015412
686 Ga0495652_0006220
687 Ga0495652_0053532
688 Ga0495652_0217915
689 Ga0495652_0255763
690 Ga0495665_0001846
691 Ga0495665_0268446
692 Ga0495640_0019540
693 Ga0495640_0043470
694 Ga0495640_0140897
695 Ga0495587_0000469
696 Ga0495587_0009850
697 Ga0495645_0000456
698 Ga0495645_0185653
699 Ga0495667_0031766
700 Ga0495667_0038337
701 Ga0495667_0149081
702 Ga0495656_0189039
703 Ga0495634_0104555
704 Ga0495635_0080684
705 Ga0495635_0178999
706 Ga0495588_0295107
707 Ga0495657_0019036
708 Ga0495657_0023596
709 Ga0495599_0000660
710 Ga0495623_0000123
711 Ga0495646_0001321
712 Ga0495646_0249903
713 Ga0495647_0005497
714 Ga0495658_0000138
715 Ga0495613_0007232
716 Ga0495613_0128325
717 Ga0495624_0009211
718 Ga0495624_0273283
719 Ga0495581_0000807
720 Ga0495604_0001520
721 Ga0495674_0040524
722 Ga0495674_0042206
723 Ga0495674_0086743
724 Ga0495674_0302549
725 Ga0495676_0005351
726 Ga0495676_0140543
727 Ga0495676_0168580
728 Ga0495676_0322154
729 Ga0495676_0423057
730 Ga0495680_0000502
731 Ga0495680_0006055
732 Ga0495680_0010551
733 Ga0495680_0013016
734 Ga0495680_0052279
735 Ga0495680_0129619
736 Ga0495675_0001583
737 Ga0495675_0004653
738 Ga0495675_0081938
739 Ga0495684_0014988
740 Ga0495684_0272002
741 Ga0495593_0014056
742 Ga0495602_0011825
743 Ga0495602_0015411
744 Ga0495614_0015437
745 Ga0496100_0013634
746 Ga0496100_0032424
747 Ga0496100_0213195
748 Ga0496101_0007692
749 Ga0496101_0017717
750 Ga0496101_0050365
751 Ga0496101_0118889
752 Ga0496102_0011159
753 Ga0496102_0893932
754 Ga0496104_0008579
755 Ga0496104_0008920
756 Ga0496104_0213778
757 Ga0496104_0414156
758 Ga0496105_0008156
759 Ga0496105_0021250
760 Ga0496105_0132078
761 Ga0496105_0409597
762 Ga0496106_0008219
763 Ga0496106_0067911
764 Ga0496107_0019343
765 Ga0496107_0021500
766 Ga0496107_0122676
767 Ga0496108_0395604
768 Ga0496109_0022226
769 Ga0496109_0042561
770 Ga0496110_0047116
771 Ga0496110_0128655
772 Ga0496111_0010692
773 Ga0496111_0134326
774 Ga0496112_0018429
775 Ga0496112_0031919
776 Ga0496112_0089601
777 Ga0496112_0157749
778 Ga0496112_0331558
779 Ga0496113_0104395
780 Ga0496113_0223030
781 Ga0496114_0026120
782 Ga0496114_0058212
783 Ga0496114_0102024
784 Ga0496114_0129081
785 Ga0496114_0263649
786 Ga0496115_0011339
787 Ga0496115_0025919
788 Ga0496115_0173865
789 Ga0501047_0052404
790 Ga0501067_0004067
791 Ga0501069_0003080
792 Ga0501069_0061840
793 Ga0501069_0079911
794 Ga0501070_0373996
795 Ga0501080_0009344
796 Ga0501080_0172951
797 nmdc:mga03683_89928_c1
798 nmdc:mga0yw44_306495_c1
799 nmdc:mga0qj67_69385_c1
800 nmdc:mga0n895_320594_c1
801 nmdc:mga0n895_614541_c1
802 nmdc:mga0n895_82181_c1
803 nmdc:mga0a205_221027_c1
804 nmdc:mga0a205_40569_c1
805 Ga0495601_0000612
806 Ga0495601_0020741
807 Ga0495601_0147839
808 Ga0495601_0225719
809 Ga0495655_0024863
810 Ga0495595_0018907
811 Ga0495619_0003218
812 Ga0495619_0028149
813 Ga0495619_0103407
814 Ga0495619_0237094
815 Ga0466962_0000486
816 Ga0466962_0100833
817 Ga0466962_0173272
818 Ga0530510_0025130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01596

Methyltransf_3

O-methyltransferase

29

222

0.94

PF13578

Methyltransf_24

Methyltransferase domain

78

179

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tr6-assembly1.cif.gz_A-2 structure of a o-methyltransferase from coxiella burnetii 0.9388 1 209
5zw3-assembly1.cif.gz_B crystal structure of trmr from b. subtilis 0.9311 5 209
3tr6-assembly1.cif.gz_A-2 structure of a o-methyltransferase from coxiella burnetii 0.9302 1 209
5log-assembly1.cif.gz_A crystal structure of safc from myxococcus xanthus bound to sam 0.9269 1 209
7cvv-assembly1.cif.gz_A crystal structure of catechol o-methyl transferase (comt) from niastella koreensis 0.9242 7 210
ID Description Score Start End Superfamily
af_Q5BLE6_34_270_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9625 5 209 3.40.50.150
af_Q5BLE6_34_270_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9358 5 209 3.40.50.150
3cbgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9239 3 210 3.40.50.150
af_Q86IC9_10_229_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9226 1 210 3.40.50.150
af_F4IAT4_68_291_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9211 36 209 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A257SKD5-F1-model_v4 deleted 0.9914 39 148
AF-A0A6J4RL73-F1-model_v4 O-methyltransferase 0.9845 8 103 GO:0008171
GO:0032259
AF-A0A8B6D0K5-F1-model_v4 Uncharacterized protein 0.9788 5 147 GO:0008171
GO:0008757
GO:0032259
AF-A0A3D5S351-F1-model_v4 Methyltransferase 0.9691 3 166 GO:0008171
GO:0008757
GO:0032259
AF-A0A7S2B9E3-F1-model_v4 Uncharacterized protein 0.9675 5 111 GO:0008171
GO:0008757
GO:0032259

Map