F437021

General Info

Members Datasets Scaffolds Average Seq Length
409 226 409 147

Family's Representative Sequence

Representative Sequence 3300027876|Ga0209974_10038941|Ga0209974_100389412
Length 137
Sequence VRVDGDTVAEIGEGMLILLGVGHDDDEATTDALARRTTELRFFRDEAGKTNRSILDIGGAALVVSQFTLFADTSRGRRPGFTNAATPDLANRLYRRFGDALRSAGVEDVQLGSFGAEMAVELVNDGPFTLWLDTDRP

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
115 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
130 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
131 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
143 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.78
Rhizosphere 89
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10029387 3300005328 Bacteria 3126
2 Ga0070690_100111544 3300005330 Bacteria 1826
3 Ga0070670_100010922 3300005331 Bacteria 7756
4 Ga0070680_101044629 3300005336 Bacteria 706
5 Ga0070682_100018483 3300005337 Bacteria 4076
6 Ga0070660_100041503 3300005339 Bacteria 3507
7 Ga0070692_10004375 3300005345 Bacteria 5891
8 Ga0070692_10066156 3300005345 Bacteria 1915
9 Ga0070669_100012524 3300005353 Bacteria 6017
10 Ga0070675_100002114 3300005354 Bacteria 14669
11 Ga0070675_100831336 3300005354 Bacteria 845
12 Ga0070674_100014575 3300005356 Bacteria 4890
13 Ga0070674_100661206 3300005356 Bacteria 889
14 Ga0070673_100018298 3300005364 Bacteria 5001
15 Ga0070673_101928637 3300005364 Bacteria 560
16 Ga0070688_100002293 3300005365 Bacteria 9667
17 Ga0070688_101143250 3300005365 Bacteria 624
18 Ga0070705_100053724 3300005440 Bacteria 2360
19 Ga0070705_100147212 3300005440 Bacteria 1558
20 Ga0070700_100001617 3300005441 Bacteria 11239
21 Ga0070700_100079941 3300005441 Bacteria 2108
22 Ga0070700_100553106 3300005441 Bacteria 894
23 Ga0070694_100026368 3300005444 Bacteria 3766
24 Ga0070694_100038298 3300005444 Bacteria 3186
25 Ga0070694_100244373 3300005444 Bacteria 1355
26 Ga0070694_100310697 3300005444 Bacteria 1210
27 Ga0070708_100000387 3300005445 Bacteria 33206
28 Ga0070708_100075476 3300005445 Bacteria 3043
29 Ga0070708_100255794 3300005445 Bacteria 1646
30 Ga0070708_100296970 3300005445 Bacteria 1521
31 Ga0070663_100045208 3300005455 Bacteria 3109
32 Ga0070678_100040841 3300005456 Bacteria 3285
33 Ga0070662_100001685 3300005457 Bacteria 13597
34 Ga0068867_100024134 3300005459 Bacteria 4358
35 Ga0070685_10008107 3300005466 Bacteria 5386
36 Ga0070685_10384452 3300005466 Bacteria 968
37 Ga0070706_100000515 3300005467 Bacteria 45368
38 Ga0070706_100031239 3300005467 Bacteria 4911
39 Ga0070706_100053653 3300005467 Bacteria 3721
40 Ga0070707_100001618 3300005468 Bacteria 21830
41 Ga0070707_100002066 3300005468 Bacteria 19252
42 Ga0070707_100088413 3300005468 Bacteria 2997
43 Ga0070698_100048760 3300005471 Bacteria 4327
44 Ga0070698_101302087 3300005471 Bacteria 677
45 Ga0070699_100005863 3300005518 Bacteria 10728
46 Ga0070684_100057919 3300005535 Bacteria 3384
47 Ga0070697_100612946 3300005536 Bacteria 957
48 Ga0070672_100042945 3300005543 Bacteria 3483
49 Ga0070686_100010254 3300005544 Bacteria 5276
50 Ga0070695_100014873 3300005545 Bacteria 4695
51 Ga0070695_100153537 3300005545 Bacteria 1609
52 Ga0070695_100215840 3300005545 Bacteria 1379
53 Ga0070696_100063072 3300005546 Bacteria 2595
54 Ga0070696_100142282 3300005546 Bacteria 1754
55 Ga0070696_100152257 3300005546 Bacteria 1698
56 Ga0070696_100329513 3300005546 Bacteria 1177
57 Ga0070696_100340147 3300005546 Bacteria 1159
58 Ga0070693_100012108 3300005547 Bacteria 4358
59 Ga0070693_100725146 3300005547 Bacteria 730
60 Ga0070704_100017007 3300005549 Bacteria 4612
61 Ga0070704_100091874 3300005549 Bacteria 2264
62 Ga0070704_100221459 3300005549 Bacteria 1539
63 Ga0070704_100320446 3300005549 Bacteria 1299
64 Ga0070704_100783213 3300005549 Bacteria 851
65 Ga0068855_100197078 3300005563 Bacteria 2269
66 Ga0070664_100032350 3300005564 Bacteria 4374
67 Ga0068857_100558657 3300005577 Bacteria 1079
68 Ga0068854_100221921 3300005578 Unclassified 1496
69 Ga0070702_100004660 3300005615 Bacteria 6287
70 Ga0068852_100444105 3300005616 Bacteria 1283
71 Ga0068859_101362524 3300005617 Unclassified 782
72 Ga0068864_100014386 3300005618 Bacteria 6571
73 Ga0068870_10031019 3300005840 Bacteria 2706
74 Ga0068860_100032595 3300005843 Bacteria 5006
75 Ga0068860_100139564 3300005843 Bacteria 2329
76 Ga0068862_100468594 3300005844 Bacteria 1190
77 Ga0081539_10010249 3300005985 Bacteria 7656
78 Ga0068871_100287532 3300006358 Bacteria 1440
79 Ga0075428_100523872 3300006844 Bacteria 1268
80 Ga0075431_100076099 3300006847 Bacteria 3464
81 Ga0075433_10154245 3300006852 Bacteria 2043
82 Ga0075433_10926137 3300006852 Bacteria 760
83 Ga0075433_10961164 3300006852 Bacteria 744
84 Ga0075434_100015047 3300006871 Bacteria 7409
85 Ga0068865_100020101 3300006881 Bacteria 4330
86 Ga0075436_100556831 3300006914 Bacteria 842
87 Ga0097620_101362899 3300006931 Unclassified 782
88 Ga0075435_101582340 3300007076 Bacteria 575
89 Ga0111539_10167466 3300009094 Bacteria 2568
90 Ga0111539_10276063 3300009094 Bacteria 1956
91 Ga0111539_10286929 3300009094 Bacteria 1915
92 Ga0111539_11012302 3300009094 Bacteria 966
93 Ga0105245_10032092 3300009098 Bacteria 4650
94 Ga0105245_10549772 3300009098 Unclassified 1176
95 Ga0105245_11765430 3300009098 Bacteria 671
96 Ga0114129_10158105 3300009147 Bacteria 3098
97 Ga0114129_10173305 3300009147 Bacteria 2940
98 Ga0114129_10195999 3300009147 Bacteria 2739
99 Ga0114129_10262625 3300009147 Bacteria 2313
100 Ga0105243_10094725 3300009148 Bacteria 2466
101 Ga0105243_10910598 3300009148 Bacteria 875
102 Ga0105242_10384097 3300009176 Bacteria 1306
103 Ga0105242_11219987 3300009176 Bacteria 772
104 Ga0105248_10018770 3300009177 Bacteria 7647
105 Ga0105248_11649702 3300009177 Unclassified 727
106 Ga0105238_10416724 3300009551 Bacteria 1337
107 Ga0105249_10177326 3300009553 Bacteria 2071
108 Ga0105249_12194003 3300009553 Unclassified 625
109 Ga0105239_10030065 3300010375 Bacteria 5974
110 Ga0105239_10792330 3300010375 Bacteria 1086
111 Ga0105239_11448210 3300010375 Bacteria 793
112 Ga0105239_12538608 3300010375 Bacteria 597
113 Ga0105246_10351562 3300011119 Bacteria 1208
114 Ga0105246_11497023 3300011119 Unclassified 634
115 Ga0157374_10285140 3300013296 Bacteria 1631
116 Ga0157374_10409772 3300013296 Unclassified 1353
117 Ga0163162_11208769 3300013306 Bacteria 858
118 Ga0163162_11246222 3300013306 Archaea 844
119 Ga0157375_10112349 3300013308 Bacteria 2824
120 Ga0157375_10746188 3300013308 Bacteria 1130
121 Ga0163163_10015291 3300014325 Bacteria 7091
122 Ga0157380_10263918 3300014326 Bacteria 1566
123 Ga0157380_10320309 3300014326 Bacteria 1437
124 Ga0157380_10553070 3300014326 Bacteria 1129
125 Ga0157380_10693233 3300014326 Bacteria 1022
126 Ga0157377_10092905 3300014745 Bacteria 1785
127 Ga0157377_10769367 3300014745 Unclassified 707
128 Ga0157377_11649891 3300014745 Bacteria 515
129 Ga0157376_10066475 3300014969 Bacteria 3048
130 Ga0163161_10615543 3300017792 Bacteria 897
131 Ga0213876_10198435 3300021384 Bacteria 1067
132 Ga0207688_10007418 3300025901 Bacteria 5968
133 Ga0207688_10061004 3300025901 Bacteria 2125
134 Ga0207643_10001977 3300025908 Bacteria 11314
135 Ga0207684_10015853 3300025910 Bacteria 6479
136 Ga0207684_10059022 3300025910 Bacteria 3257
137 Ga0207707_10687832 3300025912 Unclassified 860
138 Ga0207660_10984998 3300025917 Bacteria 688
139 Ga0207662_10007234 3300025918 Bacteria 6037
140 Ga0207657_10067017 3300025919 Bacteria 3054
141 Ga0207652_10077275 3300025921 Bacteria 2905
142 Ga0207646_10003504 3300025922 Bacteria 17691
143 Ga0207646_10009489 3300025922 Bacteria 9615
144 Ga0207646_11055288 3300025922 Bacteria 716
145 Ga0207681_10026152 3300025923 Bacteria 3762
146 Ga0207687_10351796 3300025927 Bacteria 1200
147 Ga0207687_10530528 3300025927 Bacteria 986
148 Ga0207687_11284584 3300025927 Bacteria 629
149 Ga0207644_10649966 3300025931 Bacteria 878
150 Ga0207706_10026227 3300025933 Bacteria 5215
151 Ga0207706_10037897 3300025933 Bacteria 4278
152 Ga0207686_10116870 3300025934 Bacteria 1809
153 Ga0207709_10021597 3300025935 Bacteria 3646
154 Ga0207709_10332770 3300025935 Unclassified 1140
155 Ga0207670_11015995 3300025936 Bacteria 698
156 Ga0207669_10018663 3300025937 Bacteria 3592
157 Ga0207669_11113907 3300025937 Bacteria 667
158 Ga0207704_10046260 3300025938 Bacteria 2592
159 Ga0207691_10049180 3300025940 Bacteria 3864
160 Ga0207661_11466856 3300025944 Bacteria 625
161 Ga0207679_10140143 3300025945 Bacteria 1954
162 Ga0207679_11115645 3300025945 Bacteria 724
163 Ga0207667_10274767 3300025949 Bacteria 1722
164 Ga0207677_10186878 3300026023 Bacteria 1635
165 Ga0207703_10715868 3300026035 Bacteria 952
166 Ga0207639_10549111 3300026041 Bacteria 1061
167 Ga0207678_10017127 3300026067 Bacteria 6363
168 Ga0207708_10003389 3300026075 Bacteria 11744
169 Ga0207708_10027249 3300026075 Bacteria 4326
170 Ga0207702_10935077 3300026078 Bacteria 859
171 Ga0207648_10001801 3300026089 Bacteria 23481
172 Ga0207676_10134317 3300026095 Bacteria 2108
173 Ga0207674_10513119 3300026116 Bacteria 1158
174 Ga0207675_100104565 3300026118 Bacteria 2669
175 Ga0207683_10030915 3300026121 Bacteria 4643
176 Ga0207698_10888817 3300026142 Unclassified 898
177 Ga0209998_10086710 3300027717 Bacteria 764
178 Ga0209974_10038941 3300027876 Bacteria 1581
179 Ga0207428_10032722 3300027907 Bacteria 4276
180 Ga0268265_10460043 3300028380 Bacteria 1190
181 Ga0268264_10050646 3300028381 Bacteria 3459
182 Ga0268264_10133065 3300028381 Bacteria 2207
183 Ga0265334_10022126 3300028573 Unclassified 2594
184 Ga0265334_10065206 3300028573 Bacteria 1366
185 Ga0265323_10171335 3300028653 Bacteria 689
186 Ga0265322_10033712 3300028654 Bacteria 1460
187 Ga0265330_10225909 3300031235 Bacteria 790
188 Ga0265329_10068760 3300031242 Bacteria 1120
189 Ga0265316_10005247 3300031344 Bacteria 12654
190 Ga0307408_100313043 3300031548 Bacteria 1320
191 Ga0307408_100552718 3300031548 Bacteria 1016
192 Ga0316575_10117948 3300031665 Bacteria 1085
193 Ga0265314_10222238 3300031711 Bacteria 1101
194 Ga0265342_10070780 3300031712 Bacteria 2034
195 Ga0307405_10044674 3300031731 Bacteria 2711
196 Ga0307410_10927381 3300031852 Bacteria 747
197 Ga0307407_10586094 3300031903 Bacteria 829
198 Ga0307407_10828902 3300031903 Bacteria 705
199 Ga0307416_100376194 3300032002 Bacteria 1448
200 Ga0307416_100482748 3300032002 Bacteria 1300
201 Ga0307411_10607518 3300032005 Bacteria 941
202 Ga0307411_10883470 3300032005 Bacteria 793
203 Ga0307415_100003134 3300032126 Bacteria 8375
204 Ga0307415_100560423 3300032126 Bacteria 1010
205 Ga0316583_10007599 3300032133 Bacteria 3904
206 Ga0316585_10041418 3300032137 Bacteria 1468
207 Ga0373952_0096559 3300035092 Bacteria 774
208 Ga0373932_0041631 3300035112 Bacteria 1328
209 Ga0373939_0024984 3300035114 Bacteria 1670
210 Ga0373960_0011324 3300035121 Bacteria 2196
211 Ga0373943_0714629 3300035170 Bacteria 594
212 Ga0373961_0266147 3300035241 Bacteria 625
213 Ga0373962_0032360 3300035242 Bacteria 1438
214 Ga0373931_0018179 3300035691 Bacteria 3492
215 Ga0373947_0443895 3300035725 Bacteria 878
216 Ga0373925_0388707 3300037068 Bacteria 1137
217 Ga0436365_1327079 3300039437 Bacteria 2188
218 Ga0451800_1472595 3300041459 Bacteria 850
219 Ga0451839_0015487 3300041496 Bacteria 869
220 Ga0451853_1192951 3300041512 Unclassified 554
221 Ga0451853_1686535 3300041512 Bacteria 970
222 Ga0450905_050828 3300042142 Bacteria 676
223 Ga0439446_0089238 3300042156 Bacteria 963
224 Ga0439434_0048658 3300042435 Bacteria 1312
225 Ga0451577_0056335 3300042876 Bacteria 3506
226 Ga0453684_0596437 3300044712 Bacteria 1211
227 Ga0453684_0652820 3300044712 Bacteria 1148
228 Ga0466960_0338237 3300044901 Bacteria 856
229 Ga0495629_0124149 3300046459 Bacteria 1799
230 Ga0495653_0586707 3300046463 Bacteria 686
231 Ga0495582_0154444 3300046473 Bacteria 1304
232 Ga0495662_0062790 3300046476 Bacteria 1795
233 Ga0495628_0081967 3300046516 Bacteria 2506
234 Ga0495587_0395692 3300046536 Bacteria 768
235 Ga0495634_0630184 3300046642 Bacteria 620
236 Ga0495635_0115682 3300046663 Bacteria 1831
237 Ga0495657_0179153 3300046675 Bacteria 1302
238 Ga0495647_0081794 3300046681 Unclassified 1311
239 Ga0495658_0280954 3300046683 Bacteria 1051
240 Ga0495658_0434854 3300046683 Bacteria 838
241 Ga0495658_0751495 3300046683 Bacteria 625
242 Ga0495613_0352176 3300046689 Bacteria 1011
243 Ga0495624_0170262 3300046690 Bacteria 1329
244 Ga0495604_0317637 3300047317 Bacteria 1042
245 Ga0495674_0721160 3300047319 Bacteria 781
246 Ga0495676_0114675 3300047321 Bacteria 1971
247 Ga0495676_0291427 3300047321 Bacteria 1103
248 Ga0495680_0446467 3300047322 Bacteria 886
249 Ga0495684_0671110 3300047471 Bacteria 691
250 Ga0495593_0085573 3300047673 Bacteria 1627
251 Ga0496100_0408499 3300048903 Bacteria 1035
252 Ga0496101_0572793 3300048904 Unclassified 893
253 Ga0496102_0025636 3300048905 Bacteria 5252
254 Ga0496102_0158611 3300048905 Bacteria 2128
255 Ga0496103_0024446 3300048906 Bacteria 3648
256 Ga0496103_0089675 3300048906 Bacteria 1940
257 Ga0496103_0553984 3300048906 Bacteria 734
258 Ga0496104_0094596 3300048907 Bacteria 2859
259 Ga0496105_0042239 3300048908 Bacteria 3758
260 Ga0496106_0055775 3300048909 Bacteria 2987
261 Ga0496106_0376883 3300048909 Bacteria 1140
262 Ga0496107_0115298 3300048910 Bacteria 1977
263 Ga0496107_0820575 3300048910 Bacteria 680
264 Ga0496108_0006839 3300048911 Bacteria 9228
265 Ga0496108_0035999 3300048911 Bacteria 4116
266 Ga0496108_0116592 3300048911 Bacteria 2288
267 Ga0496109_0008412 3300048912 Bacteria 8770
268 Ga0496109_0165733 3300048912 Bacteria 2071
269 Ga0496109_0237041 3300048912 Bacteria 1716
270 Ga0496109_0264701 3300048912 Bacteria 1620
271 Ga0496109_0270560 3300048912 Bacteria 1601
272 Ga0496109_0278523 3300048912 Bacteria 1576
273 Ga0496109_0440039 3300048912 Bacteria 1231
274 Ga0496109_1456388 3300048912 Unclassified 620
275 Ga0496110_0056181 3300048913 Bacteria 3464
276 Ga0496110_0057009 3300048913 Bacteria 3438
277 Ga0496111_0025396 3300048914 Bacteria 4181
278 Ga0496111_0061098 3300048914 Bacteria 2732
279 Ga0496111_0176673 3300048914 Bacteria 1587
280 Ga0496112_0017218 3300048915 Bacteria 6785
281 Ga0496112_0132640 3300048915 Bacteria 2462
282 Ga0496113_0015627 3300048916 Bacteria 5226
283 Ga0496113_0179536 3300048916 Bacteria 1678
284 Ga0496113_0730860 3300048916 Bacteria 789
285 Ga0496114_0011503 3300048917 Bacteria 7075
286 Ga0496114_0198919 3300048917 Bacteria 1755
287 Ga0496114_0360658 3300048917 Bacteria 1286
288 Ga0496114_0396117 3300048917 Bacteria 1223
289 Ga0496114_1267525 3300048917 Unclassified 624
290 Ga0501031_0194923 3300049568 Bacteria 1322
291 Ga0501031_0222789 3300049568 Bacteria 1228
292 Ga0501031_0365804 3300049568 Bacteria 933
293 Ga0501031_0713137 3300049568 Bacteria 644
294 Ga0501032_0037325 3300049569 Bacteria 3314
295 Ga0501032_0514290 3300049569 Bacteria 765
296 Ga0501036_0178844 3300049572 Bacteria 1786
297 Ga0501036_0548228 3300049572 Bacteria 961
298 Ga0501036_0766766 3300049572 Bacteria 795
299 Ga0501036_1190986 3300049572 Bacteria 621
300 Ga0501037_0091675 3300049573 Bacteria 2198
301 Ga0501038_0274233 3300049574 Bacteria 1329
302 Ga0501038_0728861 3300049574 Bacteria 741
303 Ga0501038_0896395 3300049574 Bacteria 655
304 Ga0501039_0036428 3300049575 Bacteria 3796
305 Ga0501039_0274127 3300049575 Bacteria 1326
306 Ga0501039_0653320 3300049575 Bacteria 823
307 Ga0501040_0011475 3300049576 Bacteria 5800
308 Ga0501040_0180349 3300049576 Bacteria 1497
309 Ga0501040_0251051 3300049576 Bacteria 1262
310 Ga0501040_0659038 3300049576 Bacteria 756
311 Ga0501040_0993698 3300049576 Bacteria 608
312 Ga0501041_0014197 3300049577 Bacteria 4728
313 Ga0501041_0137298 3300049577 Bacteria 1524
314 Ga0501041_0277653 3300049577 Bacteria 1054
315 Ga0501041_0523100 3300049577 Bacteria 755
316 Ga0501042_0787099 3300049578 Bacteria 692
317 Ga0501042_0878918 3300049578 Bacteria 653
318 Ga0501043_0881883 3300049579 Bacteria 643
319 Ga0501046_0069359 3300049580 Bacteria 2743
320 Ga0501046_0162441 3300049580 Bacteria 1679
321 Ga0501046_0316617 3300049580 Bacteria 1137
322 Ga0501046_0626809 3300049580 Bacteria 761
323 Ga0501046_0661437 3300049580 Bacteria 738
324 Ga0501048_0025214 3300049582 Bacteria 4334
325 Ga0501048_0711152 3300049582 Bacteria 721
326 Ga0501067_0190624 3300049583 Bacteria 1142
327 Ga0501068_0008125 3300049584 Bacteria 5827
328 Ga0501069_0007839 3300049585 Bacteria 5605
329 Ga0501069_0146912 3300049585 Bacteria 1354
330 Ga0501069_0185430 3300049585 Bacteria 1203
331 Ga0501071_0043038 3300049587 Bacteria 3236
332 Ga0501071_0190095 3300049587 Bacteria 1540
333 Ga0501071_0235268 3300049587 Bacteria 1381
334 Ga0501071_0394987 3300049587 Bacteria 1055
335 Ga0501071_0722370 3300049587 Bacteria 767
336 Ga0501071_0822008 3300049587 Bacteria 716
337 Ga0501071_1231170 3300049587 Bacteria 578
338 Ga0501072_0070669 3300049588 Bacteria 2757
339 Ga0501072_0159700 3300049588 Bacteria 1798
340 Ga0501072_0174587 3300049588 Bacteria 1714
341 Ga0501072_0390092 3300049588 Bacteria 1105
342 Ga0501072_0435673 3300049588 Bacteria 1038
343 Ga0501072_0520421 3300049588 Bacteria 940
344 Ga0501072_0637144 3300049588 Bacteria 839
345 Ga0501073_0051430 3300049589 Bacteria 2886
346 Ga0501073_0507541 3300049589 Bacteria 834
347 Ga0501074_0040186 3300049590 Bacteria 3388
348 Ga0501074_0369288 3300049590 Bacteria 1018
349 Ga0501074_0385887 3300049590 Bacteria 994
350 Ga0501074_0579825 3300049590 Bacteria 794
351 Ga0501075_0094997 3300049591 Bacteria 2262
352 Ga0501075_0153243 3300049591 Bacteria 1757
353 Ga0501075_0298227 3300049591 Bacteria 1228
354 Ga0501075_0466517 3300049591 Bacteria 963
355 Ga0501076_0195506 3300049592 Bacteria 1651
356 Ga0501076_0246671 3300049592 Bacteria 1461
357 Ga0501076_0310908 3300049592 Bacteria 1292
358 Ga0501076_1181884 3300049592 Bacteria 630
359 Ga0501077_0051715 3300049593 Bacteria 2610
360 Ga0501077_0090517 3300049593 Bacteria 1939
361 Ga0501077_0231871 3300049593 Bacteria 1173
362 Ga0501077_0574872 3300049593 Bacteria 723
363 Ga0501079_0007714 3300049741 Bacteria 8146
364 Ga0501079_0176607 3300049741 Unclassified 1666
365 Ga0501079_0236144 3300049741 Bacteria 1428
366 Ga0501079_0260186 3300049741 Bacteria 1356
367 Ga0501079_0548195 3300049741 Bacteria 909
368 Ga0501079_0915323 3300049741 Bacteria 691
369 Ga0501080_0014339 3300049742 Bacteria 7298
370 Ga0501080_0368719 3300049742 Bacteria 1295
371 Ga0501081_0020491 3300049743 Bacteria 4407
372 Ga0501081_0022597 3300049743 Bacteria 4210
373 Ga0501081_0159974 3300049743 Bacteria 1622
374 Ga0501081_1210383 3300049743 Bacteria 572
375 Ga0501083_0076071 3300049744 Bacteria 2228
376 Ga0501045_0079661 3300049824 Bacteria 2415
377 Ga0501045_0082681 3300049824 Bacteria 2368
378 Ga0501045_0715635 3300049824 Bacteria 738
379 Ga0501045_0751871 3300049824 Bacteria 718
380 nmdc:mga05p37_432798_c1 3300050507 Bacteria 1528
381 nmdc:mga05p37_924498_c1 3300050507 Bacteria 937
382 nmdc:mga06r32_664660_c1 3300050510 Bacteria 1009
383 nmdc:mga08y16_124928_c1 3300050511 Bacteria 2677
384 nmdc:mga08y16_195697_c1 3300050511 Bacteria 2095
385 nmdc:mga08y16_30556_c1 3300050511 Bacteria 5669
386 nmdc:mga08y16_462195_c1 3300050511 Bacteria 1293
387 nmdc:mga0n895_612327_c1 3300050512 Bacteria 1090
388 nmdc:mga0rr50_1281828_c1 3300050513 Bacteria 622
389 nmdc:mga0rr50_27298_c1 3300050513 Bacteria 3994
390 nmdc:mga08x19_232098_c1 3300050514 Bacteria 1270
391 nmdc:mga08x19_287852_c1 3300050514 Bacteria 1139
392 nmdc:mga0a205_208353_c1 3300050515 Bacteria 1844
393 nmdc:mga0a205_230772_c1 3300050515 Bacteria 1734
394 nmdc:mga0a205_343351_c1 3300050515 Bacteria 1361
395 Ga0495601_0671398 3300053077 Bacteria 662
396 Ga0495601_0753377 3300053077 Bacteria 619
397 Ga0495612_0014255 3300053078 Bacteria 3198
398 Ga0495619_0065656 3300053085 Bacteria 2421
399 Ga0501084_0035771 3300054114 Bacteria 4151
400 Ga0501084_0153673 3300054114 Bacteria 1940
401 Ga0501084_0473846 3300054114 Bacteria 1058
402 Ga0501084_0770016 3300054114 Bacteria 811
403 Ga0590071_000361 3300059421 Bacteria 13441
404 Ga0590074_013458 3300059423 Bacteria 1382
405 Ga0501082_0889621 3300060353 Bacteria 779
406 Ga0501082_1210551 3300060353 Bacteria 660
407 Ga0530510_0056858 3300061734 Bacteria 2827
408 Ga0530510_0329935 3300061734 Bacteria 1144
409 Ga0530510_0785669 3300061734 Bacteria 726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_100482748 Ga0307416_1004827482 134
2 3300032126 Ga0307415_100560423 Ga0307415_1005604231 134
3 3300049580 Ga0501046_0661437 Ga0501046_0661437_162_566 134
4 3300049587 Ga0501071_0235268 Ga0501071_0235268_212_616 134
5 3300049592 Ga0501076_0195506 Ga0501076_0195506_1099_1545 134
6 3300049592 Ga0501076_1181884 Ga0501076_1181884_152_556 134
7 3300013308 Ga0157375_10746188 Ga0157375_107461882 136
8 3300027876 Ga0209974_10038941 Ga0209974_100389412 136
9 3300031665 Ga0316575_10117948 Ga0316575_101179482 136
10 3300032133 Ga0316583_10007599 Ga0316583_100075995 136
11 3300046476 Ga0495662_0062790 Ga0495662_0062790_13_423 136
12 3300046516 Ga0495628_0081967 Ga0495628_0081967_448_858 136
13 3300046663 Ga0495635_0115682 Ga0495635_0115682_269_679 136
14 3300046683 Ga0495658_0751495 Ga0495658_0751495_140_550 136
15 3300046689 Ga0495613_0352176 Ga0495613_0352176_69_485 136
16 3300047319 Ga0495674_0721160 Ga0495674_0721160_220_630 136
17 3300047322 Ga0495680_0446467 Ga0495680_0446467_306_716 136
18 3300047471 Ga0495684_0671110 Ga0495684_0671110_43_453 136
19 3300048904 Ga0496101_0572793 Ga0496101_0572793_140_550 136
20 3300048909 Ga0496106_0376883 Ga0496106_0376883_46_456 136
21 3300048912 Ga0496109_0008412 Ga0496109_0008412_5178_5588 136
22 3300048912 Ga0496109_0264701 Ga0496109_0264701_241_651 136
23 3300048913 Ga0496110_0056181 Ga0496110_0056181_1531_1941 136
24 3300048914 Ga0496111_0061098 Ga0496111_0061098_1950_2360 136
25 3300048915 Ga0496112_0132640 Ga0496112_0132640_315_725 136
26 3300048916 Ga0496113_0179536 Ga0496113_0179536_709_1119 136
27 3300048917 Ga0496114_0011503 Ga0496114_0011503_4361_4771 136
28 3300048917 Ga0496114_0396117 Ga0496114_0396117_84_494 136
29 3300048917 Ga0496114_1267525 Ga0496114_1267525_190_600 136
30 3300049576 Ga0501040_0251051 Ga0501040_0251051_829_1239 136
31 3300049590 Ga0501074_0579825 Ga0501074_0579825_364_774 136
32 3300053077 Ga0495601_0671398 Ga0495601_0671398_156_566 136
33 3300053077 Ga0495601_0753377 Ga0495601_0753377_26_436 136
34 3300053085 Ga0495619_0065656 Ga0495619_0065656_758_1168 136
35 3300005365 Ga0070688_101143250 Ga0070688_1011432501 140
36 3300009176 Ga0105242_10384097 Ga0105242_103840972 141
37 3300049568 Ga0501031_0194923 Ga0501031_0194923_28_453 141
38 3300049568 Ga0501031_0713137 Ga0501031_0713137_36_461 141
39 3300049569 Ga0501032_0514290 Ga0501032_0514290_160_585 141
40 3300049572 Ga0501036_0548228 Ga0501036_0548228_172_597 141
41 3300049573 Ga0501037_0091675 Ga0501037_0091675_257_682 141
42 3300049574 Ga0501038_0896395 Ga0501038_0896395_207_632 141
43 3300049575 Ga0501039_0274127 Ga0501039_0274127_594_1019 141
44 3300049577 Ga0501041_0277653 Ga0501041_0277653_439_864 141
45 3300049577 Ga0501041_0523100 Ga0501041_0523100_30_455 141
46 3300049578 Ga0501042_0878918 Ga0501042_0878918_80_505 141
47 3300049580 Ga0501046_0626809 Ga0501046_0626809_61_486 141
48 3300049587 Ga0501071_0190095 Ga0501071_0190095_841_1266 141
49 3300049588 Ga0501072_0070669 Ga0501072_0070669_2160_2585 141
50 3300049588 Ga0501072_0637144 Ga0501072_0637144_379_804 141
51 3300049591 Ga0501075_0153243 Ga0501075_0153243_418_843 141
52 3300049592 Ga0501076_0310908 Ga0501076_0310908_840_1265 141
53 3300049593 Ga0501077_0090517 Ga0501077_0090517_1207_1632 141
54 3300049741 Ga0501079_0236144 Ga0501079_0236144_991_1416 141
55 3300049741 Ga0501079_0260186 Ga0501079_0260186_412_837 141
56 3300049743 Ga0501081_0022597 Ga0501081_0022597_345_770 141
57 3300049824 Ga0501045_0079661 Ga0501045_0079661_822_1247 141
58 3300060353 Ga0501082_0889621 Ga0501082_0889621_27_458 141
59 3300061734 Ga0530510_0785669 Ga0530510_0785669_41_466 141
60 3300026078 Ga0207702_10935077 Ga0207702_109350772 143
61 3300009553 Ga0105249_10177326 Ga0105249_101773262 145
62 3300010375 Ga0105239_10792330 Ga0105239_107923302 145
63 3300013296 Ga0157374_10409772 Ga0157374_104097721 145
64 3300013306 Ga0163162_11246222 Ga0163162_112462222 145
65 3300013308 Ga0157375_10112349 Ga0157375_101123492 145
66 3300048910 Ga0496107_0820575 Ga0496107_0820575_41_478 145
67 3300048911 Ga0496108_0116592 Ga0496108_0116592_654_1091 145
68 3300048912 Ga0496109_0165733 Ga0496109_0165733_441_878 145
69 3300048916 Ga0496113_0730860 Ga0496113_0730860_300_737 145
70 3300005441 Ga0070700_100553106 Ga0070700_1005531061 147
71 3300005445 Ga0070708_100075476 Ga0070708_1000754763 147
72 3300026035 Ga0207703_10715868 Ga0207703_107158682 147
73 3300041459 Ga0451800_1472595 Ga0451800_1472595_85_528 147
74 3300046536 Ga0495587_0395692 Ga0495587_0395692_241_684 147
75 3300046675 Ga0495657_0179153 Ga0495657_0179153_658_1101 147
76 3300047317 Ga0495604_0317637 Ga0495604_0317637_281_724 147
77 3300048912 Ga0496109_0278523 Ga0496109_0278523_377_820 147
78 3300048917 Ga0496114_0360658 Ga0496114_0360658_413_856 147
79 3300049572 Ga0501036_1190986 Ga0501036_1190986_63_536 147
80 3300049576 Ga0501040_0180349 Ga0501040_0180349_367_840 147
81 3300049582 Ga0501048_0711152 Ga0501048_0711152_40_483 147
82 3300049587 Ga0501071_0394987 Ga0501071_0394987_162_635 147
83 3300049742 Ga0501080_0368719 Ga0501080_0368719_304_777 147
84 3300049743 Ga0501081_1210383 Ga0501081_1210383_25_498 147
85 3300060353 Ga0501082_1210551 Ga0501082_1210551_97_570 147
86 3300005328 Ga0070676_10029387 Ga0070676_100293872 148
87 3300005330 Ga0070690_100111544 Ga0070690_1001115442 148
88 3300005331 Ga0070670_100010922 Ga0070670_1000109224 148
89 3300005336 Ga0070680_101044629 Ga0070680_1010446291 148
90 3300005337 Ga0070682_100018483 Ga0070682_1000184834 148
91 3300005339 Ga0070660_100041503 Ga0070660_1000415034 148
92 3300005345 Ga0070692_10004375 Ga0070692_100043754 148
93 3300005345 Ga0070692_10066156 Ga0070692_100661562 148
94 3300005353 Ga0070669_100012524 Ga0070669_1000125249 148
95 3300005354 Ga0070675_100002114 Ga0070675_10000211410 148
96 3300005354 Ga0070675_100831336 Ga0070675_1008313361 148
97 3300005356 Ga0070674_100014575 Ga0070674_1000145755 148
98 3300005356 Ga0070674_100661206 Ga0070674_1006612062 148
99 3300005364 Ga0070673_100018298 Ga0070673_1000182983 148
100 3300005364 Ga0070673_101928637 Ga0070673_1019286371 148
101 3300005365 Ga0070688_100002293 Ga0070688_1000022939 148
102 3300005440 Ga0070705_100053724 Ga0070705_1000537242 148
103 3300005440 Ga0070705_100147212 Ga0070705_1001472123 148
104 3300005441 Ga0070700_100001617 Ga0070700_10000161713 148
105 3300005441 Ga0070700_100079941 Ga0070700_1000799412 148
106 3300005444 Ga0070694_100026368 Ga0070694_1000263683 148
107 3300005444 Ga0070694_100038298 Ga0070694_1000382985 148
108 3300005444 Ga0070694_100244373 Ga0070694_1002443731 148
109 3300005444 Ga0070694_100310697 Ga0070694_1003106972 148
110 3300005445 Ga0070708_100000387 Ga0070708_10000038713 148
111 3300005445 Ga0070708_100255794 Ga0070708_1002557944 148
112 3300005445 Ga0070708_100296970 Ga0070708_1002969702 148
113 3300005455 Ga0070663_100045208 Ga0070663_1000452081 148
114 3300005456 Ga0070678_100040841 Ga0070678_1000408414 148
115 3300005457 Ga0070662_100001685 Ga0070662_10000168513 148
116 3300005459 Ga0068867_100024134 Ga0068867_1000241344 148
117 3300005466 Ga0070685_10008107 Ga0070685_100081078 148
118 3300005466 Ga0070685_10384452 Ga0070685_103844521 148
119 3300005467 Ga0070706_100000515 Ga0070706_10000051534 148
120 3300005467 Ga0070706_100031239 Ga0070706_1000312395 148
121 3300005467 Ga0070706_100053653 Ga0070706_1000536533 148
122 3300005468 Ga0070707_100001618 Ga0070707_10000161815 148
123 3300005468 Ga0070707_100002066 Ga0070707_10000206616 148
124 3300005468 Ga0070707_100088413 Ga0070707_1000884133 148
125 3300005471 Ga0070698_100048760 Ga0070698_1000487602 148
126 3300005471 Ga0070698_101302087 Ga0070698_1013020872 148
127 3300005518 Ga0070699_100005863 Ga0070699_10000586311 148
128 3300005535 Ga0070684_100057919 Ga0070684_1000579192 148
129 3300005536 Ga0070697_100612946 Ga0070697_1006129461 148
130 3300005543 Ga0070672_100042945 Ga0070672_1000429454 148
131 3300005544 Ga0070686_100010254 Ga0070686_1000102544 148
132 3300005545 Ga0070695_100014873 Ga0070695_1000148734 148
133 3300005545 Ga0070695_100153537 Ga0070695_1001535373 148
134 3300005545 Ga0070695_100215840 Ga0070695_1002158402 148
135 3300005546 Ga0070696_100063072 Ga0070696_1000630722 148
136 3300005546 Ga0070696_100142282 Ga0070696_1001422822 148
137 3300005546 Ga0070696_100152257 Ga0070696_1001522572 148
138 3300005546 Ga0070696_100329513 Ga0070696_1003295132 148
139 3300005546 Ga0070696_100340147 Ga0070696_1003401471 148
140 3300005547 Ga0070693_100012108 Ga0070693_1000121082 148
141 3300005547 Ga0070693_100725146 Ga0070693_1007251462 148
142 3300005549 Ga0070704_100017007 Ga0070704_1000170074 148
143 3300005549 Ga0070704_100091874 Ga0070704_1000918743 148
144 3300005549 Ga0070704_100221459 Ga0070704_1002214593 148
145 3300005549 Ga0070704_100320446 Ga0070704_1003204462 148
146 3300005549 Ga0070704_100783213 Ga0070704_1007832132 148
147 3300005563 Ga0068855_100197078 Ga0068855_1001970782 148
148 3300005564 Ga0070664_100032350 Ga0070664_1000323504 148
149 3300005577 Ga0068857_100558657 Ga0068857_1005586572 148
150 3300005578 Ga0068854_100221921 Ga0068854_1002219212 148
151 3300005615 Ga0070702_100004660 Ga0070702_1000046603 148
152 3300005616 Ga0068852_100444105 Ga0068852_1004441052 148
153 3300005617 Ga0068859_101362524 Ga0068859_1013625242 148
154 3300005618 Ga0068864_100014386 Ga0068864_1000143863 148
155 3300005840 Ga0068870_10031019 Ga0068870_100310194 148
156 3300005843 Ga0068860_100032595 Ga0068860_1000325957 148
157 3300005843 Ga0068860_100139564 Ga0068860_1001395642 148
158 3300005844 Ga0068862_100468594 Ga0068862_1004685942 148
159 3300005985 Ga0081539_10010249 Ga0081539_100102497 148
160 3300006358 Ga0068871_100287532 Ga0068871_1002875322 148
161 3300006844 Ga0075428_100523872 Ga0075428_1005238722 148
162 3300006847 Ga0075431_100076099 Ga0075431_1000760994 148
163 3300006852 Ga0075433_10154245 Ga0075433_101542452 148
164 3300006852 Ga0075433_10926137 Ga0075433_109261371 148
165 3300006852 Ga0075433_10961164 Ga0075433_109611642 148
166 3300006871 Ga0075434_100015047 Ga0075434_1000150471 148
167 3300006881 Ga0068865_100020101 Ga0068865_1000201014 148
168 3300006914 Ga0075436_100556831 Ga0075436_1005568312 148
169 3300006931 Ga0097620_101362899 Ga0097620_1013628992 148
170 3300007076 Ga0075435_101582340 Ga0075435_1015823401 148
171 3300009094 Ga0111539_10167466 Ga0111539_101674663 148
172 3300009094 Ga0111539_10276063 Ga0111539_102760632 148
173 3300009094 Ga0111539_10286929 Ga0111539_102869293 148
174 3300009094 Ga0111539_11012302 Ga0111539_110123022 148
175 3300009098 Ga0105245_10032092 Ga0105245_100320925 148
176 3300009098 Ga0105245_10549772 Ga0105245_105497722 148
177 3300009098 Ga0105245_11765430 Ga0105245_117654302 148
178 3300009147 Ga0114129_10158105 Ga0114129_101581053 148
179 3300009147 Ga0114129_10173305 Ga0114129_101733052 148
180 3300009147 Ga0114129_10195999 Ga0114129_101959994 148
181 3300009147 Ga0114129_10262625 Ga0114129_102626253 148
182 3300009148 Ga0105243_10094725 Ga0105243_100947252 148
183 3300009148 Ga0105243_10910598 Ga0105243_109105981 148
184 3300009176 Ga0105242_11219987 Ga0105242_112199872 148
185 3300009177 Ga0105248_10018770 Ga0105248_100187705 148
186 3300009177 Ga0105248_11649702 Ga0105248_116497022 148
187 3300009551 Ga0105238_10416724 Ga0105238_104167242 148
188 3300009553 Ga0105249_12194003 Ga0105249_121940031 148
189 3300010375 Ga0105239_10030065 Ga0105239_100300654 148
190 3300010375 Ga0105239_11448210 Ga0105239_114482102 148
191 3300010375 Ga0105239_12538608 Ga0105239_125386081 148
192 3300011119 Ga0105246_10351562 Ga0105246_103515622 148
193 3300011119 Ga0105246_11497023 Ga0105246_114970231 148
194 3300013296 Ga0157374_10285140 Ga0157374_102851402 148
195 3300013306 Ga0163162_11208769 Ga0163162_112087692 148
196 3300014325 Ga0163163_10015291 Ga0163163_100152915 148
197 3300014326 Ga0157380_10263918 Ga0157380_102639182 148
198 3300014326 Ga0157380_10320309 Ga0157380_103203092 148
199 3300014326 Ga0157380_10553070 Ga0157380_105530703 148
200 3300014326 Ga0157380_10693233 Ga0157380_106932331 148
201 3300014745 Ga0157377_10092905 Ga0157377_100929052 148
202 3300014745 Ga0157377_10769367 Ga0157377_107693672 148
203 3300014745 Ga0157377_11649891 Ga0157377_116498911 148
204 3300014969 Ga0157376_10066475 Ga0157376_100664754 148
205 3300017792 Ga0163161_10615543 Ga0163161_106155432 148
206 3300021384 Ga0213876_10198435 Ga0213876_101984352 148
207 3300025901 Ga0207688_10007418 Ga0207688_100074185 148
208 3300025901 Ga0207688_10061004 Ga0207688_100610044 148
209 3300025908 Ga0207643_10001977 Ga0207643_100019774 148
210 3300025910 Ga0207684_10015853 Ga0207684_100158532 148
211 3300025910 Ga0207684_10059022 Ga0207684_100590222 148
212 3300025912 Ga0207707_10687832 Ga0207707_106878322 148
213 3300025917 Ga0207660_10984998 Ga0207660_109849982 148
214 3300025918 Ga0207662_10007234 Ga0207662_100072341 148
215 3300025919 Ga0207657_10067017 Ga0207657_100670171 148
216 3300025921 Ga0207652_10077275 Ga0207652_100772752 148
217 3300025922 Ga0207646_10003504 Ga0207646_100035048 148
218 3300025922 Ga0207646_10009489 Ga0207646_100094897 148
219 3300025922 Ga0207646_11055288 Ga0207646_110552881 148
220 3300025923 Ga0207681_10026152 Ga0207681_100261523 148
221 3300025927 Ga0207687_10351796 Ga0207687_103517962 148
222 3300025927 Ga0207687_10530528 Ga0207687_105305282 148
223 3300025927 Ga0207687_11284584 Ga0207687_112845842 148
224 3300025931 Ga0207644_10649966 Ga0207644_106499661 148
225 3300025933 Ga0207706_10026227 Ga0207706_100262272 148
226 3300025933 Ga0207706_10037897 Ga0207706_100378975 148
227 3300025934 Ga0207686_10116870 Ga0207686_101168702 148
228 3300025935 Ga0207709_10021597 Ga0207709_100215975 148
229 3300025935 Ga0207709_10332770 Ga0207709_103327702 148
230 3300025936 Ga0207670_11015995 Ga0207670_110159952 148
231 3300025937 Ga0207669_10018663 Ga0207669_100186632 148
232 3300025937 Ga0207669_11113907 Ga0207669_111139071 148
233 3300025938 Ga0207704_10046260 Ga0207704_100462601 148
234 3300025940 Ga0207691_10049180 Ga0207691_100491802 148
235 3300025944 Ga0207661_11466856 Ga0207661_114668561 148
236 3300025945 Ga0207679_10140143 Ga0207679_101401432 148
237 3300025945 Ga0207679_11115645 Ga0207679_111156452 148
238 3300025949 Ga0207667_10274767 Ga0207667_102747672 148
239 3300026023 Ga0207677_10186878 Ga0207677_101868782 148
240 3300026041 Ga0207639_10549111 Ga0207639_105491112 148
241 3300026067 Ga0207678_10017127 Ga0207678_100171274 148
242 3300026075 Ga0207708_10003389 Ga0207708_100033891 148
243 3300026075 Ga0207708_10027249 Ga0207708_100272495 148
244 3300026089 Ga0207648_10001801 Ga0207648_100018015 148
245 3300026095 Ga0207676_10134317 Ga0207676_101343172 148
246 3300026116 Ga0207674_10513119 Ga0207674_105131192 148
247 3300026118 Ga0207675_100104565 Ga0207675_1001045652 148
248 3300026121 Ga0207683_10030915 Ga0207683_100309154 148
249 3300026142 Ga0207698_10888817 Ga0207698_108888172 148
250 3300027717 Ga0209998_10086710 Ga0209998_100867101 148
251 3300027907 Ga0207428_10032722 Ga0207428_100327224 148
252 3300028380 Ga0268265_10460043 Ga0268265_104600432 148
253 3300028381 Ga0268264_10050646 Ga0268264_100506462 148
254 3300028381 Ga0268264_10133065 Ga0268264_101330652 148
255 3300028573 Ga0265334_10022126 Ga0265334_100221262 148
256 3300028573 Ga0265334_10065206 Ga0265334_100652061 148
257 3300028653 Ga0265323_10171335 Ga0265323_101713351 148
258 3300028654 Ga0265322_10033712 Ga0265322_100337123 148
259 3300031235 Ga0265330_10225909 Ga0265330_102259092 148
260 3300031242 Ga0265329_10068760 Ga0265329_100687602 148
261 3300031344 Ga0265316_10005247 Ga0265316_1000524710 148
262 3300031548 Ga0307408_100313043 Ga0307408_1003130432 148
263 3300031548 Ga0307408_100552718 Ga0307408_1005527182 148
264 3300031711 Ga0265314_10222238 Ga0265314_102222381 148
265 3300031712 Ga0265342_10070780 Ga0265342_100707802 148
266 3300031731 Ga0307405_10044674 Ga0307405_100446742 148
267 3300031852 Ga0307410_10927381 Ga0307410_109273811 148
268 3300031903 Ga0307407_10586094 Ga0307407_105860942 148
269 3300031903 Ga0307407_10828902 Ga0307407_108289022 148
270 3300032002 Ga0307416_100376194 Ga0307416_1003761942 148
271 3300032005 Ga0307411_10607518 Ga0307411_106075182 148
272 3300032005 Ga0307411_10883470 Ga0307411_108834701 148
273 3300032126 Ga0307415_100003134 Ga0307415_1000031345 148
274 3300032137 Ga0316585_10041418 Ga0316585_100414183 148
275 3300035092 Ga0373952_0096559 Ga0373952_0096559_148_594 148
276 3300035112 Ga0373932_0041631 Ga0373932_0041631_330_776 148
277 3300035114 Ga0373939_0024984 Ga0373939_0024984_190_636 148
278 3300035121 Ga0373960_0011324 Ga0373960_0011324_342_788 148
279 3300035170 Ga0373943_0714629 Ga0373943_0714629_76_522 148
280 3300035241 Ga0373961_0266147 Ga0373961_0266147_40_486 148
281 3300035242 Ga0373962_0032360 Ga0373962_0032360_10_456 148
282 3300035691 Ga0373931_0018179 Ga0373931_0018179_1059_1505 148
283 3300035725 Ga0373947_0443895 Ga0373947_0443895_210_656 148
284 3300037068 Ga0373925_0388707 Ga0373925_0388707_672_1118 148
285 3300039437 Ga0436365_1327079 Ga0436365_1327079_535_981 148
286 3300041496 Ga0451839_0015487 Ga0451839_0015487_156_602 148
287 3300041512 Ga0451853_1192951 Ga0451853_1192951_52_498 148
288 3300041512 Ga0451853_1686535 Ga0451853_1686535_126_572 148
289 3300042142 Ga0450905_050828 Ga0450905_050828_116_565 148
290 3300042156 Ga0439446_0089238 Ga0439446_0089238_419_874 148
291 3300042435 Ga0439434_0048658 Ga0439434_0048658_734_1189 148
292 3300042876 Ga0451577_0056335 Ga0451577_0056335_1184_1630 148
293 3300044712 Ga0453684_0596437 Ga0453684_0596437_145_591 148
294 3300044712 Ga0453684_0652820 Ga0453684_0652820_277_723 148
295 3300044901 Ga0466960_0338237 Ga0466960_0338237_333_782 148
296 3300046459 Ga0495629_0124149 Ga0495629_0124149_855_1301 148
297 3300046463 Ga0495653_0586707 Ga0495653_0586707_202_648 148
298 3300046473 Ga0495582_0154444 Ga0495582_0154444_253_699 148
299 3300046642 Ga0495634_0630184 Ga0495634_0630184_29_475 148
300 3300046681 Ga0495647_0081794 Ga0495647_0081794_362_808 148
301 3300046683 Ga0495658_0280954 Ga0495658_0280954_177_629 148
302 3300046683 Ga0495658_0434854 Ga0495658_0434854_255_701 148
303 3300046690 Ga0495624_0170262 Ga0495624_0170262_332_778 148
304 3300047321 Ga0495676_0114675 Ga0495676_0114675_232_678 148
305 3300047321 Ga0495676_0291427 Ga0495676_0291427_278_724 148
306 3300047673 Ga0495593_0085573 Ga0495593_0085573_132_584 148
307 3300048903 Ga0496100_0408499 Ga0496100_0408499_110_556 148
308 3300048905 Ga0496102_0025636 Ga0496102_0025636_1272_1718 148
309 3300048905 Ga0496102_0158611 Ga0496102_0158611_117_563 148
310 3300048906 Ga0496103_0024446 Ga0496103_0024446_2787_3233 148
311 3300048906 Ga0496103_0089675 Ga0496103_0089675_601_1047 148
312 3300048906 Ga0496103_0553984 Ga0496103_0553984_209_655 148
313 3300048907 Ga0496104_0094596 Ga0496104_0094596_455_901 148
314 3300048908 Ga0496105_0042239 Ga0496105_0042239_2357_2803 148
315 3300048909 Ga0496106_0055775 Ga0496106_0055775_462_908 148
316 3300048910 Ga0496107_0115298 Ga0496107_0115298_755_1201 148
317 3300048911 Ga0496108_0006839 Ga0496108_0006839_4873_5319 148
318 3300048911 Ga0496108_0035999 Ga0496108_0035999_1974_2420 148
319 3300048912 Ga0496109_0237041 Ga0496109_0237041_61_507 148
320 3300048912 Ga0496109_0270560 Ga0496109_0270560_690_1136 148
321 3300048912 Ga0496109_0440039 Ga0496109_0440039_199_645 148
322 3300048912 Ga0496109_1456388 Ga0496109_1456388_137_583 148
323 3300048913 Ga0496110_0057009 Ga0496110_0057009_2964_3410 148
324 3300048914 Ga0496111_0025396 Ga0496111_0025396_1484_1930 148
325 3300048914 Ga0496111_0176673 Ga0496111_0176673_834_1280 148
326 3300048915 Ga0496112_0017218 Ga0496112_0017218_2308_2754 148
327 3300048916 Ga0496113_0015627 Ga0496113_0015627_4025_4471 148
328 3300048917 Ga0496114_0198919 Ga0496114_0198919_861_1307 148
329 3300049568 Ga0501031_0222789 Ga0501031_0222789_447_893 148
330 3300049568 Ga0501031_0365804 Ga0501031_0365804_441_887 148
331 3300049569 Ga0501032_0037325 Ga0501032_0037325_2809_3255 148
332 3300049572 Ga0501036_0178844 Ga0501036_0178844_985_1431 148
333 3300049572 Ga0501036_0766766 Ga0501036_0766766_133_579 148
334 3300049574 Ga0501038_0274233 Ga0501038_0274233_664_1110 148
335 3300049574 Ga0501038_0728861 Ga0501038_0728861_87_533 148
336 3300049575 Ga0501039_0036428 Ga0501039_0036428_98_544 148
337 3300049575 Ga0501039_0653320 Ga0501039_0653320_95_541 148
338 3300049576 Ga0501040_0011475 Ga0501040_0011475_90_536 148
339 3300049576 Ga0501040_0659038 Ga0501040_0659038_35_481 148
340 3300049576 Ga0501040_0993698 Ga0501040_0993698_118_564 148
341 3300049577 Ga0501041_0014197 Ga0501041_0014197_3837_4283 148
342 3300049577 Ga0501041_0137298 Ga0501041_0137298_471_917 148
343 3300049578 Ga0501042_0787099 Ga0501042_0787099_149_595 148
344 3300049579 Ga0501043_0881883 Ga0501043_0881883_81_527 148
345 3300049580 Ga0501046_0069359 Ga0501046_0069359_217_663 148
346 3300049580 Ga0501046_0162441 Ga0501046_0162441_417_863 148
347 3300049580 Ga0501046_0316617 Ga0501046_0316617_297_743 148
348 3300049582 Ga0501048_0025214 Ga0501048_0025214_364_810 148
349 3300049583 Ga0501067_0190624 Ga0501067_0190624_597_1043 148
350 3300049584 Ga0501068_0008125 Ga0501068_0008125_4876_5322 148
351 3300049585 Ga0501069_0007839 Ga0501069_0007839_218_664 148
352 3300049585 Ga0501069_0146912 Ga0501069_0146912_84_530 148
353 3300049585 Ga0501069_0185430 Ga0501069_0185430_78_524 148
354 3300049587 Ga0501071_0043038 Ga0501071_0043038_1640_2086 148
355 3300049587 Ga0501071_0722370 Ga0501071_0722370_121_567 148
356 3300049587 Ga0501071_0822008 Ga0501071_0822008_194_640 148
357 3300049587 Ga0501071_1231170 Ga0501071_1231170_11_457 148
358 3300049588 Ga0501072_0159700 Ga0501072_0159700_1262_1708 148
359 3300049588 Ga0501072_0174587 Ga0501072_0174587_1097_1543 148
360 3300049588 Ga0501072_0390092 Ga0501072_0390092_441_887 148
361 3300049588 Ga0501072_0435673 Ga0501072_0435673_455_901 148
362 3300049588 Ga0501072_0520421 Ga0501072_0520421_455_901 148
363 3300049589 Ga0501073_0051430 Ga0501073_0051430_157_603 148
364 3300049589 Ga0501073_0507541 Ga0501073_0507541_25_471 148
365 3300049590 Ga0501074_0040186 Ga0501074_0040186_335_781 148
366 3300049590 Ga0501074_0369288 Ga0501074_0369288_444_890 148
367 3300049590 Ga0501074_0385887 Ga0501074_0385887_273_719 148
368 3300049591 Ga0501075_0094997 Ga0501075_0094997_1506_1952 148
369 3300049591 Ga0501075_0298227 Ga0501075_0298227_590_1054 148
370 3300049591 Ga0501075_0466517 Ga0501075_0466517_212_658 148
371 3300049592 Ga0501076_0246671 Ga0501076_0246671_248_694 148
372 3300049593 Ga0501077_0051715 Ga0501077_0051715_286_732 148
373 3300049593 Ga0501077_0231871 Ga0501077_0231871_168_614 148
374 3300049593 Ga0501077_0574872 Ga0501077_0574872_49_495 148
375 3300049741 Ga0501079_0007714 Ga0501079_0007714_1363_1809 148
376 3300049741 Ga0501079_0176607 Ga0501079_0176607_533_1015 148
377 3300049741 Ga0501079_0548195 Ga0501079_0548195_226_672 148
378 3300049741 Ga0501079_0915323 Ga0501079_0915323_165_623 148
379 3300049742 Ga0501080_0014339 Ga0501080_0014339_3347_3793 148
380 3300049743 Ga0501081_0020491 Ga0501081_0020491_3335_3781 148
381 3300049743 Ga0501081_0159974 Ga0501081_0159974_281_727 148
382 3300049744 Ga0501083_0076071 Ga0501083_0076071_13_462 148
383 3300049824 Ga0501045_0082681 Ga0501045_0082681_544_990 148
384 3300049824 Ga0501045_0715635 Ga0501045_0715635_54_500 148
385 3300049824 Ga0501045_0751871 Ga0501045_0751871_139_585 148
386 3300050507 nmdc:mga05p37_432798_c1 nmdc:mga05p37_432798_c1_60_548 148
387 3300050507 nmdc:mga05p37_924498_c1 nmdc:mga05p37_924498_c1_465_911 148
388 3300050510 nmdc:mga06r32_664660_c1 nmdc:mga06r32_664660_c1_550_996 148
389 3300050511 nmdc:mga08y16_124928_c1 nmdc:mga08y16_124928_c1_294_740 148
390 3300050511 nmdc:mga08y16_195697_c1 nmdc:mga08y16_195697_c1_277_723 148
391 3300050511 nmdc:mga08y16_30556_c1 nmdc:mga08y16_30556_c1_3949_4422 148
392 3300050511 nmdc:mga08y16_462195_c1 nmdc:mga08y16_462195_c1_745_1191 148
393 3300050512 nmdc:mga0n895_612327_c1 nmdc:mga0n895_612327_c1_446_892 148
394 3300050513 nmdc:mga0rr50_1281828_c1 nmdc:mga0rr50_1281828_c1_81_527 148
395 3300050513 nmdc:mga0rr50_27298_c1 nmdc:mga0rr50_27298_c1_3504_3950 148
396 3300050514 nmdc:mga08x19_232098_c1 nmdc:mga08x19_232098_c1_663_1109 148
397 3300050514 nmdc:mga08x19_287852_c1 nmdc:mga08x19_287852_c1_664_1110 148
398 3300050515 nmdc:mga0a205_208353_c1 nmdc:mga0a205_208353_c1_1009_1455 148
399 3300050515 nmdc:mga0a205_230772_c1 nmdc:mga0a205_230772_c1_827_1273 148
400 3300050515 nmdc:mga0a205_343351_c1 nmdc:mga0a205_343351_c1_242_688 148
401 3300053078 Ga0495612_0014255 Ga0495612_0014255_2398_2844 148
402 3300054114 Ga0501084_0035771 Ga0501084_0035771_1386_1832 148
403 3300054114 Ga0501084_0153673 Ga0501084_0153673_399_845 148
404 3300054114 Ga0501084_0473846 Ga0501084_0473846_446_892 148
405 3300054114 Ga0501084_0770016 Ga0501084_0770016_45_491 148
406 3300059421 Ga0590071_000361 Ga0590071_000361_8706_9155 148
407 3300059423 Ga0590074_013458 Ga0590074_013458_536_985 148
408 3300061734 Ga0530510_0056858 Ga0530510_0056858_1133_1579 148
409 3300061734 Ga0530510_0329935 Ga0530510_0329935_454_900 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

1

133

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9136 1 144
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.913 3 145
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9017 3 145
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.8945 3 145
3knp-assembly3.cif.gz_E crystal structure of dtd from plasmodium falciparum 0.8845 1 144
ID Description Score Start End Superfamily
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9136 1 144 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.913 3 145 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.8945 3 145 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.8881 3 147 3.50.80.10
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.885 3 147 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A382ZUF0-F1-model_v4 D-aminoacyl-tRNA deacylase 0.9953 33 128 GO:0005737
GO:0051500
AF-A0A3N5RD52-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.992 1 84 GO:0005737
GO:0051500
AF-A0A7Y3BWC1-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9918 1 83 GO:0005737
GO:0016020
GO:0051500
AF-A0A3B9TR69-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9906 28 127 GO:0005737
GO:0051500
AF-A0A1F7IIQ7-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9904 1 127 GO:0005737
GO:0051500

Feature Viewer

pLDDT pTM Quality
92.03 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map