F436986

General Info

Members Datasets Scaffolds Average Seq Length
409 235 818 188

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10657283|Ga0105239_106572831
Length 186
Sequence MDYSILVKDCLKGKPTAQKQLYDHFAPSMFSVCYRYTKSVADAEDVLQEGFVKVFFNLNQYKFQGELGGWIRRVMVTTAINYLKRNSRYQTDLLFPDEQLHVVNNEAHPEIKMEAKELADLIRQLPPGYQTIFNLYGVEGFNHVEIGKILGIKEGTSRSQYARARALLIQWIEQKEKGIKKAVYAK

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
165 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
166 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
167 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
197 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
198 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
199 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
200 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
201 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
204 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
207 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
208 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
220 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
221 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
222 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
223 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
224 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
225 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
229 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
232 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
235 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 0
Rhizoplane 0.24
Rhizosphere 91.93
Stem 0
Stem Tuber 0
Unclassified 15.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10657283 3300010375 Unclassified 1197
2 MBSR1b_contig_3275341 2162886012 Bacteria 822
3 JGI24740J21852_10071569 3300001979 Bacteria 928
4 JGI24739J22299_10111543 3300001989 Unclassified 820
5 rootH1_10083769 3300003323 Bacteria 7235
6 Ga0065712_10001097 3300005290 Bacteria 9741
7 Ga0065712_10018986 3300005290 Bacteria 1568
8 Ga0065712_10201139 3300005290 Bacteria 1108
9 Ga0065715_10106087 3300005293 Bacteria 2834
10 Ga0070658_10503547 3300005327 Bacteria 1046
11 Ga0070676_10159786 3300005328 Bacteria 1449
12 Ga0070676_10206695 3300005328 Bacteria 1290
13 Ga0070683_100209277 3300005329 Bacteria 1853
14 Ga0070683_100700658 3300005329 Bacteria 970
15 Ga0070690_100388750 3300005330 Bacteria 1022
16 Ga0070670_100066715 3300005331 Unclassified 3088
17 Ga0070670_100163046 3300005331 Bacteria 1932
18 Ga0070670_100292499 3300005331 Bacteria 1424
19 Ga0068869_100013675 3300005334 Bacteria 5405
20 Ga0068869_100043344 3300005334 Unclassified 3231
21 Ga0068869_100223711 3300005334 Bacteria 1493
22 Ga0070666_10040494 3300005335 Bacteria 3110
23 Ga0070666_10595897 3300005335 Bacteria 806
24 Ga0070680_100300014 3300005336 Bacteria 1362
25 Ga0070680_100419239 3300005336 Bacteria 1142
26 Ga0070680_100627188 3300005336 Unclassified 923
27 Ga0070682_100078243 3300005337 Bacteria 2133
28 Ga0070682_100099012 3300005337 Bacteria 1921
29 Ga0068868_100009312 3300005338 Bacteria 7061
30 Ga0070660_100048975 3300005339 Bacteria 3246
31 Ga0070660_100527523 3300005339 Bacteria 984
32 Ga0070689_100197286 3300005340 Bacteria 1642
33 Ga0070689_100836408 3300005340 Unclassified 811
34 Ga0070687_100258970 3300005343 Bacteria 1085
35 Ga0070687_100576205 3300005343 Bacteria 770
36 Ga0070661_100013357 3300005344 Bacteria 5763
37 Ga0070692_10725635 3300005345 Bacteria 671
38 Ga0070669_100080372 3300005353 Bacteria 2426
39 Ga0070669_100584056 3300005353 Bacteria 935
40 Ga0070675_100014690 3300005354 Bacteria 6176
41 Ga0070675_100055497 3300005354 Bacteria 3261
42 Ga0070675_100974952 3300005354 Bacteria 778
43 Ga0070671_100359115 3300005355 Bacteria 1244
44 Ga0070673_100041154 3300005364 Bacteria 3550
45 Ga0070673_100129577 3300005364 Bacteria 2115
46 Ga0070673_100285140 3300005364 Bacteria 1450
47 Ga0070688_100042765 3300005365 Bacteria 2788
48 Ga0070659_100007706 3300005366 Bacteria 7830
49 Ga0070667_100687089 3300005367 Bacteria 946
50 Ga0070701_10420536 3300005438 Bacteria 851
51 Ga0070694_100283415 3300005444 Bacteria 1264
52 Ga0070663_100459125 3300005455 Bacteria 1051
53 Ga0070663_100625825 3300005455 Unclassified 908
54 Ga0070678_100545037 3300005456 Unclassified 1029
55 Ga0070662_100010406 3300005457 Bacteria 6101
56 Ga0070662_101077638 3300005457 Bacteria 689
57 Ga0070681_10035211 3300005458 Bacteria 5029
58 Ga0070681_10214606 3300005458 Bacteria 1841
59 Ga0068867_100050594 3300005459 Unclassified 3063
60 Ga0068867_100132332 3300005459 Unclassified 1940
61 Ga0068867_100299002 3300005459 Bacteria 1326
62 Ga0070685_10003737 3300005466 Bacteria 7706
63 Ga0070685_10039223 3300005466 Unclassified 2689
64 Ga0070685_10233941 3300005466 Bacteria 1210
65 Ga0070698_100000658 3300005471 Bacteria 36954
66 Ga0070698_100001549 3300005471 Bacteria 25509
67 Ga0070698_100002888 3300005471 Bacteria 18914
68 Ga0070699_100210373 3300005518 Bacteria 1731
69 Ga0070679_100036257 3300005530 Bacteria 4894
70 Ga0070679_100152854 3300005530 Bacteria 2284
71 Ga0070684_100103602 3300005535 Bacteria 2545
72 Ga0068853_100009991 3300005539 Bacteria 7664
73 Ga0068853_100074795 3300005539 Bacteria 2956
74 Ga0068853_100181880 3300005539 Bacteria 1907
75 Ga0068853_100340841 3300005539 Bacteria 1393
76 Ga0068853_100537063 3300005539 Bacteria 1107
77 Ga0070672_100748198 3300005543 Bacteria 858
78 Ga0070693_100275676 3300005547 Unclassified 1124
79 Ga0070704_100303535 3300005549 Bacteria 1331
80 Ga0068855_100023869 3300005563 Bacteria 7325
81 Ga0070664_100012972 3300005564 Bacteria 6780
82 Ga0070664_101744764 3300005564 Unclassified 590
83 Ga0068857_100116032 3300005577 Bacteria 2409
84 Ga0068857_100281853 3300005577 Unclassified 1529
85 Ga0068854_100045827 3300005578 Bacteria 3111
86 Ga0068854_100721316 3300005578 Bacteria 862
87 Ga0068854_100851123 3300005578 Bacteria 798
88 Ga0068856_100016191 3300005614 Bacteria 7213
89 Ga0068856_100039397 3300005614 Bacteria 4640
90 Ga0068856_100047142 3300005614 Bacteria 4245
91 Ga0068852_100000991 3300005616 Bacteria 18727
92 Ga0068852_100006007 3300005616 Bacteria 8746
93 Ga0068852_100124521 3300005616 Bacteria 2364
94 Ga0068852_100224041 3300005616 Bacteria 1790
95 Ga0068852_100522355 3300005616 Bacteria 1185
96 Ga0068852_100940374 3300005616 Bacteria 882
97 Ga0068859_100050695 3300005617 Unclassified 4170
98 Ga0068859_100096088 3300005617 Bacteria 3016
99 Ga0068859_100125143 3300005617 Bacteria 2639
100 Ga0068859_100183856 3300005617 Bacteria 2173
101 Ga0068859_100639531 3300005617 Bacteria 1156
102 Ga0068859_101550241 3300005617 Bacteria 731
103 Ga0068864_100004459 3300005618 Bacteria 11504
104 Ga0068864_100047817 3300005618 Unclassified 3676
105 Ga0068864_100617023 3300005618 Bacteria 1054
106 Ga0068864_101795549 3300005618 Bacteria 618
107 Ga0068861_100004775 3300005719 Bacteria 9112
108 Ga0068861_100430539 3300005719 Bacteria 1177
109 Ga0068851_10153947 3300005834 Bacteria 1259
110 Ga0068851_10186755 3300005834 Bacteria 1150
111 Ga0068863_100160353 3300005841 Bacteria 2155
112 Ga0068863_100613775 3300005841 Bacteria 1077
113 Ga0068858_100007710 3300005842 Bacteria 10391
114 Ga0068858_100960608 3300005842 Bacteria 837
115 Ga0068860_100001310 3300005843 Bacteria 27050
116 Ga0068860_100406765 3300005843 Bacteria 1347
117 Ga0068860_100573521 3300005843 Bacteria 1132
118 Ga0068860_100849961 3300005843 Bacteria 927
119 Ga0068862_100642785 3300005844 Bacteria 1022
120 Ga0068862_100664141 3300005844 Bacteria 1006
121 Ga0070715_10039955 3300006163 Bacteria 1958
122 Ga0075366_10258983 3300006195 Bacteria 1062
123 Ga0097621_100032063 3300006237 Bacteria 4175
124 Ga0097621_100270392 3300006237 Bacteria 1493
125 Ga0068871_100003430 3300006358 Bacteria 10905
126 Ga0068871_100009885 3300006358 Bacteria 6926
127 Ga0075428_100004080 3300006844 Bacteria 16060
128 Ga0075428_100046250 3300006844 Bacteria 4780
129 Ga0075428_100118935 3300006844 Unclassified 2877
130 Ga0075428_100665561 3300006844 Bacteria 1110
131 Ga0075428_100937114 3300006844 Bacteria 918
132 Ga0075430_100002152 3300006846 Bacteria 16306
133 Ga0075431_100012347 3300006847 Bacteria 8619
134 Ga0075431_100505848 3300006847 Bacteria 1199
135 Ga0075429_100045778 3300006880 Bacteria 3806
136 Ga0075429_100135283 3300006880 Bacteria 2157
137 Ga0075429_101272148 3300006880 Bacteria 642
138 Ga0068865_100100911 3300006881 Bacteria 2113
139 Ga0068865_100680397 3300006881 Unclassified 877
140 Ga0097620_100050693 3300006931 Unclassified 4170
141 Ga0097620_100096087 3300006931 Bacteria 3016
142 Ga0097620_100125144 3300006931 Bacteria 2639
143 Ga0097620_100183846 3300006931 Bacteria 2173
144 Ga0097620_100639527 3300006931 Bacteria 1156
145 Ga0097620_101550223 3300006931 Bacteria 731
146 Ga0105240_10021043 3300009093 Bacteria 8682
147 Ga0105240_10234906 3300009093 Bacteria 2128
148 Ga0111539_10121834 3300009094 Bacteria 3056
149 Ga0111539_10193332 3300009094 Bacteria 2374
150 Ga0111539_10199764 3300009094 Bacteria 2332
151 Ga0111539_10676752 3300009094 Bacteria 1201
152 Ga0105247_10195039 3300009101 Bacteria 1358
153 Ga0114129_10036931 3300009147 Bacteria 6897
154 Ga0114129_10101824 3300009147 Bacteria 3973
155 Ga0114129_10333954 3300009147 Bacteria 2012
156 Ga0114129_10411472 3300009147 Unclassified 1781
157 Ga0114129_10545339 3300009147 Bacteria 1509
158 Ga0105241_10005706 3300009174 Bacteria 9188
159 Ga0105241_10457807 3300009174 Bacteria 1130
160 Ga0105241_11303729 3300009174 Bacteria 692
161 Ga0105242_10003712 3300009176 Bacteria 11876
162 Ga0105248_10367091 3300009177 Bacteria 1620
163 Ga0105237_10083320 3300009545 Bacteria 3189
164 Ga0105249_10011151 3300009553 Bacteria 7896
165 Ga0105249_10184665 3300009553 Bacteria 2031
166 Ga0105239_10001398 3300010375 Bacteria 32312
167 Ga0105239_10039979 3300010375 Bacteria 5137
168 Ga0105239_10275134 3300010375 Bacteria 1894
169 Ga0105246_10490886 3300011119 Bacteria 1041
170 Ga0157373_10041433 3300013100 Bacteria 3294
171 Ga0157371_10078543 3300013102 Bacteria 2338
172 Ga0157370_10056359 3300013104 Bacteria 3740
173 Ga0157369_10033409 3300013105 Bacteria 5654
174 Ga0157369_10894188 3300013105 Unclassified 911
175 Ga0157374_10004911 3300013296 Bacteria 11221
176 Ga0157374_10019348 3300013296 Bacteria 6026
177 Ga0157378_10009231 3300013297 Bacteria 8591
178 Ga0157378_10441781 3300013297 Bacteria 1290
179 Ga0157378_10460580 3300013297 Unclassified 1263
180 Ga0163162_10114750 3300013306 Bacteria 2793
181 Ga0163162_10207489 3300013306 Bacteria 2089
182 Ga0163162_10308296 3300013306 Bacteria 1715
183 Ga0157372_10054037 3300013307 Bacteria 4479
184 Ga0157372_10127920 3300013307 Unclassified 2921
185 Ga0157372_10623687 3300013307 Unclassified 1256
186 Ga0157372_10678071 3300013307 Bacteria 1200
187 Ga0157372_10987917 3300013307 Unclassified 975
188 Ga0157372_11463924 3300013307 Bacteria 787
189 Ga0157372_11768775 3300013307 Unclassified 711
190 Ga0157375_10111334 3300013308 Bacteria 2837
191 Ga0157375_10587949 3300013308 Bacteria 1273
192 Ga0163163_10128381 3300014325 Bacteria 2574
193 Ga0163163_10388321 3300014325 Bacteria 1454
194 Ga0163163_10501793 3300014325 Bacteria 1275
195 Ga0163163_10823294 3300014325 Unclassified 992
196 Ga0157380_10000556 3300014326 Bacteria 22954
197 Ga0157380_10132812 3300014326 Bacteria 2126
198 Ga0157380_10282056 3300014326 Bacteria 1521
199 Ga0157380_10492295 3300014326 Bacteria 1189
200 Ga0157377_10018177 3300014745 Bacteria 3652
201 Ga0157379_10027351 3300014968 Bacteria 5078
202 Ga0157379_11089288 3300014968 Bacteria 765
203 Ga0157376_10123211 3300014969 Bacteria 2301
204 Ga0163161_10036648 3300017792 Unclassified 3513
205 Ga0163161_10509086 3300017792 Bacteria 981
206 Ga0209646_1003827 3300025246 Bacteria 2872
207 Ga0207697_10154639 3300025315 Bacteria 999
208 Ga0207656_10044305 3300025321 Unclassified 1899
209 Ga0207682_10028698 3300025893 Bacteria 2222
210 Ga0207688_10220572 3300025901 Bacteria 1142
211 Ga0207680_10055466 3300025903 Bacteria 2388
212 Ga0207647_10079800 3300025904 Bacteria 1964
213 Ga0207643_10007246 3300025908 Bacteria 5953
214 Ga0207705_10132577 3300025909 Unclassified 1855
215 Ga0207705_10861213 3300025909 Bacteria 702
216 Ga0207654_10011712 3300025911 Bacteria 4477
217 Ga0207695_10386959 3300025913 Bacteria 1284
218 Ga0207671_10086888 3300025914 Bacteria 2351
219 Ga0207671_10162525 3300025914 Unclassified 1730
220 Ga0207663_10726199 3300025916 Unclassified 788
221 Ga0207660_10776030 3300025917 Unclassified 782
222 Ga0207662_10026461 3300025918 Bacteria 3346
223 Ga0207657_10050892 3300025919 Bacteria 3602
224 Ga0207657_10516601 3300025919 Bacteria 935
225 Ga0207649_11028099 3300025920 Bacteria 649
226 Ga0207652_10366608 3300025921 Bacteria 1300
227 Ga0207652_10818044 3300025921 Unclassified 826
228 Ga0207681_10036826 3300025923 Bacteria 3230
229 Ga0207681_10745337 3300025923 Bacteria 816
230 Ga0207650_10025119 3300025925 Unclassified 4242
231 Ga0207650_10104152 3300025925 Unclassified 2189
232 Ga0207650_10186371 3300025925 Bacteria 1656
233 Ga0207650_10468621 3300025925 Bacteria 1050
234 Ga0207659_10061233 3300025926 Unclassified 2712
235 Ga0207659_10128479 3300025926 Bacteria 1952
236 Ga0207659_10316002 3300025926 Bacteria 1287
237 Ga0207700_10486933 3300025928 Bacteria 1090
238 Ga0207644_11239925 3300025931 Bacteria 627
239 Ga0207690_10199927 3300025932 Bacteria 1517
240 Ga0207706_10017560 3300025933 Bacteria 6447
241 Ga0207686_10001202 3300025934 Bacteria 15019
242 Ga0207704_10473393 3300025938 Bacteria 1004
243 Ga0207691_10044264 3300025940 Bacteria 4098
244 Ga0207689_10015088 3300025942 Bacteria 6550
245 Ga0207689_10148961 3300025942 Bacteria 1929
246 Ga0207689_10299518 3300025942 Bacteria 1333
247 Ga0207689_10666649 3300025942 Bacteria 877
248 Ga0207679_10206002 3300025945 Bacteria 1646
249 Ga0207667_10019616 3300025949 Bacteria 7541
250 Ga0207667_10025354 3300025949 Bacteria 6491
251 Ga0207667_10081611 3300025949 Bacteria 3349
252 Ga0207651_10188008 3300025960 Bacteria 1645
253 Ga0207651_10392664 3300025960 Bacteria 1178
254 Ga0207712_10009068 3300025961 Bacteria 6291
255 Ga0207640_10157629 3300025981 Unclassified 1675
256 Ga0207640_10972850 3300025981 Bacteria 745
257 Ga0207658_11202033 3300025986 Bacteria 693
258 Ga0207677_10058297 3300026023 Bacteria 2658
259 Ga0207703_10480408 3300026035 Bacteria 1164
260 Ga0207639_10049846 3300026041 Bacteria 3177
261 Ga0207639_10078207 3300026041 Bacteria 2610
262 Ga0207639_10366767 3300026041 Unclassified 1290
263 Ga0207708_10174550 3300026075 Bacteria 1704
264 Ga0207708_10662356 3300026075 Bacteria 889
265 Ga0207702_10095990 3300026078 Bacteria 2606
266 Ga0207702_10187474 3300026078 Bacteria 1909
267 Ga0207702_10271250 3300026078 Bacteria 1600
268 Ga0207641_10000969 3300026088 Bacteria 29404
269 Ga0207641_10522305 3300026088 Unclassified 1155
270 Ga0207641_10601025 3300026088 Bacteria 1077
271 Ga0207648_10453803 3300026089 Bacteria 1168
272 Ga0207648_10647717 3300026089 Bacteria 976
273 Ga0207676_10038423 3300026095 Bacteria 3653
274 Ga0207676_10375838 3300026095 Bacteria 1321
275 Ga0207676_11489633 3300026095 Bacteria 673
276 Ga0207674_10092855 3300026116 Unclassified 3007
277 Ga0207674_10102692 3300026116 Bacteria 2839
278 Ga0207674_10645175 3300026116 Bacteria 1022
279 Ga0207674_11125820 3300026116 Bacteria 754
280 Ga0207675_100006424 3300026118 Bacteria 11130
281 Ga0207675_100055812 3300026118 Bacteria 3686
282 Ga0207675_100877387 3300026118 Bacteria 913
283 Ga0207675_101265509 3300026118 Bacteria 758
284 Ga0207683_10072065 3300026121 Bacteria 3055
285 Ga0207683_10449193 3300026121 Bacteria 1188
286 Ga0207698_10013800 3300026142 Bacteria 5346
287 Ga0207698_10044943 3300026142 Bacteria 3323
288 Ga0207698_10223283 3300026142 Bacteria 1704
289 Ga0207698_11047589 3300026142 Bacteria 827
290 Ga0209982_1030553 3300027552 Bacteria 847
291 Ga0207428_10121071 3300027907 Bacteria 2006
292 Ga0207428_10216679 3300027907 Bacteria 1436
293 Ga0268265_10010453 3300028380 Bacteria 6268
294 Ga0268265_10173338 3300028380 Bacteria 1846
295 Ga0268264_10019429 3300028381 Bacteria 5552
296 Ga0268264_10607018 3300028381 Bacteria 1079
297 Ga0268264_10982269 3300028381 Bacteria 850
298 Ga0307517_10000689 3300028786 Bacteria 58121
299 Ga0265340_10073889 3300031247 Unclassified 1613
300 Ga0265340_10122519 3300031247 Bacteria 1196
301 Ga0307513_10121995 3300031456 Bacteria 2571
302 Ga0307509_10279162 3300031507 Bacteria 1433
303 Ga0265313_10060880 3300031595 Unclassified 1769
304 Ga0307508_10006223 3300031616 Bacteria 11252
305 Ga0307508_10235994 3300031616 Bacteria 1427
306 Ga0307410_10224180 3300031852 Unclassified 1448
307 Ga0307416_101115281 3300032002 Unclassified 894
308 Ga0307414_10106712 3300032004 Bacteria 2121
309 Ga0307414_10496842 3300032004 Bacteria 1079
310 Ga0307414_10743287 3300032004 Unclassified 891
311 Ga0307414_10896145 3300032004 Unclassified 813
312 Ga0307411_10917564 3300032005 Unclassified 779
313 Ga0307507_10195493 3300033179 Bacteria 1412
314 Ga0373946_0081822 3300035171 Bacteria 1415
315 Ga0373927_0035742 3300035695 Bacteria 3231
316 Ga0373925_0727463 3300037068 Unclassified 818
317 Ga0395905_0534714 3300037471 Bacteria 1073
318 Ga0436365_0849211 3300039437 Bacteria 1550
319 Ga0436365_1514287 3300039437 Bacteria 23671
320 Ga0439439_0022123 3300041406 Bacteria 1587
321 Ga0451802_1122068 3300041460 Bacteria 1358
322 Ga0451843_1742182 3300041509 Bacteria 1092
323 Ga0439457_030714 3300042014 Bacteria 1191
324 Ga0450923_011299 3300042125 Unclassified 1603
325 Ga0439446_0135551 3300042156 Bacteria 801
326 Ga0466969_0007848 3300044656 Bacteria 5670
327 Ga0466972_0000011 3300044658 Bacteria 249697
328 Ga0466965_0139419 3300044683 Bacteria 1262
329 Ga0466966_0001290 3300044684 Bacteria 16042
330 Ga0466961_0259577 3300044693 Bacteria 1066
331 Ga0466970_0516585 3300044765 Bacteria 689
332 Ga0466957_0001056 3300044842 Bacteria 14202
333 Ga0466957_0052949 3300044842 Bacteria 2473
334 Ga0466960_0585588 3300044901 Bacteria 661
335 Ga0466959_0000039 3300045049 Bacteria 101186
336 Ga0466967_0274021 3300045976 Bacteria 1617
337 Ga0495629_0634395 3300046459 Bacteria 713
338 Ga0495638_0026737 3300046460 Bacteria 3740
339 Ga0495594_0030777 3300046499 Bacteria 2907
340 Ga0495598_0089137 3300046537 Bacteria 1003
341 Ga0495621_0155178 3300046539 Bacteria 903
342 Ga0495621_0200416 3300046539 Bacteria 803
343 Ga0495668_0001220 3300046616 Bacteria 25984
344 Ga0495600_0199872 3300046809 Bacteria 1284
345 Ga0495672_0026693 3300047320 Unclassified 3681
346 Ga0501299_028523 3300049522 Bacteria 1064
347 Ga0501032_0034988 3300049569 Bacteria 3435
348 Ga0501032_0438807 3300049569 Bacteria 837
349 Ga0501033_0036379 3300049570 Bacteria 3690
350 Ga0501034_0047956 3300049571 Bacteria 4311
351 Ga0501034_0751085 3300049571 Bacteria 871
352 Ga0501037_0194440 3300049573 Bacteria 1435
353 Ga0501038_0031096 3300049574 Bacteria 4720
354 Ga0501039_0240840 3300049575 Unclassified 1422
355 Ga0501043_0093864 3300049579 Bacteria 2359
356 Ga0501047_0008167 3300049581 Bacteria 9886
357 Ga0501047_0010268 3300049581 Bacteria 8858
358 Ga0501070_0731432 3300049586 Bacteria 781
359 Ga0501201_005106 3300049651 Unclassified 1224
360 Ga0501202_129338 3300049652 Bacteria 642
361 Ga0501207_000034 3300049654 Bacteria 9772
362 Ga0501217_022936 3300049661 Unclassified 1484
363 Ga0501223_011090 3300049663 Unclassified 1809
364 Ga0501224_010128 3300049664 Unclassified 1381
365 Ga0501235_026047 3300049669 Unclassified 1309
366 Ga0501242_011571 3300049674 Unclassified 1067
367 Ga0501251_013763 3300049681 Unclassified 995
368 Ga0501257_041935 3300049686 Bacteria 1125
369 Ga0501259_001107 3300049688 Bacteria 4495
370 Ga0501261_006279 3300049690 Bacteria 1508
371 Ga0501225_0001962 3300049705 Bacteria 6434
372 Ga0501225_0023663 3300049705 Bacteria 1692
373 Ga0501083_0263740 3300049744 Bacteria 1121
374 Ga0501270_009765 3300049767 Unclassified 1248
375 Ga0501035_0257017 3300049822 Bacteria 1482
376 Ga0501035_0640693 3300049822 Unclassified 862
377 Ga0501044_0005730 3300049823 Bacteria 13761
378 Ga0501044_0192530 3300049823 Bacteria 2001
379 nmdc:mga0k408_383703_c1 3300050493 Bacteria 837
380 nmdc:mga05p37_346413_c1 3300050507 Unclassified 1750
381 nmdc:mga05p37_944449_c1 3300050507 Bacteria 924
382 nmdc:mga05p37_970_c2 3300050507 Bacteria 15674
383 nmdc:mga09592_19010_c1 3300050508 Bacteria 5638
384 nmdc:mga09592_19642_c1 3300050508 Bacteria 5548
385 nmdc:mga0qj67_68942_c1 3300050509 Unclassified 2820
386 nmdc:mga06r32_327160_c1 3300050510 Bacteria 1518
387 nmdc:mga06r32_71274_c1 3300050510 Unclassified 3362
388 nmdc:mga06r32_72311_c1 3300050510 Bacteria 3339
389 nmdc:mga08y16_258636_c1 3300050511 Bacteria 1798
390 nmdc:mga08y16_483457_c1 3300050511 Bacteria 1260
391 Ga0500578_0000027 3300053086 Bacteria 144362
392 Ga0500644_0005587 3300053088 Bacteria 3181
393 Ga0500646_0007292 3300053090 Bacteria 2824
394 Ga0500583_0000004 3300053092 Bacteria 174723
395 Ga0500583_0154407 3300053092 Bacteria 1143
396 Ga0500651_0266449 3300053093 Bacteria 992
397 Ga0500594_0141509 3300053118 Bacteria 768
398 Ga0500652_089314 3300053131 Bacteria 1286
399 Ga0500559_0040208 3300053136 Bacteria 2036
400 Ga0500568_0193629 3300053139 Bacteria 746
401 Ga0500588_0044112 3300053146 Bacteria 1359
402 Ga0500588_0073776 3300053146 Bacteria 1126
403 Ga0500604_0029433 3300053151 Bacteria 1601
404 Ga0500616_0023606 3300053153 Bacteria 3424
405 Ga0500639_079854 3300053163 Bacteria 1650
406 Ga0500636_0089211 3300053177 Bacteria 1768
407 Ga0500645_024546 3300053730 Bacteria 1842
408 Ga0500661_027637 3300055283 Bacteria 1002
409 2738727627 2738541278 Bacteria 9755573
410 Ga0105239_10657283
411 MBSR1b_contig_3275341
412 JGI24740J21852_10071569
413 JGI24739J22299_10111543
414 rootH1_10083769
415 Ga0065712_10001097
416 Ga0065712_10018986
417 Ga0065712_10201139
418 Ga0065715_10106087
419 Ga0070658_10503547
420 Ga0070676_10159786
421 Ga0070676_10206695
422 Ga0070683_100209277
423 Ga0070683_100700658
424 Ga0070690_100388750
425 Ga0070670_100066715
426 Ga0070670_100163046
427 Ga0070670_100292499
428 Ga0068869_100013675
429 Ga0068869_100043344
430 Ga0068869_100223711
431 Ga0070666_10040494
432 Ga0070666_10595897
433 Ga0070680_100300014
434 Ga0070680_100419239
435 Ga0070680_100627188
436 Ga0070682_100078243
437 Ga0070682_100099012
438 Ga0068868_100009312
439 Ga0070660_100048975
440 Ga0070660_100527523
441 Ga0070689_100197286
442 Ga0070689_100836408
443 Ga0070687_100258970
444 Ga0070687_100576205
445 Ga0070661_100013357
446 Ga0070692_10725635
447 Ga0070669_100080372
448 Ga0070669_100584056
449 Ga0070675_100014690
450 Ga0070675_100055497
451 Ga0070675_100974952
452 Ga0070671_100359115
453 Ga0070673_100041154
454 Ga0070673_100129577
455 Ga0070673_100285140
456 Ga0070688_100042765
457 Ga0070659_100007706
458 Ga0070667_100687089
459 Ga0070701_10420536
460 Ga0070694_100283415
461 Ga0070663_100459125
462 Ga0070663_100625825
463 Ga0070678_100545037
464 Ga0070662_100010406
465 Ga0070662_101077638
466 Ga0070681_10035211
467 Ga0070681_10214606
468 Ga0068867_100050594
469 Ga0068867_100132332
470 Ga0068867_100299002
471 Ga0070685_10003737
472 Ga0070685_10039223
473 Ga0070685_10233941
474 Ga0070698_100000658
475 Ga0070698_100001549
476 Ga0070698_100002888
477 Ga0070699_100210373
478 Ga0070679_100036257
479 Ga0070679_100152854
480 Ga0070684_100103602
481 Ga0068853_100009991
482 Ga0068853_100074795
483 Ga0068853_100181880
484 Ga0068853_100340841
485 Ga0068853_100537063
486 Ga0070672_100748198
487 Ga0070693_100275676
488 Ga0070704_100303535
489 Ga0068855_100023869
490 Ga0070664_100012972
491 Ga0070664_101744764
492 Ga0068857_100116032
493 Ga0068857_100281853
494 Ga0068854_100045827
495 Ga0068854_100721316
496 Ga0068854_100851123
497 Ga0068856_100016191
498 Ga0068856_100039397
499 Ga0068856_100047142
500 Ga0068852_100000991
501 Ga0068852_100006007
502 Ga0068852_100124521
503 Ga0068852_100224041
504 Ga0068852_100522355
505 Ga0068852_100940374
506 Ga0068859_100050695
507 Ga0068859_100096088
508 Ga0068859_100125143
509 Ga0068859_100183856
510 Ga0068859_100639531
511 Ga0068859_101550241
512 Ga0068864_100004459
513 Ga0068864_100047817
514 Ga0068864_100617023
515 Ga0068864_101795549
516 Ga0068861_100004775
517 Ga0068861_100430539
518 Ga0068851_10153947
519 Ga0068851_10186755
520 Ga0068863_100160353
521 Ga0068863_100613775
522 Ga0068858_100007710
523 Ga0068858_100960608
524 Ga0068860_100001310
525 Ga0068860_100406765
526 Ga0068860_100573521
527 Ga0068860_100849961
528 Ga0068862_100642785
529 Ga0068862_100664141
530 Ga0070715_10039955
531 Ga0075366_10258983
532 Ga0097621_100032063
533 Ga0097621_100270392
534 Ga0068871_100003430
535 Ga0068871_100009885
536 Ga0075428_100004080
537 Ga0075428_100046250
538 Ga0075428_100118935
539 Ga0075428_100665561
540 Ga0075428_100937114
541 Ga0075430_100002152
542 Ga0075431_100012347
543 Ga0075431_100505848
544 Ga0075429_100045778
545 Ga0075429_100135283
546 Ga0075429_101272148
547 Ga0068865_100100911
548 Ga0068865_100680397
549 Ga0097620_100050693
550 Ga0097620_100096087
551 Ga0097620_100125144
552 Ga0097620_100183846
553 Ga0097620_100639527
554 Ga0097620_101550223
555 Ga0105240_10021043
556 Ga0105240_10234906
557 Ga0111539_10121834
558 Ga0111539_10193332
559 Ga0111539_10199764
560 Ga0111539_10676752
561 Ga0105247_10195039
562 Ga0114129_10036931
563 Ga0114129_10101824
564 Ga0114129_10333954
565 Ga0114129_10411472
566 Ga0114129_10545339
567 Ga0105241_10005706
568 Ga0105241_10457807
569 Ga0105241_11303729
570 Ga0105242_10003712
571 Ga0105248_10367091
572 Ga0105237_10083320
573 Ga0105249_10011151
574 Ga0105249_10184665
575 Ga0105239_10001398
576 Ga0105239_10039979
577 Ga0105239_10275134
578 Ga0105246_10490886
579 Ga0157373_10041433
580 Ga0157371_10078543
581 Ga0157370_10056359
582 Ga0157369_10033409
583 Ga0157369_10894188
584 Ga0157374_10004911
585 Ga0157374_10019348
586 Ga0157378_10009231
587 Ga0157378_10441781
588 Ga0157378_10460580
589 Ga0163162_10114750
590 Ga0163162_10207489
591 Ga0163162_10308296
592 Ga0157372_10054037
593 Ga0157372_10127920
594 Ga0157372_10623687
595 Ga0157372_10678071
596 Ga0157372_10987917
597 Ga0157372_11463924
598 Ga0157372_11768775
599 Ga0157375_10111334
600 Ga0157375_10587949
601 Ga0163163_10128381
602 Ga0163163_10388321
603 Ga0163163_10501793
604 Ga0163163_10823294
605 Ga0157380_10000556
606 Ga0157380_10132812
607 Ga0157380_10282056
608 Ga0157380_10492295
609 Ga0157377_10018177
610 Ga0157379_10027351
611 Ga0157379_11089288
612 Ga0157376_10123211
613 Ga0163161_10036648
614 Ga0163161_10509086
615 Ga0209646_1003827
616 Ga0207697_10154639
617 Ga0207656_10044305
618 Ga0207682_10028698
619 Ga0207688_10220572
620 Ga0207680_10055466
621 Ga0207647_10079800
622 Ga0207643_10007246
623 Ga0207705_10132577
624 Ga0207705_10861213
625 Ga0207654_10011712
626 Ga0207695_10386959
627 Ga0207671_10086888
628 Ga0207671_10162525
629 Ga0207663_10726199
630 Ga0207660_10776030
631 Ga0207662_10026461
632 Ga0207657_10050892
633 Ga0207657_10516601
634 Ga0207649_11028099
635 Ga0207652_10366608
636 Ga0207652_10818044
637 Ga0207681_10036826
638 Ga0207681_10745337
639 Ga0207650_10025119
640 Ga0207650_10104152
641 Ga0207650_10186371
642 Ga0207650_10468621
643 Ga0207659_10061233
644 Ga0207659_10128479
645 Ga0207659_10316002
646 Ga0207700_10486933
647 Ga0207644_11239925
648 Ga0207690_10199927
649 Ga0207706_10017560
650 Ga0207686_10001202
651 Ga0207704_10473393
652 Ga0207691_10044264
653 Ga0207689_10015088
654 Ga0207689_10148961
655 Ga0207689_10299518
656 Ga0207689_10666649
657 Ga0207679_10206002
658 Ga0207667_10019616
659 Ga0207667_10025354
660 Ga0207667_10081611
661 Ga0207651_10188008
662 Ga0207651_10392664
663 Ga0207712_10009068
664 Ga0207640_10157629
665 Ga0207640_10972850
666 Ga0207658_11202033
667 Ga0207677_10058297
668 Ga0207703_10480408
669 Ga0207639_10049846
670 Ga0207639_10078207
671 Ga0207639_10366767
672 Ga0207708_10174550
673 Ga0207708_10662356
674 Ga0207702_10095990
675 Ga0207702_10187474
676 Ga0207702_10271250
677 Ga0207641_10000969
678 Ga0207641_10522305
679 Ga0207641_10601025
680 Ga0207648_10453803
681 Ga0207648_10647717
682 Ga0207676_10038423
683 Ga0207676_10375838
684 Ga0207676_11489633
685 Ga0207674_10092855
686 Ga0207674_10102692
687 Ga0207674_10645175
688 Ga0207674_11125820
689 Ga0207675_100006424
690 Ga0207675_100055812
691 Ga0207675_100877387
692 Ga0207675_101265509
693 Ga0207683_10072065
694 Ga0207683_10449193
695 Ga0207698_10013800
696 Ga0207698_10044943
697 Ga0207698_10223283
698 Ga0207698_11047589
699 Ga0209982_1030553
700 Ga0207428_10121071
701 Ga0207428_10216679
702 Ga0268265_10010453
703 Ga0268265_10173338
704 Ga0268264_10019429
705 Ga0268264_10607018
706 Ga0268264_10982269
707 Ga0307517_10000689
708 Ga0265340_10073889
709 Ga0265340_10122519
710 Ga0307513_10121995
711 Ga0307509_10279162
712 Ga0265313_10060880
713 Ga0307508_10006223
714 Ga0307508_10235994
715 Ga0307410_10224180
716 Ga0307416_101115281
717 Ga0307414_10106712
718 Ga0307414_10496842
719 Ga0307414_10743287
720 Ga0307414_10896145
721 Ga0307411_10917564
722 Ga0307507_10195493
723 Ga0373946_0081822
724 Ga0373927_0035742
725 Ga0373925_0727463
726 Ga0395905_0534714
727 Ga0436365_0849211
728 Ga0436365_1514287
729 Ga0439439_0022123
730 Ga0451802_1122068
731 Ga0451843_1742182
732 Ga0439457_030714
733 Ga0450923_011299
734 Ga0439446_0135551
735 Ga0466969_0007848
736 Ga0466972_0000011
737 Ga0466965_0139419
738 Ga0466966_0001290
739 Ga0466961_0259577
740 Ga0466970_0516585
741 Ga0466957_0001056
742 Ga0466957_0052949
743 Ga0466960_0585588
744 Ga0466959_0000039
745 Ga0466967_0274021
746 Ga0495629_0634395
747 Ga0495638_0026737
748 Ga0495594_0030777
749 Ga0495598_0089137
750 Ga0495621_0155178
751 Ga0495621_0200416
752 Ga0495668_0001220
753 Ga0495600_0199872
754 Ga0495672_0026693
755 Ga0501299_028523
756 Ga0501032_0034988
757 Ga0501032_0438807
758 Ga0501033_0036379
759 Ga0501034_0047956
760 Ga0501034_0751085
761 Ga0501037_0194440
762 Ga0501038_0031096
763 Ga0501039_0240840
764 Ga0501043_0093864
765 Ga0501047_0008167
766 Ga0501047_0010268
767 Ga0501070_0731432
768 Ga0501201_005106
769 Ga0501202_129338
770 Ga0501207_000034
771 Ga0501217_022936
772 Ga0501223_011090
773 Ga0501224_010128
774 Ga0501235_026047
775 Ga0501242_011571
776 Ga0501251_013763
777 Ga0501257_041935
778 Ga0501259_001107
779 Ga0501261_006279
780 Ga0501225_0001962
781 Ga0501225_0023663
782 Ga0501083_0263740
783 Ga0501270_009765
784 Ga0501035_0257017
785 Ga0501035_0640693
786 Ga0501044_0005730
787 Ga0501044_0192530
788 nmdc:mga0k408_383703_c1
789 nmdc:mga05p37_346413_c1
790 nmdc:mga05p37_944449_c1
791 nmdc:mga05p37_970_c2
792 nmdc:mga09592_19010_c1
793 nmdc:mga09592_19642_c1
794 nmdc:mga0qj67_68942_c1
795 nmdc:mga06r32_327160_c1
796 nmdc:mga06r32_71274_c1
797 nmdc:mga06r32_72311_c1
798 nmdc:mga08y16_258636_c1
799 nmdc:mga08y16_483457_c1
800 Ga0500578_0000027
801 Ga0500644_0005587
802 Ga0500646_0007292
803 Ga0500583_0000004
804 Ga0500583_0154407
805 Ga0500651_0266449
806 Ga0500594_0141509
807 Ga0500652_089314
808 Ga0500559_0040208
809 Ga0500568_0193629
810 Ga0500588_0044112
811 Ga0500588_0073776
812 Ga0500604_0029433
813 Ga0500616_0023606
814 Ga0500639_079854
815 Ga0500636_0089211
816 Ga0500645_024546
817 Ga0500661_027637
818 2738727627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

21

89

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

115

168

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9642 115 168
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9517 123 170
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9363 115 171
5or5-assembly1.cif.gz_A nmr structure of the complex formed by an engineered region 2 of sigmae in complex with gtaaaa 0.9112 1 83
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9001 6 91
ID Description Score Start End Superfamily
3hugG00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9749 117 167 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9669 115 168 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9642 115 168 1.10.10.10
3hugI00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9513 117 175 1.10.10.10
4nqwA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9415 115 169 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q5Z5M3-F1-model_v4 RNA polymerase sigma factor 0.985 1 184 GO:0003677
GO:0006352
GO:0016987
AF-A0A4Q5Z5M3-F1-model_v4 RNA polymerase sigma factor 0.9745 1 184 GO:0003677
GO:0006352
GO:0016987
AF-A0A257HTK2-F1-model_v4 RNA polymerase subunit sigma-70 0.9688 1 184 GO:0003677
GO:0006352
GO:0016987
AF-A0A257HTK2-F1-model_v4 RNA polymerase subunit sigma-70 0.9536 1 184 GO:0003677
GO:0006352
GO:0016987
AF-A0A4Q7MBH1-F1-model_v4 RNA polymerase sigma-70 factor (ECF subfamily) 0.9494 12 186 GO:0003677
GO:0006352
GO:0016987

Map