F436985

General Info

Members Datasets Scaffolds Average Seq Length
409 229 818 598

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10172928|Ga0105239_101729282
Length 658
Sequence VTKATADFPHWPPLGGRFILRHSRVARPQIRMQRWTVPLEQRRGDFFRARFRLEPFDQDFVMTIQAKPLFVALALAFASVTVHAAPAADVATRVKQLNDLLAEQWQYNLKETPEFASILGDYRYNDKWSDITLAHAQQQKKDAQAFIKRFEAIDTTGFSEQDRLNKQLMVQQLKDGVQATDLKLNEMPVDQFNGVHIQLASFVSALPFENTKQYEDYIARLNKVPALFDDLIAVLKQGEQDKLMPPKFLLEKVVKQCQSIAEPAGEASVFAQPVAKFADGVPEADRKRLHDAVIAAVDGKVRPAYTKLADFVAKEYAPHGRTEPGMWALPNGDALYKFDVEQQTTTNKTPAEIHELGLSEVKRIEAAQAEIAKQLGYKDLADMRTKLKNDPKVHAQSREQIVDLYKKYIAQMQPKLPELFGLLPKTNVEVLPVEPFREKEASGAQYNQGTPDGKRPGRVYVNTYDYANRLTLNIETTAYHEGVPGHHMQIAIAQTLPDLPPFRQQAGYTAYIEGWALYSERLGKEVGFYQDPLSYFGHLSDELLRADRLVLDTGVHYKHWTRQQMVDFFHAHSSQDEPSIQSETDRYIAYPGQALAYKMGQLKILELREKAKKELGDKFDIRAFHDEILNGGALPLDVLETRVTAWIGAQKAGKVAAK

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
85 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
148 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
149 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
164 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
178 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
216 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
221 2739367700 Dyella sp. YR388 Isolate Unclassified
222 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
223 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
224 2884411467 Dyella sp. AD56 Isolate Rhizosphere
225 2919085039 Luteibacter sp. 1214 Isolate Unclassified
226 2928963466 Dyella japonica 1073 Isolate Unclassified
227 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
228 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
229 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.56
Metatranscriptomes 0
Isolates 2.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.54
Nodule 0
Rhizoplane 2.44
Rhizosphere 81.42
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10172928 3300010375 Bacteria 2416
2 JGI24740J21852_10014255 3300001979 Bacteria 2938
3 JGI24739J22299_10001015 3300001989 Bacteria 10419
4 JGI24737J22298_10000943 3300001990 Bacteria 10314
5 JGI24738J21930_10008181 3300002075 Bacteria 2384
6 JGI25162J39368_1000499 3300002737 Bacteria 29755
7 JGI25162J39368_1002408 3300002737 Bacteria 7329
8 JGI25157J39369_1000401 3300002741 Bacteria 29804
9 JGI25157J39369_1001968 3300002741 Bacteria 6090
10 JGI25163J39215_1000215 3300002771 Bacteria 21828
11 JGI25164J39214_1000337 3300002772 Bacteria 29755
12 JGI25165J46597_1000622 3300003214 Bacteria 29755
13 JGI25153J46596_10017834 3300003215 Bacteria 2779
14 Ga0055538_1001415 3300003751 Bacteria 4661
15 Ga0055533_1000324 3300003756 Bacteria 21682
16 Ga0055535_1000597 3300003761 Bacteria 29755
17 Ga0055542_1000620 3300003762 Bacteria 30079
18 Ga0055542_1000624 3300003762 Bacteria 29755
19 Ga0055529_1000576 3300003763 Bacteria 29755
20 Ga0065165_1012233 3300005262 Bacteria 3509
21 Ga0070658_10020944 3300005327 Bacteria 5238
22 Ga0070690_100033911 3300005330 Bacteria 3197
23 Ga0070670_100009819 3300005331 Bacteria 8175
24 Ga0068869_100063666 3300005334 Bacteria 2710
25 Ga0070666_10000219 3300005335 Bacteria 38980
26 Ga0070666_10001552 3300005335 Bacteria 13944
27 Ga0070682_100002686 3300005337 Bacteria 9841
28 Ga0070682_100003524 3300005337 Bacteria 8661
29 Ga0070682_100093792 3300005337 Bacteria 1969
30 Ga0070660_100121505 3300005339 Bacteria 2084
31 Ga0070661_100004071 3300005344 Bacteria 10066
32 Ga0070661_100009631 3300005344 Bacteria 6695
33 Ga0070661_100014252 3300005344 Bacteria 5600
34 Ga0070659_100021643 3300005366 Bacteria 4900
35 Ga0070659_100058087 3300005366 Bacteria 3052
36 Ga0070667_100033394 3300005367 Bacteria 4300
37 Ga0070667_100133476 3300005367 Bacteria 2169
38 Ga0070714_100011912 3300005435 Bacteria 6916
39 Ga0070714_100112057 3300005435 Bacteria 2417
40 Ga0070713_100036135 3300005436 Bacteria 3984
41 Ga0070711_100065017 3300005439 Unclassified 2550
42 Ga0070694_100028044 3300005444 Bacteria 3660
43 Ga0070708_100035830 3300005445 Bacteria 4325
44 Ga0070663_100011068 3300005455 Bacteria 5648
45 Ga0070663_100011090 3300005455 Bacteria 5642
46 Ga0070663_100033759 3300005455 Bacteria 3537
47 Ga0070678_100074880 3300005456 Bacteria 2545
48 Ga0070681_10003480 3300005458 Bacteria 14751
49 Ga0070681_10097675 3300005458 Bacteria 2884
50 Ga0068867_100016710 3300005459 Bacteria 5214
51 Ga0068867_100020930 3300005459 Bacteria 4665
52 Ga0070685_10016614 3300005466 Bacteria 3925
53 Ga0070707_100048610 3300005468 Bacteria 4063
54 Ga0070679_100063805 3300005530 Bacteria 3672
55 Ga0070679_100108485 3300005530 Bacteria 2762
56 Ga0068853_100004931 3300005539 Bacteria 10392
57 Ga0068853_100005821 3300005539 Bacteria 9707
58 Ga0068853_100006032 3300005539 Bacteria 9585
59 Ga0068853_100026919 3300005539 Bacteria 4832
60 Ga0068853_100101685 3300005539 Bacteria 2542
61 Ga0070696_100014164 3300005546 Bacteria 5351
62 Ga0070665_100001506 3300005548 Bacteria 27100
63 Ga0070665_100025515 3300005548 Bacteria 5953
64 Ga0068855_100000561 3300005563 Bacteria 45527
65 Ga0068855_100001241 3300005563 Bacteria 31649
66 Ga0068855_100009492 3300005563 Bacteria 11750
67 Ga0068855_100090639 3300005563 Bacteria 3528
68 Ga0068855_100107402 3300005563 Bacteria 3206
69 Ga0070664_100000538 3300005564 Bacteria 28884
70 Ga0070664_100131931 3300005564 Bacteria 2195
71 Ga0068857_100000081 3300005577 Bacteria 55561
72 Ga0068857_100000923 3300005577 Bacteria 22253
73 Ga0068857_100031365 3300005577 Bacteria 4696
74 Ga0068854_100013304 3300005578 Bacteria 5397
75 Ga0068856_100000394 3300005614 Bacteria 47803
76 Ga0068856_100001986 3300005614 Bacteria 21328
77 Ga0068856_100002428 3300005614 Bacteria 19174
78 Ga0068856_100038880 3300005614 Bacteria 4671
79 Ga0068856_100054971 3300005614 Bacteria 3928
80 Ga0068852_100033948 3300005616 Bacteria 4242
81 Ga0068859_100000290 3300005617 Bacteria 49956
82 Ga0068864_100001275 3300005618 Bacteria 20944
83 Ga0068864_100002179 3300005618 Bacteria 16167
84 Ga0068864_100051232 3300005618 Bacteria 3555
85 Ga0068861_100044601 3300005719 Bacteria 3335
86 Ga0068851_10004675 3300005834 Bacteria 6186
87 Ga0068863_100005188 3300005841 Bacteria 12850
88 Ga0068863_100038204 3300005841 Bacteria 4568
89 Ga0068863_100049690 3300005841 Bacteria 3976
90 Ga0068863_100113765 3300005841 Bacteria 2578
91 Ga0068858_100000409 3300005842 Bacteria 44615
92 Ga0068858_100001752 3300005842 Bacteria 22123
93 Ga0068858_100007542 3300005842 Bacteria 10515
94 Ga0068860_100060348 3300005843 Bacteria 3604
95 Ga0068860_100093933 3300005843 Bacteria 2859
96 Ga0068862_100002347 3300005844 Bacteria 16853
97 Ga0068862_100015169 3300005844 Bacteria 6399
98 Ga0070717_10011349 3300006028 Bacteria 6763
99 Ga0070717_10018397 3300006028 Bacteria 5454
100 Ga0070717_10032805 3300006028 Bacteria 4186
101 Ga0097621_100002603 3300006237 Bacteria 12369
102 Ga0097621_100006940 3300006237 Bacteria 8061
103 Ga0097621_100076205 3300006237 Bacteria 2782
104 Ga0068871_100001192 3300006358 Bacteria 17360
105 Ga0068871_100007456 3300006358 Bacteria 7820
106 Ga0068871_100052549 3300006358 Bacteria 3300
107 Ga0068865_100002241 3300006881 Bacteria 11378
108 Ga0068865_100032165 3300006881 Bacteria 3502
109 Ga0068865_100129533 3300006881 Bacteria 1888
110 Ga0097620_100000290 3300006931 Bacteria 49956
111 Ga0105240_10000628 3300009093 Bacteria 65065
112 Ga0105240_10066314 3300009093 Bacteria 4479
113 Ga0105240_10284015 3300009093 Bacteria 1900
114 Ga0105245_10008495 3300009098 Bacteria 8958
115 Ga0105245_10060019 3300009098 Bacteria 3425
116 Ga0105245_10116518 3300009098 Bacteria 2491
117 Ga0105241_10068581 3300009174 Bacteria 2748
118 Ga0105242_10000543 3300009176 Bacteria 29884
119 Ga0105237_10000084 3300009545 Bacteria 125742
120 Ga0105237_10011657 3300009545 Bacteria 9301
121 Ga0105237_10063331 3300009545 Bacteria 3696
122 Ga0105237_10163764 3300009545 Bacteria 2223
123 Ga0105238_10003809 3300009551 Bacteria 14980
124 Ga0105238_10004147 3300009551 Bacteria 14377
125 Ga0105238_10012299 3300009551 Bacteria 8630
126 Ga0105238_10021459 3300009551 Bacteria 6578
127 Ga0105238_10040133 3300009551 Bacteria 4744
128 Ga0105249_10001960 3300009553 Bacteria 17850
129 Ga0105249_10027072 3300009553 Bacteria 5172
130 Ga0105239_10005484 3300010375 Bacteria 14878
131 Ga0105239_10025308 3300010375 Bacteria 6535
132 Ga0105239_10042230 3300010375 Bacteria 4997
133 Ga0105239_10058505 3300010375 Bacteria 4229
134 Ga0105239_10166152 3300010375 Bacteria 2467
135 Ga0157373_10001871 3300013100 Bacteria 15954
136 Ga0157373_10021086 3300013100 Bacteria 4731
137 Ga0157369_10000150 3300013105 Bacteria 99203
138 Ga0157369_10000258 3300013105 Bacteria 72711
139 Ga0157369_10005535 3300013105 Bacteria 14666
140 Ga0157369_10012832 3300013105 Bacteria 9501
141 Ga0157369_10086252 3300013105 Bacteria 3353
142 Ga0157374_10001052 3300013296 Bacteria 23995
143 Ga0157374_10001435 3300013296 Bacteria 20148
144 Ga0157374_10016809 3300013296 Bacteria 6437
145 Ga0157378_10000398 3300013297 Bacteria 42680
146 Ga0157378_10000497 3300013297 Bacteria 37315
147 Ga0157378_10000541 3300013297 Bacteria 35976
148 Ga0157378_10001113 3300013297 Bacteria 24466
149 Ga0157378_10002142 3300013297 Bacteria 17530
150 Ga0157378_10027175 3300013297 Bacteria 5050
151 Ga0163162_10000004 3300013306 Bacteria 505593
152 Ga0163162_10005382 3300013306 Bacteria 12359
153 Ga0163162_10056699 3300013306 Bacteria 3945
154 Ga0163162_10086021 3300013306 Bacteria 3221
155 Ga0163162_10203568 3300013306 Bacteria 2108
156 Ga0157372_10000335 3300013307 Bacteria 51775
157 Ga0157372_10001168 3300013307 Bacteria 28395
158 Ga0157372_10001936 3300013307 Bacteria 22477
159 Ga0157372_10009724 3300013307 Bacteria 10229
160 Ga0157375_10000026 3300013308 Bacteria 222518
161 Ga0157375_10000946 3300013308 Bacteria 25152
162 Ga0157375_10001438 3300013308 Bacteria 20474
163 Ga0163163_10000039 3300014325 Bacteria 148715
164 Ga0163163_10000530 3300014325 Bacteria 33984
165 Ga0182008_10002553 3300014497 Bacteria 11336
166 Ga0182008_10029000 3300014497 Bacteria 2798
167 Ga0157377_10000118 3300014745 Bacteria 53087
168 Ga0157379_10006946 3300014968 Bacteria 9792
169 Ga0157376_10018058 3300014969 Bacteria 5396
170 Ga0157376_10094421 3300014969 Bacteria 2599
171 Ga0182006_1001403 3300015261 Bacteria 14605
172 Ga0182007_10005634 3300015262 Bacteria 5468
173 Ga0182005_1000004 3300015265 Bacteria 609645
174 Ga0182005_1001553 3300015265 Bacteria 9091
175 Ga0183368_1002 3300015687 Bacteria 1865598
176 Ga0209760_100698 3300025207 Bacteria 5174
177 Ga0209784_100204 3300025224 Bacteria 42366
178 Ga0209674_100061 3300025226 Bacteria 280844
179 Ga0209674_100612 3300025226 Bacteria 13507
180 Ga0209672_101312 3300025228 Bacteria 9555
181 Ga0207427_100179 3300025231 Bacteria 67665
182 Ga0207427_103245 3300025231 Bacteria 3552
183 Ga0209437_100099 3300025233 Bacteria 229500
184 Ga0209437_100113 3300025233 Bacteria 211240
185 Ga0209437_106098 3300025233 Bacteria 2022
186 Ga0209258_100119 3300025242 Bacteria 183554
187 Ga0209258_101749 3300025242 Bacteria 6722
188 Ga0209258_103396 3300025242 Bacteria 3448
189 Ga0209026_1000175 3300025250 Bacteria 98059
190 Ga0209026_1000276 3300025250 Bacteria 60964
191 Ga0209026_1001699 3300025250 Bacteria 9208
192 Ga0209148_1000005 3300025254 Bacteria 1806504
193 Ga0209148_1000036 3300025254 Bacteria 530505
194 Ga0209759_1000832 3300025256 Bacteria 24308
195 Ga0209233_1000040 3300025261 Bacteria 530395
196 Ga0209455_1000164 3300025272 Bacteria 114011
197 Ga0209758_1003842 3300025297 Bacteria 13182
198 Ga0209051_1005382 3300025303 Bacteria 7508
199 Ga0207656_10010303 3300025321 Bacteria 3498
200 Ga0207680_10000395 3300025903 Bacteria 20737
201 Ga0207680_10046798 3300025903 Bacteria 2559
202 Ga0207647_10000277 3300025904 Bacteria 41661
203 Ga0207647_10001194 3300025904 Bacteria 19997
204 Ga0207647_10007355 3300025904 Bacteria 7959
205 Ga0207705_10016700 3300025909 Bacteria 5257
206 Ga0207684_10027102 3300025910 Bacteria 4887
207 Ga0207654_10062832 3300025911 Bacteria 2177
208 Ga0207707_10011294 3300025912 Bacteria 7772
209 Ga0207707_10079526 3300025912 Bacteria 2862
210 Ga0207695_10000040 3300025913 Bacteria 452787
211 Ga0207695_10000330 3300025913 Bacteria 113210
212 Ga0207695_10009349 3300025913 Bacteria 12122
213 Ga0207695_10046235 3300025913 Bacteria 4615
214 Ga0207695_10114510 3300025913 Bacteria 2672
215 Ga0207671_10000011 3300025914 Bacteria 530349
216 Ga0207671_10002602 3300025914 Bacteria 19057
217 Ga0207671_10002867 3300025914 Bacteria 17887
218 Ga0207671_10053178 3300025914 Bacteria 3001
219 Ga0207657_10004058 3300025919 Bacteria 15548
220 Ga0207649_10000769 3300025920 Bacteria 20824
221 Ga0207649_10003650 3300025920 Bacteria 8404
222 Ga0207649_10057467 3300025920 Bacteria 2433
223 Ga0207652_10071373 3300025921 Bacteria 3017
224 Ga0207694_10000284 3300025924 Bacteria 47825
225 Ga0207694_10002614 3300025924 Bacteria 14611
226 Ga0207694_10006478 3300025924 Bacteria 8909
227 Ga0207694_10006748 3300025924 Bacteria 8722
228 Ga0207694_10014780 3300025924 Bacteria 5886
229 Ga0207694_10019715 3300025924 Bacteria 5101
230 Ga0207694_10022178 3300025924 Bacteria 4815
231 Ga0207694_10023334 3300025924 Bacteria 4696
232 Ga0207694_10043288 3300025924 Bacteria 3475
233 Ga0207700_10034025 3300025928 Bacteria 3653
234 Ga0207664_10059843 3300025929 Bacteria 3035
235 Ga0207690_10003402 3300025932 Bacteria 9503
236 Ga0207690_10030937 3300025932 Bacteria 3420
237 Ga0207706_10005877 3300025933 Bacteria 11419
238 Ga0207686_10007220 3300025934 Bacteria 5985
239 Ga0207686_10056697 3300025934 Bacteria 2464
240 Ga0207704_10003491 3300025938 Bacteria 7154
241 Ga0207704_10040297 3300025938 Bacteria 2728
242 Ga0207667_10000219 3300025949 Bacteria 80218
243 Ga0207667_10000446 3300025949 Bacteria 55443
244 Ga0207667_10000487 3300025949 Bacteria 52501
245 Ga0207667_10002876 3300025949 Bacteria 21377
246 Ga0207667_10019691 3300025949 Bacteria 7523
247 Ga0207667_10050322 3300025949 Bacteria 4397
248 Ga0207712_10000168 3300025961 Bacteria 67505
249 Ga0207712_10013722 3300025961 Bacteria 5196
250 Ga0207640_10000280 3300025981 Bacteria 34294
251 Ga0207640_10024088 3300025981 Bacteria 3667
252 Ga0207677_10000998 3300026023 Bacteria 15626
253 Ga0207703_10000194 3300026035 Bacteria 70509
254 Ga0207703_10006117 3300026035 Bacteria 9633
255 Ga0207703_10018363 3300026035 Bacteria 5461
256 Ga0207703_10026875 3300026035 Bacteria 4532
257 Ga0207639_10000066 3300026041 Bacteria 98237
258 Ga0207639_10000141 3300026041 Bacteria 53546
259 Ga0207639_10001030 3300026041 Bacteria 18936
260 Ga0207639_10001236 3300026041 Bacteria 17297
261 Ga0207639_10012639 3300026041 Bacteria 5885
262 Ga0207639_10037643 3300026041 Bacteria 3594
263 Ga0207678_10006056 3300026067 Bacteria 10758
264 Ga0207678_10020909 3300026067 Bacteria 5737
265 Ga0207678_10023798 3300026067 Bacteria 5356
266 Ga0207702_10000482 3300026078 Bacteria 44849
267 Ga0207702_10003272 3300026078 Bacteria 14951
268 Ga0207702_10003738 3300026078 Bacteria 13758
269 Ga0207702_10014335 3300026078 Bacteria 6582
270 Ga0207702_10049334 3300026078 Bacteria 3552
271 Ga0207641_10004699 3300026088 Bacteria 11774
272 Ga0207641_10100210 3300026088 Bacteria 2551
273 Ga0207648_10031720 3300026089 Bacteria 4670
274 Ga0207676_10002377 3300026095 Bacteria 13429
275 Ga0207676_10004281 3300026095 Bacteria 10092
276 Ga0207674_10000229 3300026116 Bacteria 69982
277 Ga0207674_10001145 3300026116 Bacteria 34394
278 Ga0207674_10015752 3300026116 Bacteria 8293
279 Ga0207674_10020201 3300026116 Bacteria 7203
280 Ga0207674_10034006 3300026116 Bacteria 5332
281 Ga0207683_10010281 3300026121 Bacteria 7977
282 Ga0207698_10036656 3300026142 Bacteria 3602
283 Ga0207698_10058990 3300026142 Bacteria 2977
284 Ga0268266_10000007 3300028379 Bacteria 1372921
285 Ga0268265_10024533 3300028380 Bacteria 4268
286 Ga0268265_10068282 3300028380 Bacteria 2755
287 Ga0268264_10076632 3300028381 Bacteria 2846
288 Ga0265334_10000033 3300028573 Bacteria 106132
289 Ga0307412_10002161 3300031911 Bacteria 10904
290 Ga0373961_0000131 3300035241 Bacteria 38556
291 Ga0373933_0060818 3300035724 Bacteria 2278
292 Ga0373947_0018351 3300035725 Bacteria 4026
293 Ga0373937_0011665 3300036401 Bacteria 7710
294 Ga0373937_0146790 3300036401 Bacteria 2208
295 Ga0395900_0002649 3300037418 Bacteria 19558
296 Ga0395898_0001957 3300037466 Bacteria 26043
297 Ga0436364_0451675 3300037853 Bacteria 10746
298 Ga0436364_0729220 3300037853 Bacteria 3525
299 Ga0395901_0000335 3300038443 Bacteria 57644
300 Ga0436365_0176254 3300039437 Bacteria 2994
301 Ga0439436_0000184 3300041404 Bacteria 14746
302 Ga0439465_0007445 3300041413 Bacteria 3480
303 Ga0451793_0952920 3300041452 Bacteria 2187
304 Ga0451837_0643638 3300041494 Bacteria 2158
305 Ga0451853_2322504 3300041512 Bacteria 2120
306 Ga0466982_0000018 3300044672 Bacteria 113912
307 Ga0466966_0014575 3300044684 Bacteria 5203
308 Ga0466971_0005728 3300044719 Bacteria 5401
309 Ga0466971_0009306 3300044719 Bacteria 4292
310 Ga0466960_0004001 3300044901 Bacteria 5731
311 Ga0466958_0093922 3300045836 Bacteria 1858
312 Ga0466967_0008123 3300045976 Bacteria 7658
313 Ga0495638_0000034 3300046460 Bacteria 282038
314 Ga0495638_0000406 3300046460 Bacteria 52627
315 Ga0495638_0000452 3300046460 Bacteria 49237
316 Ga0495650_0000466 3300046471 Bacteria 62626
317 Ga0495662_0026087 3300046476 Bacteria 2823
318 Ga0495585_0000001 3300046492 Bacteria 609804
319 Ga0495607_0000010 3300046501 Bacteria 206525
320 Ga0495606_0000016 3300046507 Bacteria 284865
321 Ga0495610_0000902 3300046512 Bacteria 27613
322 Ga0495616_0029820 3300046513 Bacteria 2874
323 Ga0495631_0000190 3300046518 Bacteria 41934
324 Ga0495632_0000003 3300046519 Bacteria 396071
325 Ga0495648_0001020 3300046524 Bacteria 28601
326 Ga0495609_0009245 3300046538 Bacteria 4775
327 Ga0495645_0027313 3300046543 Bacteria 4146
328 Ga0495611_0000001 3300046648 Bacteria 2628469
329 Ga0495625_0000001 3300046660 Bacteria 1641829
330 Ga0495661_0001137 3300046665 Bacteria 23268
331 Ga0495670_0000978 3300046691 Bacteria 13860
332 Ga0495670_0001614 3300046691 Bacteria 11044
333 Ga0495671_0000473 3300046692 Bacteria 31495
334 Ga0495649_0000645 3300046694 Bacteria 28390
335 Ga0495589_0001200 3300046794 Bacteria 15447
336 Ga0495660_0000008 3300046810 Bacteria 435769
337 Ga0495679_000001 3300047446 Bacteria 1607568
338 Ga0495673_0000942 3300047469 Bacteria 26379
339 Ga0496104_0000023 3300048907 Bacteria 236818
340 Ga0496105_0000019 3300048908 Bacteria 185293
341 Ga0496112_0043787 3300048915 Bacteria 4383
342 Ga0496112_0075016 3300048915 Bacteria 3345
343 Ga0496112_0080262 3300048915 Bacteria 3226
344 Ga0496114_0182000 3300048917 Bacteria 1836
345 Ga0496115_0000196 3300048918 Bacteria 56608
346 Ga0496115_0000670 3300048918 Bacteria 25300
347 Ga0496115_0011150 3300048918 Bacteria 6735
348 Ga0496117_0009374 3300048920 Bacteria 9116
349 Ga0496118_0004677 3300048921 Bacteria 16044
350 Ga0496118_0017129 3300048921 Bacteria 6612
351 Ga0496119_0021791 3300048922 Bacteria 4614
352 Ga0496123_0009795 3300048926 Bacteria 8562
353 Ga0496125_0001450 3300048928 Bacteria 34494
354 Ga0496126_0118736 3300048929 Bacteria 2295
355 Ga0495678_000480 3300049459 Bacteria 39751
356 Ga0495682_0001071 3300049460 Bacteria 16092
357 Ga0501032_0001033 3300049569 Bacteria 22338
358 Ga0501034_0003623 3300049571 Bacteria 17513
359 Ga0501036_0033916 3300049572 Bacteria 4318
360 Ga0501036_0108424 3300049572 Bacteria 2347
361 Ga0501036_0121345 3300049572 Bacteria 2207
362 Ga0501037_0015510 3300049573 Bacteria 5607
363 Ga0501038_0001357 3300049574 Bacteria 22325
364 Ga0501046_0005760 3300049580 Bacteria 11059
365 Ga0501046_0061671 3300049580 Bacteria 2931
366 Ga0501047_0003844 3300049581 Bacteria 14121
367 Ga0501047_0006714 3300049581 Bacteria 10820
368 Ga0501047_0013074 3300049581 Bacteria 7862
369 Ga0501069_0002151 3300049585 Bacteria 9918
370 Ga0501070_0013456 3300049586 Bacteria 6896
371 Ga0501070_0077493 3300049586 Bacteria 2751
372 Ga0501070_0097913 3300049586 Bacteria 2426
373 Ga0501070_0109691 3300049586 Bacteria 2280
374 Ga0501072_0000608 3300049588 Bacteria 25779
375 Ga0501073_0001990 3300049589 Bacteria 15238
376 Ga0501073_0013753 3300049589 Bacteria 5886
377 Ga0501074_0007246 3300049590 Bacteria 8013
378 Ga0501074_0011729 3300049590 Bacteria 6370
379 Ga0501080_0004648 3300049742 Bacteria 12241
380 Ga0501080_0005994 3300049742 Bacteria 10894
381 Ga0501080_0019265 3300049742 Bacteria 6320
382 Ga0501080_0021267 3300049742 Bacteria 6005
383 Ga0501080_0026595 3300049742 Bacteria 5376
384 Ga0501083_0002910 3300049744 Bacteria 11859
385 Ga0501035_0008185 3300049822 Bacteria 9744
386 Ga0501035_0012816 3300049822 Bacteria 7742
387 Ga0501044_0003061 3300049823 Bacteria 18917
388 Ga0501044_0013178 3300049823 Bacteria 8952
389 nmdc:mga06r32_17753_c1 3300050510 Bacteria 6501
390 nmdc:mga0a205_10191_c1 3300050515 Bacteria 6523
391 nmdc:mga0sz30_10799_c1 3300050516 Bacteria 3133
392 Ga0500610_0002073 3300053079 Bacteria 7212
393 Ga0500643_000002 3300053087 Bacteria 1277657
394 Ga0500651_0058890 3300053093 Bacteria 2402
395 Ga0500555_000420 3300053103 Bacteria 17673
396 Ga0500638_029743 3300053162 Bacteria 2629
397 Ga0500645_001020 3300053730 Bacteria 15696
398 Ga0501084_0081398 3300054114 Bacteria 2716
399 Ga0466962_0011661 3300061719 Bacteria 4232
400 2687582018 2687453130 Bacteria 4227172
401 2739729948 2739367700 Bacteria 4747630
402 2842916391 2842914999 Bacteria 4419378
403 2842918883 2842918807 Bacteria 4289178
404 2884413008 2884411467 Bacteria 5246714
405 2919085473 2919085039 Bacteria 4532964
406 2928965863 2928963466 Bacteria 5165703
407 2953994834 2953994433 Bacteria 4303959
408 641335004 641228493 Bacteria 3999591
409 643392030 643348555 Bacteria 3914947
410 Ga0105239_10172928
411 JGI24740J21852_10014255
412 JGI24739J22299_10001015
413 JGI24737J22298_10000943
414 JGI24738J21930_10008181
415 JGI25162J39368_1000499
416 JGI25162J39368_1002408
417 JGI25157J39369_1000401
418 JGI25157J39369_1001968
419 JGI25163J39215_1000215
420 JGI25164J39214_1000337
421 JGI25165J46597_1000622
422 JGI25153J46596_10017834
423 Ga0055538_1001415
424 Ga0055533_1000324
425 Ga0055535_1000597
426 Ga0055542_1000620
427 Ga0055542_1000624
428 Ga0055529_1000576
429 Ga0065165_1012233
430 Ga0070658_10020944
431 Ga0070690_100033911
432 Ga0070670_100009819
433 Ga0068869_100063666
434 Ga0070666_10000219
435 Ga0070666_10001552
436 Ga0070682_100002686
437 Ga0070682_100003524
438 Ga0070682_100093792
439 Ga0070660_100121505
440 Ga0070661_100004071
441 Ga0070661_100009631
442 Ga0070661_100014252
443 Ga0070659_100021643
444 Ga0070659_100058087
445 Ga0070667_100033394
446 Ga0070667_100133476
447 Ga0070714_100011912
448 Ga0070714_100112057
449 Ga0070713_100036135
450 Ga0070711_100065017
451 Ga0070694_100028044
452 Ga0070708_100035830
453 Ga0070663_100011068
454 Ga0070663_100011090
455 Ga0070663_100033759
456 Ga0070678_100074880
457 Ga0070681_10003480
458 Ga0070681_10097675
459 Ga0068867_100016710
460 Ga0068867_100020930
461 Ga0070685_10016614
462 Ga0070707_100048610
463 Ga0070679_100063805
464 Ga0070679_100108485
465 Ga0068853_100004931
466 Ga0068853_100005821
467 Ga0068853_100006032
468 Ga0068853_100026919
469 Ga0068853_100101685
470 Ga0070696_100014164
471 Ga0070665_100001506
472 Ga0070665_100025515
473 Ga0068855_100000561
474 Ga0068855_100001241
475 Ga0068855_100009492
476 Ga0068855_100090639
477 Ga0068855_100107402
478 Ga0070664_100000538
479 Ga0070664_100131931
480 Ga0068857_100000081
481 Ga0068857_100000923
482 Ga0068857_100031365
483 Ga0068854_100013304
484 Ga0068856_100000394
485 Ga0068856_100001986
486 Ga0068856_100002428
487 Ga0068856_100038880
488 Ga0068856_100054971
489 Ga0068852_100033948
490 Ga0068859_100000290
491 Ga0068864_100001275
492 Ga0068864_100002179
493 Ga0068864_100051232
494 Ga0068861_100044601
495 Ga0068851_10004675
496 Ga0068863_100005188
497 Ga0068863_100038204
498 Ga0068863_100049690
499 Ga0068863_100113765
500 Ga0068858_100000409
501 Ga0068858_100001752
502 Ga0068858_100007542
503 Ga0068860_100060348
504 Ga0068860_100093933
505 Ga0068862_100002347
506 Ga0068862_100015169
507 Ga0070717_10011349
508 Ga0070717_10018397
509 Ga0070717_10032805
510 Ga0097621_100002603
511 Ga0097621_100006940
512 Ga0097621_100076205
513 Ga0068871_100001192
514 Ga0068871_100007456
515 Ga0068871_100052549
516 Ga0068865_100002241
517 Ga0068865_100032165
518 Ga0068865_100129533
519 Ga0097620_100000290
520 Ga0105240_10000628
521 Ga0105240_10066314
522 Ga0105240_10284015
523 Ga0105245_10008495
524 Ga0105245_10060019
525 Ga0105245_10116518
526 Ga0105241_10068581
527 Ga0105242_10000543
528 Ga0105237_10000084
529 Ga0105237_10011657
530 Ga0105237_10063331
531 Ga0105237_10163764
532 Ga0105238_10003809
533 Ga0105238_10004147
534 Ga0105238_10012299
535 Ga0105238_10021459
536 Ga0105238_10040133
537 Ga0105249_10001960
538 Ga0105249_10027072
539 Ga0105239_10005484
540 Ga0105239_10025308
541 Ga0105239_10042230
542 Ga0105239_10058505
543 Ga0105239_10166152
544 Ga0157373_10001871
545 Ga0157373_10021086
546 Ga0157369_10000150
547 Ga0157369_10000258
548 Ga0157369_10005535
549 Ga0157369_10012832
550 Ga0157369_10086252
551 Ga0157374_10001052
552 Ga0157374_10001435
553 Ga0157374_10016809
554 Ga0157378_10000398
555 Ga0157378_10000497
556 Ga0157378_10000541
557 Ga0157378_10001113
558 Ga0157378_10002142
559 Ga0157378_10027175
560 Ga0163162_10000004
561 Ga0163162_10005382
562 Ga0163162_10056699
563 Ga0163162_10086021
564 Ga0163162_10203568
565 Ga0157372_10000335
566 Ga0157372_10001168
567 Ga0157372_10001936
568 Ga0157372_10009724
569 Ga0157375_10000026
570 Ga0157375_10000946
571 Ga0157375_10001438
572 Ga0163163_10000039
573 Ga0163163_10000530
574 Ga0182008_10002553
575 Ga0182008_10029000
576 Ga0157377_10000118
577 Ga0157379_10006946
578 Ga0157376_10018058
579 Ga0157376_10094421
580 Ga0182006_1001403
581 Ga0182007_10005634
582 Ga0182005_1000004
583 Ga0182005_1001553
584 Ga0183368_1002
585 Ga0209760_100698
586 Ga0209784_100204
587 Ga0209674_100061
588 Ga0209674_100612
589 Ga0209672_101312
590 Ga0207427_100179
591 Ga0207427_103245
592 Ga0209437_100099
593 Ga0209437_100113
594 Ga0209437_106098
595 Ga0209258_100119
596 Ga0209258_101749
597 Ga0209258_103396
598 Ga0209026_1000175
599 Ga0209026_1000276
600 Ga0209026_1001699
601 Ga0209148_1000005
602 Ga0209148_1000036
603 Ga0209759_1000832
604 Ga0209233_1000040
605 Ga0209455_1000164
606 Ga0209758_1003842
607 Ga0209051_1005382
608 Ga0207656_10010303
609 Ga0207680_10000395
610 Ga0207680_10046798
611 Ga0207647_10000277
612 Ga0207647_10001194
613 Ga0207647_10007355
614 Ga0207705_10016700
615 Ga0207684_10027102
616 Ga0207654_10062832
617 Ga0207707_10011294
618 Ga0207707_10079526
619 Ga0207695_10000040
620 Ga0207695_10000330
621 Ga0207695_10009349
622 Ga0207695_10046235
623 Ga0207695_10114510
624 Ga0207671_10000011
625 Ga0207671_10002602
626 Ga0207671_10002867
627 Ga0207671_10053178
628 Ga0207657_10004058
629 Ga0207649_10000769
630 Ga0207649_10003650
631 Ga0207649_10057467
632 Ga0207652_10071373
633 Ga0207694_10000284
634 Ga0207694_10002614
635 Ga0207694_10006478
636 Ga0207694_10006748
637 Ga0207694_10014780
638 Ga0207694_10019715
639 Ga0207694_10022178
640 Ga0207694_10023334
641 Ga0207694_10043288
642 Ga0207700_10034025
643 Ga0207664_10059843
644 Ga0207690_10003402
645 Ga0207690_10030937
646 Ga0207706_10005877
647 Ga0207686_10007220
648 Ga0207686_10056697
649 Ga0207704_10003491
650 Ga0207704_10040297
651 Ga0207667_10000219
652 Ga0207667_10000446
653 Ga0207667_10000487
654 Ga0207667_10002876
655 Ga0207667_10019691
656 Ga0207667_10050322
657 Ga0207712_10000168
658 Ga0207712_10013722
659 Ga0207640_10000280
660 Ga0207640_10024088
661 Ga0207677_10000998
662 Ga0207703_10000194
663 Ga0207703_10006117
664 Ga0207703_10018363
665 Ga0207703_10026875
666 Ga0207639_10000066
667 Ga0207639_10000141
668 Ga0207639_10001030
669 Ga0207639_10001236
670 Ga0207639_10012639
671 Ga0207639_10037643
672 Ga0207678_10006056
673 Ga0207678_10020909
674 Ga0207678_10023798
675 Ga0207702_10000482
676 Ga0207702_10003272
677 Ga0207702_10003738
678 Ga0207702_10014335
679 Ga0207702_10049334
680 Ga0207641_10004699
681 Ga0207641_10100210
682 Ga0207648_10031720
683 Ga0207676_10002377
684 Ga0207676_10004281
685 Ga0207674_10000229
686 Ga0207674_10001145
687 Ga0207674_10015752
688 Ga0207674_10020201
689 Ga0207674_10034006
690 Ga0207683_10010281
691 Ga0207698_10036656
692 Ga0207698_10058990
693 Ga0268266_10000007
694 Ga0268265_10024533
695 Ga0268265_10068282
696 Ga0268264_10076632
697 Ga0265334_10000033
698 Ga0307412_10002161
699 Ga0373961_0000131
700 Ga0373933_0060818
701 Ga0373947_0018351
702 Ga0373937_0011665
703 Ga0373937_0146790
704 Ga0395900_0002649
705 Ga0395898_0001957
706 Ga0436364_0451675
707 Ga0436364_0729220
708 Ga0395901_0000335
709 Ga0436365_0176254
710 Ga0439436_0000184
711 Ga0439465_0007445
712 Ga0451793_0952920
713 Ga0451837_0643638
714 Ga0451853_2322504
715 Ga0466982_0000018
716 Ga0466966_0014575
717 Ga0466971_0005728
718 Ga0466971_0009306
719 Ga0466960_0004001
720 Ga0466958_0093922
721 Ga0466967_0008123
722 Ga0495638_0000034
723 Ga0495638_0000406
724 Ga0495638_0000452
725 Ga0495650_0000466
726 Ga0495662_0026087
727 Ga0495585_0000001
728 Ga0495607_0000010
729 Ga0495606_0000016
730 Ga0495610_0000902
731 Ga0495616_0029820
732 Ga0495631_0000190
733 Ga0495632_0000003
734 Ga0495648_0001020
735 Ga0495609_0009245
736 Ga0495645_0027313
737 Ga0495611_0000001
738 Ga0495625_0000001
739 Ga0495661_0001137
740 Ga0495670_0000978
741 Ga0495670_0001614
742 Ga0495671_0000473
743 Ga0495649_0000645
744 Ga0495589_0001200
745 Ga0495660_0000008
746 Ga0495679_000001
747 Ga0495673_0000942
748 Ga0496104_0000023
749 Ga0496105_0000019
750 Ga0496112_0043787
751 Ga0496112_0075016
752 Ga0496112_0080262
753 Ga0496114_0182000
754 Ga0496115_0000196
755 Ga0496115_0000670
756 Ga0496115_0011150
757 Ga0496117_0009374
758 Ga0496118_0004677
759 Ga0496118_0017129
760 Ga0496119_0021791
761 Ga0496123_0009795
762 Ga0496125_0001450
763 Ga0496126_0118736
764 Ga0495678_000480
765 Ga0495682_0001071
766 Ga0501032_0001033
767 Ga0501034_0003623
768 Ga0501036_0033916
769 Ga0501036_0108424
770 Ga0501036_0121345
771 Ga0501037_0015510
772 Ga0501038_0001357
773 Ga0501046_0005760
774 Ga0501046_0061671
775 Ga0501047_0003844
776 Ga0501047_0006714
777 Ga0501047_0013074
778 Ga0501069_0002151
779 Ga0501070_0013456
780 Ga0501070_0077493
781 Ga0501070_0097913
782 Ga0501070_0109691
783 Ga0501072_0000608
784 Ga0501073_0001990
785 Ga0501073_0013753
786 Ga0501074_0007246
787 Ga0501074_0011729
788 Ga0501080_0004648
789 Ga0501080_0005994
790 Ga0501080_0019265
791 Ga0501080_0021267
792 Ga0501080_0026595
793 Ga0501083_0002910
794 Ga0501035_0008185
795 Ga0501035_0012816
796 Ga0501044_0003061
797 Ga0501044_0013178
798 nmdc:mga06r32_17753_c1
799 nmdc:mga0a205_10191_c1
800 nmdc:mga0sz30_10799_c1
801 Ga0500610_0002073
802 Ga0500643_000002
803 Ga0500651_0058890
804 Ga0500555_000420
805 Ga0500638_029743
806 Ga0500645_001020
807 Ga0501084_0081398
808 Ga0466962_0011661
809 2687582018
810 2739729948
811 2842916391
812 2842918883
813 2884413008
814 2919085473
815 2928965863
816 2953994834
817 641335004
818 643392030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05960

DUF885

Bacterial protein of unknown function (DUF885)

113

643

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o0y-assembly4.cif.gz_A the crystal structure of the putative lipoprotein from colwellia psychrerythraea 0.9563 19 574
3o0y-assembly2.cif.gz_B the crystal structure of the putative lipoprotein from colwellia psychrerythraea 0.9474 19 574
3o0y-assembly4.cif.gz_A the crystal structure of the putative lipoprotein from colwellia psychrerythraea 0.9085 19 574
3o0y-assembly2.cif.gz_B the crystal structure of the putative lipoprotein from colwellia psychrerythraea 0.9002 19 574
3iuk-assembly2.cif.gz_B crystal structure of putative bacterial protein of unknown function (duf885, pf05960.1, ) from arthrobacter aurescens tc1, reveals fold similar to that of m32 carboxypeptidases 0.8435 23 569
ID Description Score Start End Superfamily
af_Q54Y95_120_681_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.9289 51 568 1.10.1370.30
af_Q54Y95_120_681_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.8573 51 568 1.10.1370.30
af_Q54X86_5_110_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4938 137 245 1.20.58.70
af_Q54X86_5_110_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4613 137 245 1.20.58.70
3pu8B02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.338 147 223 1.20.58.1360
ID Description Score Start End GO Terms
AF-A0A062IC53-F1-model_v4 DUF885 domain-containing protein 0.9935 16 496
AF-A0A520EL01-F1-model_v4 deleted 0.9932 411 574
AF-A0A7C1XXR9-F1-model_v4 DUF885 domain-containing protein 0.9914 398 578
AF-A0A382LXE7-F1-model_v4 DUF885 domain-containing protein 0.991 406 578
AF-A0A3D1S3P0-F1-model_v4 DUF885 domain-containing protein 0.9908 399 538

Map