F436954
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 409 | 274 | 384 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300006178|Ga0075367_10218744|Ga0075367_102187442 |
| Length | 226 |
| Sequence | MTITITAFERSPDGGKGLARDTRVRWALEEVGQPYEVRLVTFRAMKEPAHLALHPFGQIPTYEEGGLALFETGSIVFHIAERHAGLLPPNSDDPHSDSGADARARAITWMFAALNTVEPPILELATAKIQEGDKPWTKERLPLVEDRIRNRLASLSEHLGSADWLDGGFSAGDLMMVSVLLRLKPSGILDEYPNLAAYLARGEARPAYIRAFEAQLAVNAGKPPSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 2 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 3 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 4 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 5 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 6 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 7 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 8 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 9 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 10 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 11 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 12 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 13 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 14 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 15 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 16 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 17 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 18 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 19 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 20 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 21 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 22 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 23 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 24 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 25 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 158 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 159 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 162 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 176 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 177 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 182 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 183 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 234 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 235 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 236 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 254 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 255 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 256 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 257 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 263 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 264 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 265 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 266 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 267 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 268 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 269 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 270 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 271 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 272 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 273 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 274 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.64 |
| Metatranscriptomes | 0.24 |
| Isolates | 6.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.82 |
| Nodule | 3.91 |
| Rhizoplane | 2.69 |
| Rhizosphere | 80.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10042435 | 3300002067 | Bacteria | 1324 |
| 2 | JGI24033J26618_1010981 | 3300002155 | Bacteria | 1074 |
| 3 | Ga0006562J51391_1047541 | 3300003578 | Bacteria | 2330 |
| 4 | Ga0055528_1005915 | 3300003790 | Bacteria | 5610 |
| 5 | Ga0055540_1000251 | 3300003792 | Bacteria | 48933 |
| 6 | Ga0065714_10002968 | 3300005288 | Bacteria | 9262 |
| 7 | Ga0065712_10118861 | 3300005290 | Bacteria | 1700 |
| 8 | Ga0065715_10002429 | 3300005293 | Bacteria | 7249 |
| 9 | Ga0070658_10105602 | 3300005327 | Bacteria | 2330 |
| 10 | Ga0070683_100002110 | 3300005329 | Bacteria | 15702 |
| 11 | Ga0070683_100235608 | 3300005329 | Bacteria | 1740 |
| 12 | Ga0070690_100064984 | 3300005330 | Bacteria | 2358 |
| 13 | Ga0070670_100014510 | 3300005331 | Bacteria | 6763 |
| 14 | Ga0070670_100057447 | 3300005331 | Bacteria | 3340 |
| 15 | Ga0070670_100079005 | 3300005331 | Bacteria | 2827 |
| 16 | Ga0070670_100190528 | 3300005331 | Bacteria | 1781 |
| 17 | Ga0070670_100276706 | 3300005331 | Bacteria | 1465 |
| 18 | Ga0068869_100024175 | 3300005334 | Bacteria | 4207 |
| 19 | Ga0070680_100662962 | 3300005336 | Bacteria | 897 |
| 20 | Ga0070682_100001349 | 3300005337 | Bacteria | 13850 |
| 21 | Ga0068868_100056925 | 3300005338 | Bacteria | 3088 |
| 22 | Ga0070660_100018261 | 3300005339 | Bacteria | 5123 |
| 23 | Ga0070660_100036670 | 3300005339 | Bacteria | 3715 |
| 24 | Ga0070660_100210988 | 3300005339 | Bacteria | 1577 |
| 25 | Ga0070689_100000018 | 3300005340 | Bacteria | 153256 |
| 26 | Ga0070689_100123818 | 3300005340 | Bacteria | 2067 |
| 27 | Ga0070661_100006111 | 3300005344 | Bacteria | 8293 |
| 28 | Ga0070661_100021529 | 3300005344 | Bacteria | 4607 |
| 29 | Ga0070661_100022569 | 3300005344 | Bacteria | 4507 |
| 30 | Ga0070661_100156381 | 3300005344 | Bacteria | 1725 |
| 31 | Ga0070661_100313325 | 3300005344 | Bacteria | 1224 |
| 32 | Ga0070692_10124064 | 3300005345 | Bacteria | 1444 |
| 33 | Ga0070675_100765477 | 3300005354 | Bacteria | 881 |
| 34 | Ga0070671_100012577 | 3300005355 | Bacteria | 6817 |
| 35 | Ga0070674_100641968 | 3300005356 | Bacteria | 901 |
| 36 | Ga0070673_100790782 | 3300005364 | Bacteria | 875 |
| 37 | Ga0070688_100049261 | 3300005365 | Bacteria | 2621 |
| 38 | Ga0070659_100000593 | 3300005366 | Bacteria | 26524 |
| 39 | Ga0070659_100003492 | 3300005366 | Bacteria | 11188 |
| 40 | Ga0070659_100034731 | 3300005366 | Bacteria | 3923 |
| 41 | Ga0070659_100089522 | 3300005366 | Bacteria | 2465 |
| 42 | Ga0070667_100120594 | 3300005367 | Bacteria | 2281 |
| 43 | Ga0070701_10017600 | 3300005438 | Bacteria | 3342 |
| 44 | Ga0070663_100027175 | 3300005455 | Bacteria | 3882 |
| 45 | Ga0070663_100049845 | 3300005455 | Bacteria | 2976 |
| 46 | Ga0070681_10003684 | 3300005458 | Bacteria | 14374 |
| 47 | Ga0068867_100234028 | 3300005459 | Bacteria | 1486 |
| 48 | Ga0070685_10014535 | 3300005466 | Bacteria | 4172 |
| 49 | Ga0070684_100118732 | 3300005535 | Bacteria | 2377 |
| 50 | Ga0070684_100396897 | 3300005535 | Bacteria | 1271 |
| 51 | Ga0068853_100005463 | 3300005539 | Bacteria | 9959 |
| 52 | Ga0068853_100006379 | 3300005539 | Bacteria | 9369 |
| 53 | Ga0070686_100006255 | 3300005544 | Bacteria | 6613 |
| 54 | Ga0070693_100000961 | 3300005547 | Bacteria | 12781 |
| 55 | Ga0070665_100022090 | 3300005548 | Bacteria | 6401 |
| 56 | Ga0070665_100074178 | 3300005548 | Bacteria | 3408 |
| 57 | Ga0070665_100088220 | 3300005548 | Bacteria | 3108 |
| 58 | Ga0070665_100534032 | 3300005548 | Bacteria | 1185 |
| 59 | Ga0068855_100047177 | 3300005563 | Bacteria | 5090 |
| 60 | Ga0070664_100025348 | 3300005564 | Bacteria | 4914 |
| 61 | Ga0070664_100224288 | 3300005564 | Bacteria | 1682 |
| 62 | Ga0070664_100282346 | 3300005564 | Bacteria | 1497 |
| 63 | Ga0068857_100049201 | 3300005577 | Bacteria | 3740 |
| 64 | Ga0068854_100109393 | 3300005578 | Bacteria | 2082 |
| 65 | Ga0068856_100234626 | 3300005614 | Bacteria | 1850 |
| 66 | Ga0068852_100494235 | 3300005616 | Bacteria | 1217 |
| 67 | Ga0068864_100026854 | 3300005618 | Bacteria | 4856 |
| 68 | Ga0068851_10003898 | 3300005834 | Bacteria | 6680 |
| 69 | Ga0068870_10001520 | 3300005840 | Bacteria | 9411 |
| 70 | Ga0068870_10246402 | 3300005840 | Bacteria | 1106 |
| 71 | Ga0068863_100000020 | 3300005841 | Bacteria | 198519 |
| 72 | Ga0068863_100023840 | 3300005841 | Bacteria | 5840 |
| 73 | Ga0068858_100032382 | 3300005842 | Bacteria | 4855 |
| 74 | Ga0068858_100237222 | 3300005842 | Bacteria | 1729 |
| 75 | Ga0068862_100062221 | 3300005844 | Bacteria | 3210 |
| 76 | Ga0068862_100078298 | 3300005844 | Bacteria | 2864 |
| 77 | Ga0081455_10000940 | 3300005937 | Bacteria | 37224 |
| 78 | Ga0081540_1008611 | 3300005983 | Bacteria | 7110 |
| 79 | Ga0075365_10103043 | 3300006038 | Bacteria | 1956 |
| 80 | Ga0075363_100068318 | 3300006048 | Bacteria | 1927 |
| 81 | Ga0075364_10216827 | 3300006051 | Bacteria | 1298 |
| 82 | Ga0075367_10087375 | 3300006178 | Bacteria | 1893 |
| 83 | Ga0075367_10107815 | 3300006178 | Bacteria | 1707 |
| 84 | Ga0075367_10218744 | 3300006178 | Bacteria | 1192 |
| 85 | Ga0075369_10175309 | 3300006186 | Bacteria | 986 |
| 86 | Ga0075366_10004948 | 3300006195 | Bacteria | 7189 |
| 87 | Ga0075370_10036323 | 3300006353 | Bacteria | 2767 |
| 88 | Ga0075370_10212668 | 3300006353 | Bacteria | 1142 |
| 89 | Ga0075428_100935933 | 3300006844 | Bacteria | 918 |
| 90 | Ga0075430_100002431 | 3300006846 | Bacteria | 15500 |
| 91 | Ga0075431_100566389 | 3300006847 | Bacteria | 1122 |
| 92 | Ga0075433_10046388 | 3300006852 | Bacteria | 3779 |
| 93 | Ga0075429_100178243 | 3300006880 | Bacteria | 1862 |
| 94 | Ga0068865_100022310 | 3300006881 | Bacteria | 4128 |
| 95 | Ga0105244_10158819 | 3300009036 | Bacteria | 1080 |
| 96 | Ga0105240_10704439 | 3300009093 | Bacteria | 1102 |
| 97 | Ga0111539_10059772 | 3300009094 | Bacteria | 4519 |
| 98 | Ga0111539_10383274 | 3300009094 | Bacteria | 1637 |
| 99 | Ga0105243_10044486 | 3300009148 | Bacteria | 3483 |
| 100 | Ga0105241_10064996 | 3300009174 | Bacteria | 2818 |
| 101 | Ga0105242_10169262 | 3300009176 | Bacteria | 1919 |
| 102 | Ga0105242_10375242 | 3300009176 | Bacteria | 1320 |
| 103 | Ga0105242_10379540 | 3300009176 | Bacteria | 1313 |
| 104 | Ga0105248_10007658 | 3300009177 | Bacteria | 11865 |
| 105 | Ga0105237_10101398 | 3300009545 | Bacteria | 2871 |
| 106 | Ga0105237_10841881 | 3300009545 | Bacteria | 924 |
| 107 | Ga0105239_10010833 | 3300010375 | Bacteria | 10186 |
| 108 | Ga0105239_10273340 | 3300010375 | Bacteria | 1901 |
| 109 | Ga0105246_10123637 | 3300011119 | Bacteria | 1921 |
| 110 | Ga0157370_10030116 | 3300013104 | Bacteria | 5320 |
| 111 | Ga0157374_10160162 | 3300013296 | Bacteria | 2192 |
| 112 | Ga0157374_10170344 | 3300013296 | Bacteria | 2124 |
| 113 | Ga0163162_10364732 | 3300013306 | Bacteria | 1577 |
| 114 | Ga0163162_10535671 | 3300013306 | Bacteria | 1300 |
| 115 | Ga0157375_10193522 | 3300013308 | Bacteria | 2189 |
| 116 | Ga0157375_11223629 | 3300013308 | Bacteria | 881 |
| 117 | Ga0163163_10163284 | 3300014325 | Bacteria | 2273 |
| 118 | Ga0157380_10001901 | 3300014326 | Bacteria | 13847 |
| 119 | Ga0157380_10013862 | 3300014326 | Bacteria | 5887 |
| 120 | Ga0182008_10015372 | 3300014497 | Bacteria | 3994 |
| 121 | Ga0157377_10002075 | 3300014745 | Bacteria | 8800 |
| 122 | Ga0157377_10375807 | 3300014745 | Bacteria | 961 |
| 123 | Ga0157379_10116036 | 3300014968 | Bacteria | 2408 |
| 124 | Ga0157376_10023986 | 3300014969 | Bacteria | 4784 |
| 125 | Ga0157376_10308088 | 3300014969 | Bacteria | 1501 |
| 126 | Ga0182006_1000181 | 3300015261 | Bacteria | 66126 |
| 127 | Ga0182006_1000832 | 3300015261 | Bacteria | 20700 |
| 128 | Ga0209673_1000974 | 3300025273 | Bacteria | 35340 |
| 129 | Ga0207673_1016986 | 3300025290 | Bacteria | 969 |
| 130 | Ga0209676_1022071 | 3300025292 | Bacteria | 2117 |
| 131 | Ga0209051_1000127 | 3300025303 | Bacteria | 142254 |
| 132 | Ga0209257_1003156 | 3300025304 | Bacteria | 14688 |
| 133 | Ga0207697_10008216 | 3300025315 | Bacteria | 4586 |
| 134 | Ga0207656_10011206 | 3300025321 | Bacteria | 3382 |
| 135 | Ga0207710_10084062 | 3300025900 | Bacteria | 1481 |
| 136 | Ga0207688_10020769 | 3300025901 | Bacteria | 3586 |
| 137 | Ga0207647_10049374 | 3300025904 | Bacteria | 2610 |
| 138 | Ga0207645_10008488 | 3300025907 | Bacteria | 7163 |
| 139 | Ga0207643_10000393 | 3300025908 | Bacteria | 29099 |
| 140 | Ga0207705_10015800 | 3300025909 | Bacteria | 5420 |
| 141 | Ga0207654_10108750 | 3300025911 | Bacteria | 1721 |
| 142 | Ga0207707_10005151 | 3300025912 | Bacteria | 11458 |
| 143 | Ga0207671_10289405 | 3300025914 | Bacteria | 1293 |
| 144 | Ga0207660_10497722 | 3300025917 | Bacteria | 989 |
| 145 | Ga0207657_10027790 | 3300025919 | Bacteria | 5174 |
| 146 | Ga0207657_10051122 | 3300025919 | Bacteria | 3593 |
| 147 | Ga0207657_10108868 | 3300025919 | Bacteria | 2290 |
| 148 | Ga0207649_10024237 | 3300025920 | Bacteria | 3525 |
| 149 | Ga0207649_10026469 | 3300025920 | Bacteria | 3393 |
| 150 | Ga0207649_10245222 | 3300025920 | Bacteria | 1288 |
| 151 | Ga0207681_10588445 | 3300025923 | Bacteria | 918 |
| 152 | Ga0207650_10018966 | 3300025925 | Bacteria | 4833 |
| 153 | Ga0207650_10662293 | 3300025925 | Bacteria | 880 |
| 154 | Ga0207659_10014895 | 3300025926 | Bacteria | 5027 |
| 155 | Ga0207644_10000622 | 3300025931 | Bacteria | 22583 |
| 156 | Ga0207644_10363906 | 3300025931 | Bacteria | 1177 |
| 157 | Ga0207690_10001299 | 3300025932 | Bacteria | 15745 |
| 158 | Ga0207690_10001599 | 3300025932 | Bacteria | 14135 |
| 159 | Ga0207690_10041564 | 3300025932 | Bacteria | 3013 |
| 160 | Ga0207706_10006641 | 3300025933 | Bacteria | 10703 |
| 161 | Ga0207670_10000001 | 3300025936 | Bacteria | 949312 |
| 162 | Ga0207670_10076065 | 3300025936 | Bacteria | 2335 |
| 163 | Ga0207669_10023932 | 3300025937 | Bacteria | 3272 |
| 164 | Ga0207669_10528445 | 3300025937 | Bacteria | 948 |
| 165 | Ga0207711_10040633 | 3300025941 | Bacteria | 3957 |
| 166 | Ga0207689_10007921 | 3300025942 | Bacteria | 9280 |
| 167 | Ga0207689_10529960 | 3300025942 | Bacteria | 988 |
| 168 | Ga0207661_10000484 | 3300025944 | Bacteria | 25619 |
| 169 | Ga0207679_10000536 | 3300025945 | Bacteria | 25661 |
| 170 | Ga0207679_10282811 | 3300025945 | Bacteria | 1423 |
| 171 | Ga0207679_10461973 | 3300025945 | Bacteria | 1127 |
| 172 | Ga0207667_10004555 | 3300025949 | Bacteria | 16990 |
| 173 | Ga0207651_10075235 | 3300025960 | Bacteria | 2408 |
| 174 | Ga0207668_10000039 | 3300025972 | Bacteria | 110049 |
| 175 | Ga0207668_10635858 | 3300025972 | Bacteria | 933 |
| 176 | Ga0207640_10226464 | 3300025981 | Bacteria | 1435 |
| 177 | Ga0207703_10170788 | 3300026035 | Bacteria | 1912 |
| 178 | Ga0207639_10012580 | 3300026041 | Bacteria | 5896 |
| 179 | Ga0207639_10023413 | 3300026041 | Bacteria | 4460 |
| 180 | Ga0207639_10822327 | 3300026041 | Bacteria | 866 |
| 181 | Ga0207678_10020969 | 3300026067 | Bacteria | 5728 |
| 182 | Ga0207678_10078227 | 3300026067 | Bacteria | 2832 |
| 183 | Ga0207702_10506182 | 3300026078 | Bacteria | 1178 |
| 184 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 185 | Ga0207641_10182406 | 3300026088 | Bacteria | 1923 |
| 186 | Ga0207648_10022608 | 3300026089 | Bacteria | 5644 |
| 187 | Ga0207676_10491728 | 3300026095 | Bacteria | 1163 |
| 188 | Ga0207674_10119040 | 3300026116 | Bacteria | 2610 |
| 189 | Ga0207675_100139728 | 3300026118 | Bacteria | 2300 |
| 190 | Ga0207698_10070681 | 3300026142 | Bacteria | 2766 |
| 191 | Ga0207698_10192970 | 3300026142 | Bacteria | 1816 |
| 192 | Ga0207698_10746477 | 3300026142 | Bacteria | 977 |
| 193 | Ga0268266_10073925 | 3300028379 | Bacteria | 2959 |
| 194 | Ga0268266_10123888 | 3300028379 | Bacteria | 2303 |
| 195 | Ga0268266_10215531 | 3300028379 | Bacteria | 1762 |
| 196 | Ga0268266_10413974 | 3300028379 | Bacteria | 1276 |
| 197 | Ga0268266_10602656 | 3300028379 | Bacteria | 1055 |
| 198 | Ga0268265_10561167 | 3300028380 | Bacteria | 1085 |
| 199 | Ga0268264_10079904 | 3300028381 | Bacteria | 2791 |
| 200 | Ga0265318_10000052 | 3300028577 | Bacteria | 116086 |
| 201 | Ga0307515_10000428 | 3300028794 | Bacteria | 101247 |
| 202 | Ga0307515_10003157 | 3300028794 | Bacteria | 34863 |
| 203 | Ga0307513_10499487 | 3300031456 | Bacteria | 934 |
| 204 | Ga0307509_10220932 | 3300031507 | Bacteria | 1708 |
| 205 | Ga0307408_100030173 | 3300031548 | Bacteria | 3763 |
| 206 | Ga0307408_100118639 | 3300031548 | Bacteria | 2046 |
| 207 | Ga0307508_10161772 | 3300031616 | Bacteria | 1842 |
| 208 | Ga0307514_10010623 | 3300031649 | Bacteria | 7695 |
| 209 | Ga0307405_10359513 | 3300031731 | Bacteria | 1126 |
| 210 | Ga0307406_10001365 | 3300031901 | Bacteria | 13654 |
| 211 | Ga0307412_10403735 | 3300031911 | Bacteria | 1113 |
| 212 | Ga0307416_101025985 | 3300032002 | Bacteria | 928 |
| 213 | Ga0373928_0115101 | 3300035084 | Bacteria | 715 |
| 214 | Ga0373951_0048701 | 3300035091 | Bacteria | 1038 |
| 215 | Ga0373927_0278851 | 3300035695 | Bacteria | 1099 |
| 216 | Ga0373937_0192213 | 3300036401 | Bacteria | 1918 |
| 217 | Ga0373925_0031961 | 3300037068 | Bacteria | 3872 |
| 218 | Ga0373925_0904630 | 3300037068 | Bacteria | 727 |
| 219 | Ga0395900_0530936 | 3300037418 | Bacteria | 1123 |
| 220 | Ga0395905_0088497 | 3300037471 | Bacteria | 2902 |
| 221 | Ga0395901_0438175 | 3300038443 | Bacteria | 1338 |
| 222 | Ga0436361_0083282 | 3300039447 | Bacteria | 2222 |
| 223 | Ga0436362_0983151 | 3300039453 | Bacteria | 724 |
| 224 | Ga0451789_1143600 | 3300041443 | Bacteria | 921 |
| 225 | Ga0451793_1343240 | 3300041452 | Bacteria | 2710 |
| 226 | Ga0451797_0019421 | 3300041453 | Bacteria | 2451 |
| 227 | Ga0451807_1038351 | 3300041486 | Bacteria | 3555 |
| 228 | Ga0451833_0194768 | 3300041491 | Bacteria | 1294 |
| 229 | Ga0451841_0083979 | 3300041498 | Bacteria | 1581 |
| 230 | Ga0439434_0078723 | 3300042435 | Bacteria | 1044 |
| 231 | Ga0466972_0129375 | 3300044658 | Bacteria | 1189 |
| 232 | Ga0466957_0128968 | 3300044842 | Bacteria | 1618 |
| 233 | Ga0466960_0005779 | 3300044901 | Bacteria | 4925 |
| 234 | Ga0466959_0404095 | 3300045049 | Bacteria | 928 |
| 235 | Ga0466967_0062002 | 3300045976 | Bacteria | 3318 |
| 236 | Ga0466967_0209794 | 3300045976 | Bacteria | 1847 |
| 237 | Ga0495617_000038 | 3300046452 | Bacteria | 132535 |
| 238 | Ga0495590_0174040 | 3300046457 | Bacteria | 785 |
| 239 | Ga0495638_0000178 | 3300046460 | Bacteria | 98340 |
| 240 | Ga0495638_0108609 | 3300046460 | Bacteria | 1650 |
| 241 | Ga0495650_0013078 | 3300046471 | Bacteria | 4416 |
| 242 | Ga0495605_0031994 | 3300046474 | Bacteria | 2682 |
| 243 | Ga0495605_0054129 | 3300046474 | Bacteria | 1945 |
| 244 | Ga0495605_0094146 | 3300046474 | Bacteria | 1384 |
| 245 | Ga0495584_0004432 | 3300046491 | Bacteria | 7559 |
| 246 | Ga0495584_0024379 | 3300046491 | Bacteria | 3068 |
| 247 | Ga0495585_0000067 | 3300046492 | Bacteria | 107222 |
| 248 | Ga0495585_0000147 | 3300046492 | Bacteria | 76686 |
| 249 | Ga0495585_0001277 | 3300046492 | Bacteria | 20136 |
| 250 | Ga0495585_0001346 | 3300046492 | Bacteria | 19500 |
| 251 | Ga0495607_0000370 | 3300046501 | Bacteria | 46319 |
| 252 | Ga0495607_0040055 | 3300046501 | Bacteria | 2792 |
| 253 | Ga0495583_0052158 | 3300046506 | Bacteria | 1862 |
| 254 | Ga0495606_0000166 | 3300046507 | Bacteria | 116524 |
| 255 | Ga0495606_0000194 | 3300046507 | Bacteria | 106498 |
| 256 | Ga0495606_0005493 | 3300046507 | Bacteria | 12130 |
| 257 | Ga0495606_0129614 | 3300046507 | Bacteria | 1500 |
| 258 | Ga0495606_0140600 | 3300046507 | Bacteria | 1426 |
| 259 | Ga0495610_0012205 | 3300046512 | Bacteria | 5188 |
| 260 | Ga0495610_0048203 | 3300046512 | Bacteria | 2092 |
| 261 | Ga0495616_0000005 | 3300046513 | Bacteria | 260589 |
| 262 | Ga0495616_0087297 | 3300046513 | Bacteria | 1482 |
| 263 | Ga0495620_0000016 | 3300046515 | Bacteria | 153638 |
| 264 | Ga0495620_0001881 | 3300046515 | Bacteria | 12348 |
| 265 | Ga0495631_0000032 | 3300046518 | Bacteria | 85166 |
| 266 | Ga0495631_0000040 | 3300046518 | Bacteria | 79773 |
| 267 | Ga0495631_0002235 | 3300046518 | Bacteria | 11129 |
| 268 | Ga0495631_0078369 | 3300046518 | Bacteria | 1426 |
| 269 | Ga0495632_0007802 | 3300046519 | Bacteria | 6669 |
| 270 | Ga0495632_0050820 | 3300046519 | Bacteria | 2042 |
| 271 | Ga0495637_0009880 | 3300046520 | Bacteria | 4641 |
| 272 | Ga0495643_0027059 | 3300046522 | Bacteria | 3228 |
| 273 | Ga0495644_0211172 | 3300046523 | Bacteria | 749 |
| 274 | Ga0495648_0000142 | 3300046524 | Bacteria | 85573 |
| 275 | Ga0495648_0001532 | 3300046524 | Bacteria | 22598 |
| 276 | Ga0495642_0011883 | 3300046528 | Bacteria | 3354 |
| 277 | Ga0495642_0023051 | 3300046528 | Bacteria | 2456 |
| 278 | Ga0495642_0124661 | 3300046528 | Bacteria | 1106 |
| 279 | Ga0495609_0022162 | 3300046538 | Bacteria | 2927 |
| 280 | Ga0495609_0025278 | 3300046538 | Bacteria | 2724 |
| 281 | Ga0495621_0120579 | 3300046539 | Bacteria | 1013 |
| 282 | Ga0495597_0000198 | 3300046542 | Bacteria | 55237 |
| 283 | Ga0495597_0000774 | 3300046542 | Bacteria | 25307 |
| 284 | Ga0495597_0086997 | 3300046542 | Bacteria | 1330 |
| 285 | Ga0495633_0002418 | 3300046558 | Bacteria | 13198 |
| 286 | Ga0495633_0162420 | 3300046558 | Bacteria | 1030 |
| 287 | Ga0495668_0001933 | 3300046616 | Bacteria | 18432 |
| 288 | Ga0495668_0002249 | 3300046616 | Bacteria | 16281 |
| 289 | Ga0495668_0024727 | 3300046616 | Bacteria | 3416 |
| 290 | Ga0495668_0177701 | 3300046616 | Bacteria | 1166 |
| 291 | Ga0495611_0000002 | 3300046648 | Bacteria | 705677 |
| 292 | Ga0495611_0000036 | 3300046648 | Bacteria | 102447 |
| 293 | Ga0495611_0010576 | 3300046648 | Bacteria | 3903 |
| 294 | Ga0495625_0000002 | 3300046660 | Bacteria | 813323 |
| 295 | Ga0495625_0000056 | 3300046660 | Bacteria | 186024 |
| 296 | Ga0495625_0003027 | 3300046660 | Bacteria | 17240 |
| 297 | Ga0495625_0478836 | 3300046660 | Bacteria | 764 |
| 298 | Ga0495661_0000462 | 3300046665 | Bacteria | 43107 |
| 299 | Ga0495661_0000539 | 3300046665 | Bacteria | 39123 |
| 300 | Ga0495661_0000679 | 3300046665 | Bacteria | 33935 |
| 301 | Ga0495661_0052744 | 3300046665 | Bacteria | 2448 |
| 302 | Ga0495670_0000301 | 3300046691 | Bacteria | 23331 |
| 303 | Ga0495670_0005668 | 3300046691 | Bacteria | 6123 |
| 304 | Ga0495670_0008472 | 3300046691 | Bacteria | 5057 |
| 305 | Ga0495671_0000120 | 3300046692 | Bacteria | 71279 |
| 306 | Ga0495671_0157908 | 3300046692 | Bacteria | 1103 |
| 307 | Ga0495589_0000014 | 3300046794 | Bacteria | 246197 |
| 308 | Ga0495589_0013983 | 3300046794 | Bacteria | 4138 |
| 309 | Ga0495660_0000105 | 3300046810 | Bacteria | 90404 |
| 310 | Ga0495660_0000138 | 3300046810 | Bacteria | 79645 |
| 311 | Ga0495672_0002970 | 3300047320 | Bacteria | 14923 |
| 312 | Ga0495672_0073151 | 3300047320 | Bacteria | 1934 |
| 313 | Ga0495683_0000439 | 3300047323 | Bacteria | 32988 |
| 314 | Ga0495687_000310 | 3300047443 | Bacteria | 63709 |
| 315 | Ga0495687_001079 | 3300047443 | Bacteria | 26839 |
| 316 | Ga0495677_0001360 | 3300047445 | Bacteria | 9771 |
| 317 | Ga0495679_000003 | 3300047446 | Bacteria | 787868 |
| 318 | Ga0495679_074813 | 3300047446 | Bacteria | 970 |
| 319 | Ga0495673_0000043 | 3300047469 | Bacteria | 284984 |
| 320 | Ga0495673_0000291 | 3300047469 | Bacteria | 67241 |
| 321 | Ga0495673_0000474 | 3300047469 | Bacteria | 43418 |
| 322 | Ga0495673_0056553 | 3300047469 | Bacteria | 1697 |
| 323 | Ga0495681_0006212 | 3300047470 | Bacteria | 7878 |
| 324 | Ga0495681_0034722 | 3300047470 | Bacteria | 2510 |
| 325 | Ga0495686_0000213 | 3300047472 | Bacteria | 107285 |
| 326 | Ga0495686_0013136 | 3300047472 | Bacteria | 5762 |
| 327 | Ga0495686_0061868 | 3300047472 | Bacteria | 2323 |
| 328 | Ga0496100_0160019 | 3300048903 | Bacteria | 1613 |
| 329 | Ga0496101_0032084 | 3300048904 | Bacteria | 3695 |
| 330 | Ga0496101_0061284 | 3300048904 | Bacteria | 2732 |
| 331 | Ga0496106_0015867 | 3300048909 | Bacteria | 5572 |
| 332 | Ga0496106_0154488 | 3300048909 | Bacteria | 1811 |
| 333 | Ga0496114_0101093 | 3300048917 | Bacteria | 2461 |
| 334 | Ga0496115_0125880 | 3300048918 | Bacteria | 2111 |
| 335 | Ga0496121_0000184 | 3300048924 | Bacteria | 138791 |
| 336 | Ga0496121_0000609 | 3300048924 | Bacteria | 67016 |
| 337 | Ga0496121_0006326 | 3300048924 | Bacteria | 14767 |
| 338 | Ga0496121_0058914 | 3300048924 | Bacteria | 3170 |
| 339 | Ga0496121_0144078 | 3300048924 | Bacteria | 1763 |
| 340 | Ga0496121_0444972 | 3300048924 | Bacteria | 836 |
| 341 | Ga0496124_0201500 | 3300048927 | Bacteria | 1513 |
| 342 | Ga0495678_001321 | 3300049459 | Bacteria | 19875 |
| 343 | Ga0501031_0590587 | 3300049568 | Bacteria | 715 |
| 344 | Ga0501034_0059114 | 3300049571 | Bacteria | 3851 |
| 345 | Ga0501036_0086814 | 3300049572 | Bacteria | 2644 |
| 346 | Ga0501037_0137437 | 3300049573 | Bacteria | 1750 |
| 347 | Ga0501038_0252002 | 3300049574 | Bacteria | 1398 |
| 348 | Ga0501039_0131544 | 3300049575 | Bacteria | 1964 |
| 349 | Ga0501043_0066159 | 3300049579 | Bacteria | 2838 |
| 350 | Ga0501046_0027563 | 3300049580 | Bacteria | 4634 |
| 351 | Ga0501046_0257285 | 3300049580 | Bacteria | 1283 |
| 352 | Ga0501047_0117468 | 3300049581 | Bacteria | 2541 |
| 353 | Ga0501047_0801359 | 3300049581 | Bacteria | 757 |
| 354 | Ga0501047_0849468 | 3300049581 | Bacteria | 727 |
| 355 | Ga0501048_0054953 | 3300049582 | Bacteria | 2828 |
| 356 | Ga0501068_0161096 | 3300049584 | Bacteria | 1414 |
| 357 | Ga0501072_0005226 | 3300049588 | Bacteria | 9881 |
| 358 | Ga0501073_0159844 | 3300049589 | Bacteria | 1561 |
| 359 | Ga0501074_0150345 | 3300049590 | Bacteria | 1665 |
| 360 | Ga0501083_0267286 | 3300049744 | Bacteria | 1112 |
| 361 | Ga0501035_0423152 | 3300049822 | Bacteria | 1105 |
| 362 | nmdc:mga03683_17419_c1 | 3300050489 | Bacteria | 2719 |
| 363 | nmdc:mga00v17_187261_c1 | 3300050491 | Bacteria | 1336 |
| 364 | nmdc:mga0yw44_53460_c1 | 3300050492 | Bacteria | 2453 |
| 365 | nmdc:mga0k408_95_c1 | 3300050493 | Bacteria | 37179 |
| 366 | nmdc:mga0k408_9620_c1 | 3300050493 | Bacteria | 5216 |
| 367 | nmdc:mga07m45_257421_c1 | 3300050496 | Bacteria | 1015 |
| 368 | nmdc:mga07m45_90951_c1 | 3300050496 | Bacteria | 1748 |
| 369 | nmdc:mga06r32_144358_c1 | 3300050510 | Bacteria | 2357 |
| 370 | nmdc:mga06r32_200234_c1 | 3300050510 | Bacteria | 1985 |
| 371 | nmdc:mga06r32_514928_c1 | 3300050510 | Bacteria | 1172 |
| 372 | nmdc:mga08y16_540482_c1 | 3300050511 | Bacteria | 1180 |
| 373 | nmdc:mga0rr50_455039_c1 | 3300050513 | Bacteria | 1085 |
| 374 | Ga0495619_0041936 | 3300053085 | Bacteria | 2995 |
| 375 | Ga0500643_000165 | 3300053087 | Bacteria | 66133 |
| 376 | Ga0500555_000227 | 3300053103 | Bacteria | 25228 |
| 377 | Ga0500594_0023143 | 3300053118 | Bacteria | 1572 |
| 378 | Ga0500597_100909 | 3300053120 | Bacteria | 1255 |
| 379 | Ga0500608_001747 | 3300053122 | Bacteria | 7762 |
| 380 | Ga0500619_000064 | 3300053154 | Bacteria | 32285 |
| 381 | Ga0500622_0000228 | 3300053156 | Bacteria | 58436 |
| 382 | Ga0500633_0002549 | 3300053160 | Bacteria | 3778 |
| 383 | Ga0500645_000646 | 3300053730 | Bacteria | 22127 |
| 384 | Ga0466962_0025890 | 3300061719 | Bacteria | 2816 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044658 | Ga0466972_0129375 | Ga0466972_0129375_16_570 | 180 |
| 2 | 3300049568 | Ga0501031_0590587 | Ga0501031_0590587_94_687 | 184 |
| 3 | 3300039453 | Ga0436362_0983151 | Ga0436362_0983151_10_594 | 191 |
| 4 | 3300046539 | Ga0495621_0120579 | Ga0495621_0120579_408_998 | 191 |
| 5 | 3300037068 | Ga0373925_0904630 | Ga0373925_0904630_51_707 | 196 |
| 6 | 3300009094 | Ga0111539_10059772 | Ga0111539_100597725 | 197 |
| 7 | 3300046528 | Ga0495642_0011883 | Ga0495642_0011883_1838_2488 | 198 |
| 8 | 3300049573 | Ga0501037_0137437 | Ga0501037_0137437_318_956 | 199 |
| 9 | 3300049574 | Ga0501038_0252002 | Ga0501038_0252002_17_655 | 199 |
| 10 | 3300049580 | Ga0501046_0027563 | Ga0501046_0027563_1022_1660 | 199 |
| 11 | 3300049822 | Ga0501035_0423152 | Ga0501035_0423152_118_756 | 199 |
| 12 | 3300046506 | Ga0495583_0052158 | Ga0495583_0052158_552_1199 | 203 |
| 13 | 3300028577 | Ga0265318_10000052 | Ga0265318_1000005292 | 206 |
| 14 | 3300061719 | Ga0466962_0025890 | Ga0466962_0025890_32_700 | 208 |
| 15 | iso_pu_bacteria | 2509276021 | 2509387987 | 208 |
| 16 | iso_pu_bacteria | 2510917030 | 2511196660 | 208 |
| 17 | iso_pu_bacteria | 2643221658 | 2644325352 | 208 |
| 18 | iso_pu_bacteria | 2718217927 | 2719384599 | 208 |
| 19 | iso_pu_bacteria | 2718218334 | 2721029390 | 208 |
| 20 | iso_pu_bacteria | 2718218423 | 2721398309 | 208 |
| 21 | iso_pu_bacteria | 2721755809 | 2724037122 | 208 |
| 22 | iso_pu_bacteria | 2734482264 | 2735834994 | 208 |
| 23 | iso_pu_bacteria | 2738543009 | 2739227862 | 208 |
| 24 | iso_pu_bacteria | 2791355256 | 2793299663 | 208 |
| 25 | iso_pu_bacteria | 2791355262 | 2793332700 | 208 |
| 26 | iso_pu_bacteria | 2791355267 | 2793368190 | 208 |
| 27 | iso_pu_bacteria | 2824773399 | 2824780504 | 208 |
| 28 | iso_pu_bacteria | 2841864319 | 2841870565 | 208 |
| 29 | iso_pu_bacteria | 2842205361 | 2842206673 | 208 |
| 30 | iso_pu_bacteria | 2842278818 | 2842280634 | 208 |
| 31 | iso_pu_bacteria | 2842341865 | 2842348552 | 208 |
| 32 | iso_pu_bacteria | 2844002411 | 2844007778 | 208 |
| 33 | iso_pu_bacteria | 2881147464 | 2881154210 | 208 |
| 34 | iso_pu_bacteria | 2919100787 | 2919107226 | 208 |
| 35 | iso_pu_bacteria | 2919404418 | 2919407982 | 208 |
| 36 | iso_pu_bacteria | 2945945610 | 2945950532 | 208 |
| 37 | iso_pu_bacteria | 8005275841 | 8005279314 | 208 |
| 38 | iso_pu_bacteria | 8018176218 | 8018178176 | 208 |
| 39 | iso_pu_bacteria | 8056375014 | 8056379298 | 208 |
| 40 | 3300005367 | Ga0070667_100120594 | Ga0070667_1001205945 | 210 |
| 41 | 3300005548 | Ga0070665_100088220 | Ga0070665_1000882202 | 210 |
| 42 | 3300009177 | Ga0105248_10007658 | Ga0105248_1000765814 | 210 |
| 43 | 3300014969 | Ga0157376_10023986 | Ga0157376_100239864 | 210 |
| 44 | 3300028379 | Ga0268266_10073925 | Ga0268266_100739257 | 210 |
| 45 | 3300037068 | Ga0373925_0031961 | Ga0373925_0031961_2883_3527 | 210 |
| 46 | 3300005547 | Ga0070693_100000961 | Ga0070693_1000009612 | 211 |
| 47 | 3300036401 | Ga0373937_0192213 | Ga0373937_0192213_1042_1692 | 211 |
| 48 | 3300046460 | Ga0495638_0108609 | Ga0495638_0108609_131_784 | 211 |
| 49 | 3300046471 | Ga0495650_0013078 | Ga0495650_0013078_1346_1999 | 211 |
| 50 | 3300046474 | Ga0495605_0054129 | Ga0495605_0054129_66_719 | 211 |
| 51 | 3300046491 | Ga0495584_0024379 | Ga0495584_0024379_1895_2548 | 211 |
| 52 | 3300046492 | Ga0495585_0001346 | Ga0495585_0001346_3385_4038 | 211 |
| 53 | 3300046507 | Ga0495606_0000166 | Ga0495606_0000166_36857_37510 | 211 |
| 54 | 3300046507 | Ga0495606_0129614 | Ga0495606_0129614_188_841 | 211 |
| 55 | 3300046512 | Ga0495610_0012205 | Ga0495610_0012205_3687_4340 | 211 |
| 56 | 3300046513 | Ga0495616_0000005 | Ga0495616_0000005_220224_220877 | 211 |
| 57 | 3300046513 | Ga0495616_0087297 | Ga0495616_0087297_696_1358 | 211 |
| 58 | 3300046515 | Ga0495620_0001881 | Ga0495620_0001881_9142_9780 | 211 |
| 59 | 3300046518 | Ga0495631_0000032 | Ga0495631_0000032_25714_26367 | 211 |
| 60 | 3300046519 | Ga0495632_0007802 | Ga0495632_0007802_5785_6438 | 211 |
| 61 | 3300046519 | Ga0495632_0050820 | Ga0495632_0050820_1361_2014 | 211 |
| 62 | 3300046524 | Ga0495648_0001532 | Ga0495648_0001532_2492_3145 | 211 |
| 63 | 3300046648 | Ga0495611_0000036 | Ga0495611_0000036_59812_60465 | 211 |
| 64 | 3300046660 | Ga0495625_0478836 | Ga0495625_0478836_24_677 | 211 |
| 65 | 3300046691 | Ga0495670_0005668 | Ga0495670_0005668_2184_2837 | 211 |
| 66 | 3300047323 | Ga0495683_0000439 | Ga0495683_0000439_14647_15300 | 211 |
| 67 | 3300047469 | Ga0495673_0000291 | Ga0495673_0000291_10109_10762 | 211 |
| 68 | 3300047469 | Ga0495673_0056553 | Ga0495673_0056553_405_1058 | 211 |
| 69 | 3300047472 | Ga0495686_0061868 | Ga0495686_0061868_1039_1692 | 211 |
| 70 | 3300048924 | Ga0496121_0000184 | Ga0496121_0000184_82873_83526 | 211 |
| 71 | 3300049588 | Ga0501072_0005226 | Ga0501072_0005226_8460_9095 | 211 |
| 72 | 3300049744 | Ga0501083_0267286 | Ga0501083_0267286_254_889 | 211 |
| 73 | 3300053160 | Ga0500633_0002549 | Ga0500633_0002549_2985_3638 | 211 |
| 74 | 3300002155 | JGI24033J26618_1010981 | JGI24033J26618_10109811 | 212 |
| 75 | 3300003578 | Ga0006562J51391_1047541 | Ga0006562J51391_10475413 | 212 |
| 76 | 3300003790 | Ga0055528_1005915 | Ga0055528_10059156 | 212 |
| 77 | 3300003792 | Ga0055540_1000251 | Ga0055540_100025116 | 212 |
| 78 | 3300005288 | Ga0065714_10002968 | Ga0065714_100029689 | 212 |
| 79 | 3300005290 | Ga0065712_10118861 | Ga0065712_101188612 | 212 |
| 80 | 3300005293 | Ga0065715_10002429 | Ga0065715_100024295 | 212 |
| 81 | 3300005327 | Ga0070658_10105602 | Ga0070658_101056022 | 212 |
| 82 | 3300005329 | Ga0070683_100002110 | Ga0070683_1000021109 | 212 |
| 83 | 3300005329 | Ga0070683_100235608 | Ga0070683_1002356082 | 212 |
| 84 | 3300005330 | Ga0070690_100064984 | Ga0070690_1000649842 | 212 |
| 85 | 3300005331 | Ga0070670_100014510 | Ga0070670_1000145105 | 212 |
| 86 | 3300005331 | Ga0070670_100057447 | Ga0070670_1000574472 | 212 |
| 87 | 3300005331 | Ga0070670_100079005 | Ga0070670_1000790054 | 212 |
| 88 | 3300005331 | Ga0070670_100190528 | Ga0070670_1001905282 | 212 |
| 89 | 3300005331 | Ga0070670_100276706 | Ga0070670_1002767062 | 212 |
| 90 | 3300005334 | Ga0068869_100024175 | Ga0068869_1000241752 | 212 |
| 91 | 3300005336 | Ga0070680_100662962 | Ga0070680_1006629621 | 212 |
| 92 | 3300005337 | Ga0070682_100001349 | Ga0070682_10000134914 | 212 |
| 93 | 3300005338 | Ga0068868_100056925 | Ga0068868_1000569252 | 212 |
| 94 | 3300005339 | Ga0070660_100018261 | Ga0070660_1000182615 | 212 |
| 95 | 3300005339 | Ga0070660_100036670 | Ga0070660_1000366703 | 212 |
| 96 | 3300005339 | Ga0070660_100210988 | Ga0070660_1002109882 | 212 |
| 97 | 3300005340 | Ga0070689_100000018 | Ga0070689_100000018109 | 212 |
| 98 | 3300005340 | Ga0070689_100123818 | Ga0070689_1001238182 | 212 |
| 99 | 3300005344 | Ga0070661_100006111 | Ga0070661_1000061112 | 212 |
| 100 | 3300005344 | Ga0070661_100021529 | Ga0070661_1000215294 | 212 |
| 101 | 3300005344 | Ga0070661_100022569 | Ga0070661_1000225694 | 212 |
| 102 | 3300005344 | Ga0070661_100156381 | Ga0070661_1001563812 | 212 |
| 103 | 3300005344 | Ga0070661_100313325 | Ga0070661_1003133252 | 212 |
| 104 | 3300005345 | Ga0070692_10124064 | Ga0070692_101240642 | 212 |
| 105 | 3300005354 | Ga0070675_100765477 | Ga0070675_1007654771 | 212 |
| 106 | 3300005355 | Ga0070671_100012577 | Ga0070671_1000125774 | 212 |
| 107 | 3300005356 | Ga0070674_100641968 | Ga0070674_1006419682 | 212 |
| 108 | 3300005364 | Ga0070673_100790782 | Ga0070673_1007907821 | 212 |
| 109 | 3300005365 | Ga0070688_100049261 | Ga0070688_1000492612 | 212 |
| 110 | 3300005366 | Ga0070659_100000593 | Ga0070659_10000059318 | 212 |
| 111 | 3300005366 | Ga0070659_100003492 | Ga0070659_1000034928 | 212 |
| 112 | 3300005366 | Ga0070659_100034731 | Ga0070659_1000347312 | 212 |
| 113 | 3300005366 | Ga0070659_100089522 | Ga0070659_1000895223 | 212 |
| 114 | 3300005438 | Ga0070701_10017600 | Ga0070701_100176002 | 212 |
| 115 | 3300005455 | Ga0070663_100027175 | Ga0070663_1000271754 | 212 |
| 116 | 3300005455 | Ga0070663_100049845 | Ga0070663_1000498453 | 212 |
| 117 | 3300005458 | Ga0070681_10003684 | Ga0070681_1000368419 | 212 |
| 118 | 3300005459 | Ga0068867_100234028 | Ga0068867_1002340282 | 212 |
| 119 | 3300005466 | Ga0070685_10014535 | Ga0070685_100145352 | 212 |
| 120 | 3300005535 | Ga0070684_100118732 | Ga0070684_1001187322 | 212 |
| 121 | 3300005535 | Ga0070684_100396897 | Ga0070684_1003968972 | 212 |
| 122 | 3300005539 | Ga0068853_100005463 | Ga0068853_1000054637 | 212 |
| 123 | 3300005539 | Ga0068853_100006379 | Ga0068853_1000063798 | 212 |
| 124 | 3300005544 | Ga0070686_100006255 | Ga0070686_1000062552 | 212 |
| 125 | 3300005548 | Ga0070665_100022090 | Ga0070665_1000220906 | 212 |
| 126 | 3300005548 | Ga0070665_100074178 | Ga0070665_1000741782 | 212 |
| 127 | 3300005548 | Ga0070665_100534032 | Ga0070665_1005340322 | 212 |
| 128 | 3300005563 | Ga0068855_100047177 | Ga0068855_1000471774 | 212 |
| 129 | 3300005564 | Ga0070664_100025348 | Ga0070664_1000253483 | 212 |
| 130 | 3300005564 | Ga0070664_100224288 | Ga0070664_1002242882 | 212 |
| 131 | 3300005564 | Ga0070664_100282346 | Ga0070664_1002823462 | 212 |
| 132 | 3300005577 | Ga0068857_100049201 | Ga0068857_1000492013 | 212 |
| 133 | 3300005578 | Ga0068854_100109393 | Ga0068854_1001093931 | 212 |
| 134 | 3300005614 | Ga0068856_100234626 | Ga0068856_1002346262 | 212 |
| 135 | 3300005616 | Ga0068852_100494235 | Ga0068852_1004942352 | 212 |
| 136 | 3300005618 | Ga0068864_100026854 | Ga0068864_1000268544 | 212 |
| 137 | 3300005834 | Ga0068851_10003898 | Ga0068851_100038985 | 212 |
| 138 | 3300005840 | Ga0068870_10001520 | Ga0068870_100015205 | 212 |
| 139 | 3300005840 | Ga0068870_10246402 | Ga0068870_102464022 | 212 |
| 140 | 3300005841 | Ga0068863_100000020 | Ga0068863_100000020209 | 212 |
| 141 | 3300005841 | Ga0068863_100023840 | Ga0068863_1000238402 | 212 |
| 142 | 3300005842 | Ga0068858_100032382 | Ga0068858_1000323824 | 212 |
| 143 | 3300005842 | Ga0068858_100237222 | Ga0068858_1002372222 | 212 |
| 144 | 3300005844 | Ga0068862_100062221 | Ga0068862_1000622213 | 212 |
| 145 | 3300005844 | Ga0068862_100078298 | Ga0068862_1000782982 | 212 |
| 146 | 3300005937 | Ga0081455_10000940 | Ga0081455_1000094021 | 212 |
| 147 | 3300005983 | Ga0081540_1008611 | Ga0081540_10086117 | 212 |
| 148 | 3300006038 | Ga0075365_10103043 | Ga0075365_101030433 | 212 |
| 149 | 3300006048 | Ga0075363_100068318 | Ga0075363_1000683183 | 212 |
| 150 | 3300006051 | Ga0075364_10216827 | Ga0075364_102168271 | 212 |
| 151 | 3300006178 | Ga0075367_10087375 | Ga0075367_100873753 | 212 |
| 152 | 3300006178 | Ga0075367_10107815 | Ga0075367_101078152 | 212 |
| 153 | 3300006178 | Ga0075367_10218744 | Ga0075367_102187442 | 212 |
| 154 | 3300006186 | Ga0075369_10175309 | Ga0075369_101753091 | 212 |
| 155 | 3300006195 | Ga0075366_10004948 | Ga0075366_100049482 | 212 |
| 156 | 3300006353 | Ga0075370_10036323 | Ga0075370_100363232 | 212 |
| 157 | 3300006353 | Ga0075370_10212668 | Ga0075370_102126682 | 212 |
| 158 | 3300006844 | Ga0075428_100935933 | Ga0075428_1009359332 | 212 |
| 159 | 3300006846 | Ga0075430_100002431 | Ga0075430_10000243112 | 212 |
| 160 | 3300006847 | Ga0075431_100566389 | Ga0075431_1005663892 | 212 |
| 161 | 3300006852 | Ga0075433_10046388 | Ga0075433_100463881 | 212 |
| 162 | 3300006880 | Ga0075429_100178243 | Ga0075429_1001782433 | 212 |
| 163 | 3300006881 | Ga0068865_100022310 | Ga0068865_1000223102 | 212 |
| 164 | 3300009036 | Ga0105244_10158819 | Ga0105244_101588192 | 212 |
| 165 | 3300009093 | Ga0105240_10704439 | Ga0105240_107044391 | 212 |
| 166 | 3300009094 | Ga0111539_10383274 | Ga0111539_103832742 | 212 |
| 167 | 3300009148 | Ga0105243_10044486 | Ga0105243_100444862 | 212 |
| 168 | 3300009174 | Ga0105241_10064996 | Ga0105241_100649963 | 212 |
| 169 | 3300009176 | Ga0105242_10169262 | Ga0105242_101692622 | 212 |
| 170 | 3300009176 | Ga0105242_10375242 | Ga0105242_103752422 | 212 |
| 171 | 3300009176 | Ga0105242_10379540 | Ga0105242_103795402 | 212 |
| 172 | 3300009545 | Ga0105237_10101398 | Ga0105237_101013983 | 212 |
| 173 | 3300009545 | Ga0105237_10841881 | Ga0105237_108418811 | 212 |
| 174 | 3300010375 | Ga0105239_10010833 | Ga0105239_100108336 | 212 |
| 175 | 3300010375 | Ga0105239_10273340 | Ga0105239_102733403 | 212 |
| 176 | 3300011119 | Ga0105246_10123637 | Ga0105246_101236372 | 212 |
| 177 | 3300013104 | Ga0157370_10030116 | Ga0157370_100301165 | 212 |
| 178 | 3300013296 | Ga0157374_10160162 | Ga0157374_101601622 | 212 |
| 179 | 3300013296 | Ga0157374_10170344 | Ga0157374_101703442 | 212 |
| 180 | 3300013306 | Ga0163162_10364732 | Ga0163162_103647322 | 212 |
| 181 | 3300013306 | Ga0163162_10535671 | Ga0163162_105356713 | 212 |
| 182 | 3300013308 | Ga0157375_10193522 | Ga0157375_101935222 | 212 |
| 183 | 3300013308 | Ga0157375_11223629 | Ga0157375_112236292 | 212 |
| 184 | 3300014325 | Ga0163163_10163284 | Ga0163163_101632842 | 212 |
| 185 | 3300014326 | Ga0157380_10001901 | Ga0157380_1000190112 | 212 |
| 186 | 3300014326 | Ga0157380_10013862 | Ga0157380_100138622 | 212 |
| 187 | 3300014497 | Ga0182008_10015372 | Ga0182008_100153724 | 212 |
| 188 | 3300014745 | Ga0157377_10002075 | Ga0157377_100020754 | 212 |
| 189 | 3300014745 | Ga0157377_10375807 | Ga0157377_103758071 | 212 |
| 190 | 3300014968 | Ga0157379_10116036 | Ga0157379_101160362 | 212 |
| 191 | 3300014969 | Ga0157376_10308088 | Ga0157376_103080882 | 212 |
| 192 | 3300015261 | Ga0182006_1000181 | Ga0182006_100018155 | 212 |
| 193 | 3300015261 | Ga0182006_1000832 | Ga0182006_100083217 | 212 |
| 194 | 3300025273 | Ga0209673_1000974 | Ga0209673_100097413 | 212 |
| 195 | 3300025290 | Ga0207673_1016986 | Ga0207673_10169861 | 212 |
| 196 | 3300025292 | Ga0209676_1022071 | Ga0209676_10220712 | 212 |
| 197 | 3300025303 | Ga0209051_1000127 | Ga0209051_1000127144 | 212 |
| 198 | 3300025304 | Ga0209257_1003156 | Ga0209257_10031563 | 212 |
| 199 | 3300025315 | Ga0207697_10008216 | Ga0207697_100082161 | 212 |
| 200 | 3300025321 | Ga0207656_10011206 | Ga0207656_100112062 | 212 |
| 201 | 3300025900 | Ga0207710_10084062 | Ga0207710_100840622 | 212 |
| 202 | 3300025901 | Ga0207688_10020769 | Ga0207688_100207692 | 212 |
| 203 | 3300025904 | Ga0207647_10049374 | Ga0207647_100493742 | 212 |
| 204 | 3300025907 | Ga0207645_10008488 | Ga0207645_100084884 | 212 |
| 205 | 3300025908 | Ga0207643_10000393 | Ga0207643_1000039314 | 212 |
| 206 | 3300025909 | Ga0207705_10015800 | Ga0207705_100158003 | 212 |
| 207 | 3300025911 | Ga0207654_10108750 | Ga0207654_101087501 | 212 |
| 208 | 3300025912 | Ga0207707_10005151 | Ga0207707_1000515116 | 212 |
| 209 | 3300025914 | Ga0207671_10289405 | Ga0207671_102894051 | 212 |
| 210 | 3300025917 | Ga0207660_10497722 | Ga0207660_104977221 | 212 |
| 211 | 3300025919 | Ga0207657_10027790 | Ga0207657_100277905 | 212 |
| 212 | 3300025919 | Ga0207657_10051122 | Ga0207657_100511222 | 212 |
| 213 | 3300025919 | Ga0207657_10108868 | Ga0207657_101088682 | 212 |
| 214 | 3300025920 | Ga0207649_10024237 | Ga0207649_100242371 | 212 |
| 215 | 3300025920 | Ga0207649_10026469 | Ga0207649_100264693 | 212 |
| 216 | 3300025920 | Ga0207649_10245222 | Ga0207649_102452222 | 212 |
| 217 | 3300025923 | Ga0207681_10588445 | Ga0207681_105884451 | 212 |
| 218 | 3300025925 | Ga0207650_10018966 | Ga0207650_100189663 | 212 |
| 219 | 3300025925 | Ga0207650_10662293 | Ga0207650_106622932 | 212 |
| 220 | 3300025926 | Ga0207659_10014895 | Ga0207659_100148952 | 212 |
| 221 | 3300025931 | Ga0207644_10000622 | Ga0207644_1000062210 | 212 |
| 222 | 3300025931 | Ga0207644_10363906 | Ga0207644_103639063 | 212 |
| 223 | 3300025932 | Ga0207690_10001299 | Ga0207690_1000129911 | 212 |
| 224 | 3300025932 | Ga0207690_10001599 | Ga0207690_100015999 | 212 |
| 225 | 3300025932 | Ga0207690_10041564 | Ga0207690_100415644 | 212 |
| 226 | 3300025933 | Ga0207706_10006641 | Ga0207706_100066418 | 212 |
| 227 | 3300025936 | Ga0207670_10000001 | Ga0207670_10000001108 | 212 |
| 228 | 3300025936 | Ga0207670_10076065 | Ga0207670_100760651 | 212 |
| 229 | 3300025937 | Ga0207669_10023932 | Ga0207669_100239321 | 212 |
| 230 | 3300025937 | Ga0207669_10528445 | Ga0207669_105284452 | 212 |
| 231 | 3300025941 | Ga0207711_10040633 | Ga0207711_100406332 | 212 |
| 232 | 3300025942 | Ga0207689_10007921 | Ga0207689_100079216 | 212 |
| 233 | 3300025942 | Ga0207689_10529960 | Ga0207689_105299602 | 212 |
| 234 | 3300025944 | Ga0207661_10000484 | Ga0207661_1000048419 | 212 |
| 235 | 3300025945 | Ga0207679_10000536 | Ga0207679_100005363 | 212 |
| 236 | 3300025945 | Ga0207679_10282811 | Ga0207679_102828112 | 212 |
| 237 | 3300025945 | Ga0207679_10461973 | Ga0207679_104619731 | 212 |
| 238 | 3300025949 | Ga0207667_10004555 | Ga0207667_100045554 | 212 |
| 239 | 3300025960 | Ga0207651_10075235 | Ga0207651_100752352 | 212 |
| 240 | 3300025972 | Ga0207668_10000039 | Ga0207668_1000003990 | 212 |
| 241 | 3300025972 | Ga0207668_10635858 | Ga0207668_106358582 | 212 |
| 242 | 3300025981 | Ga0207640_10226464 | Ga0207640_102264641 | 212 |
| 243 | 3300026035 | Ga0207703_10170788 | Ga0207703_101707882 | 212 |
| 244 | 3300026041 | Ga0207639_10012580 | Ga0207639_100125807 | 212 |
| 245 | 3300026041 | Ga0207639_10023413 | Ga0207639_100234136 | 212 |
| 246 | 3300026041 | Ga0207639_10822327 | Ga0207639_108223272 | 212 |
| 247 | 3300026067 | Ga0207678_10020969 | Ga0207678_100209691 | 212 |
| 248 | 3300026067 | Ga0207678_10078227 | Ga0207678_100782273 | 212 |
| 249 | 3300026078 | Ga0207702_10506182 | Ga0207702_105061822 | 212 |
| 250 | 3300026088 | Ga0207641_10000001 | Ga0207641_100000011155 | 212 |
| 251 | 3300026088 | Ga0207641_10182406 | Ga0207641_101824062 | 212 |
| 252 | 3300026089 | Ga0207648_10022608 | Ga0207648_100226085 | 212 |
| 253 | 3300026095 | Ga0207676_10491728 | Ga0207676_104917281 | 212 |
| 254 | 3300026116 | Ga0207674_10119040 | Ga0207674_101190402 | 212 |
| 255 | 3300026118 | Ga0207675_100139728 | Ga0207675_1001397284 | 212 |
| 256 | 3300026142 | Ga0207698_10070681 | Ga0207698_100706814 | 212 |
| 257 | 3300026142 | Ga0207698_10192970 | Ga0207698_101929702 | 212 |
| 258 | 3300026142 | Ga0207698_10746477 | Ga0207698_107464772 | 212 |
| 259 | 3300028379 | Ga0268266_10123888 | Ga0268266_101238882 | 212 |
| 260 | 3300028379 | Ga0268266_10215531 | Ga0268266_102155312 | 212 |
| 261 | 3300028379 | Ga0268266_10413974 | Ga0268266_104139743 | 212 |
| 262 | 3300028379 | Ga0268266_10602656 | Ga0268266_106026562 | 212 |
| 263 | 3300028380 | Ga0268265_10561167 | Ga0268265_105611671 | 212 |
| 264 | 3300028381 | Ga0268264_10079904 | Ga0268264_100799044 | 212 |
| 265 | 3300028794 | Ga0307515_10000428 | Ga0307515_1000042870 | 212 |
| 266 | 3300028794 | Ga0307515_10003157 | Ga0307515_1000315717 | 212 |
| 267 | 3300031456 | Ga0307513_10499487 | Ga0307513_104994872 | 212 |
| 268 | 3300031507 | Ga0307509_10220932 | Ga0307509_102209322 | 212 |
| 269 | 3300031548 | Ga0307408_100030173 | Ga0307408_1000301735 | 212 |
| 270 | 3300031548 | Ga0307408_100118639 | Ga0307408_1001186392 | 212 |
| 271 | 3300031616 | Ga0307508_10161772 | Ga0307508_101617723 | 212 |
| 272 | 3300031649 | Ga0307514_10010623 | Ga0307514_100106235 | 212 |
| 273 | 3300031731 | Ga0307405_10359513 | Ga0307405_103595132 | 212 |
| 274 | 3300031901 | Ga0307406_10001365 | Ga0307406_100013655 | 212 |
| 275 | 3300031911 | Ga0307412_10403735 | Ga0307412_104037351 | 212 |
| 276 | 3300032002 | Ga0307416_101025985 | Ga0307416_1010259851 | 212 |
| 277 | 3300035084 | Ga0373928_0115101 | Ga0373928_0115101_47_700 | 212 |
| 278 | 3300035091 | Ga0373951_0048701 | Ga0373951_0048701_89_742 | 212 |
| 279 | 3300035695 | Ga0373927_0278851 | Ga0373927_0278851_191_844 | 212 |
| 280 | 3300037418 | Ga0395900_0530936 | Ga0395900_0530936_172_819 | 212 |
| 281 | 3300037471 | Ga0395905_0088497 | Ga0395905_0088497_321_968 | 212 |
| 282 | 3300038443 | Ga0395901_0438175 | Ga0395901_0438175_159_812 | 212 |
| 283 | 3300039447 | Ga0436361_0083282 | Ga0436361_0083282_1013_1663 | 212 |
| 284 | 3300041443 | Ga0451789_1143600 | Ga0451789_1143600_255_908 | 212 |
| 285 | 3300041452 | Ga0451793_1343240 | Ga0451793_1343240_1909_2583 | 212 |
| 286 | 3300041453 | Ga0451797_0019421 | Ga0451797_0019421_1038_1712 | 212 |
| 287 | 3300041486 | Ga0451807_1038351 | Ga0451807_1038351_416_1090 | 212 |
| 288 | 3300041491 | Ga0451833_0194768 | Ga0451833_0194768_340_981 | 212 |
| 289 | 3300041498 | Ga0451841_0083979 | Ga0451841_0083979_142_792 | 212 |
| 290 | 3300042435 | Ga0439434_0078723 | Ga0439434_0078723_14_667 | 212 |
| 291 | 3300044901 | Ga0466960_0005779 | Ga0466960_0005779_1771_2454 | 212 |
| 292 | 3300045976 | Ga0466967_0062002 | Ga0466967_0062002_317_961 | 212 |
| 293 | 3300046452 | Ga0495617_000038 | Ga0495617_000038_33633_34274 | 212 |
| 294 | 3300046457 | Ga0495590_0174040 | Ga0495590_0174040_29_685 | 212 |
| 295 | 3300046460 | Ga0495638_0000178 | Ga0495638_0000178_66146_66802 | 212 |
| 296 | 3300046474 | Ga0495605_0031994 | Ga0495605_0031994_1847_2494 | 212 |
| 297 | 3300046474 | Ga0495605_0094146 | Ga0495605_0094146_643_1299 | 212 |
| 298 | 3300046491 | Ga0495584_0004432 | Ga0495584_0004432_6277_6942 | 212 |
| 299 | 3300046492 | Ga0495585_0000067 | Ga0495585_0000067_42391_43047 | 212 |
| 300 | 3300046492 | Ga0495585_0000147 | Ga0495585_0000147_74321_74971 | 212 |
| 301 | 3300046492 | Ga0495585_0001277 | Ga0495585_0001277_16794_17459 | 212 |
| 302 | 3300046501 | Ga0495607_0000370 | Ga0495607_0000370_18785_19441 | 212 |
| 303 | 3300046501 | Ga0495607_0040055 | Ga0495607_0040055_189_836 | 212 |
| 304 | 3300046507 | Ga0495606_0000194 | Ga0495606_0000194_42093_42734 | 212 |
| 305 | 3300046507 | Ga0495606_0005493 | Ga0495606_0005493_5446_6096 | 212 |
| 306 | 3300046507 | Ga0495606_0140600 | Ga0495606_0140600_723_1376 | 212 |
| 307 | 3300046512 | Ga0495610_0048203 | Ga0495610_0048203_964_1620 | 212 |
| 308 | 3300046515 | Ga0495620_0000016 | Ga0495620_0000016_53186_53827 | 212 |
| 309 | 3300046518 | Ga0495631_0000040 | Ga0495631_0000040_13868_14524 | 212 |
| 310 | 3300046518 | Ga0495631_0002235 | Ga0495631_0002235_7875_8540 | 212 |
| 311 | 3300046518 | Ga0495631_0078369 | Ga0495631_0078369_752_1399 | 212 |
| 312 | 3300046520 | Ga0495637_0009880 | Ga0495637_0009880_830_1486 | 212 |
| 313 | 3300046522 | Ga0495643_0027059 | Ga0495643_0027059_2123_2779 | 212 |
| 314 | 3300046523 | Ga0495644_0211172 | Ga0495644_0211172_52_717 | 212 |
| 315 | 3300046524 | Ga0495648_0000142 | Ga0495648_0000142_2923_3579 | 212 |
| 316 | 3300046528 | Ga0495642_0023051 | Ga0495642_0023051_773_1429 | 212 |
| 317 | 3300046528 | Ga0495642_0124661 | Ga0495642_0124661_209_859 | 212 |
| 318 | 3300046538 | Ga0495609_0022162 | Ga0495609_0022162_1131_1787 | 212 |
| 319 | 3300046538 | Ga0495609_0025278 | Ga0495609_0025278_751_1398 | 212 |
| 320 | 3300046542 | Ga0495597_0000198 | Ga0495597_0000198_50114_50761 | 212 |
| 321 | 3300046542 | Ga0495597_0000774 | Ga0495597_0000774_16353_17009 | 212 |
| 322 | 3300046542 | Ga0495597_0086997 | Ga0495597_0086997_309_959 | 212 |
| 323 | 3300046558 | Ga0495633_0002418 | Ga0495633_0002418_1442_2107 | 212 |
| 324 | 3300046558 | Ga0495633_0162420 | Ga0495633_0162420_258_908 | 212 |
| 325 | 3300046616 | Ga0495668_0001933 | Ga0495668_0001933_6270_6926 | 212 |
| 326 | 3300046616 | Ga0495668_0002249 | Ga0495668_0002249_13958_14614 | 212 |
| 327 | 3300046616 | Ga0495668_0024727 | Ga0495668_0024727_2274_2924 | 212 |
| 328 | 3300046616 | Ga0495668_0177701 | Ga0495668_0177701_74_730 | 212 |
| 329 | 3300046648 | Ga0495611_0000002 | Ga0495611_0000002_731_1387 | 212 |
| 330 | 3300046648 | Ga0495611_0010576 | Ga0495611_0010576_1258_1923 | 212 |
| 331 | 3300046660 | Ga0495625_0000002 | Ga0495625_0000002_731_1387 | 212 |
| 332 | 3300046660 | Ga0495625_0000056 | Ga0495625_0000056_68089_68742 | 212 |
| 333 | 3300046660 | Ga0495625_0003027 | Ga0495625_0003027_1503_2144 | 212 |
| 334 | 3300046665 | Ga0495661_0000462 | Ga0495661_0000462_42272_42919 | 212 |
| 335 | 3300046665 | Ga0495661_0000539 | Ga0495661_0000539_14542_15207 | 212 |
| 336 | 3300046665 | Ga0495661_0000679 | Ga0495661_0000679_2358_3014 | 212 |
| 337 | 3300046665 | Ga0495661_0052744 | Ga0495661_0052744_94_744 | 212 |
| 338 | 3300046691 | Ga0495670_0000301 | Ga0495670_0000301_5802_6467 | 212 |
| 339 | 3300046691 | Ga0495670_0008472 | Ga0495670_0008472_1470_2126 | 212 |
| 340 | 3300046692 | Ga0495671_0000120 | Ga0495671_0000120_47546_48202 | 212 |
| 341 | 3300046692 | Ga0495671_0157908 | Ga0495671_0157908_361_1011 | 212 |
| 342 | 3300046794 | Ga0495589_0000014 | Ga0495589_0000014_731_1387 | 212 |
| 343 | 3300046794 | Ga0495589_0013983 | Ga0495589_0013983_254_910 | 212 |
| 344 | 3300046810 | Ga0495660_0000105 | Ga0495660_0000105_32078_32734 | 212 |
| 345 | 3300046810 | Ga0495660_0000138 | Ga0495660_0000138_42266_42922 | 212 |
| 346 | 3300047320 | Ga0495672_0002970 | Ga0495672_0002970_11929_12585 | 212 |
| 347 | 3300047320 | Ga0495672_0073151 | Ga0495672_0073151_341_979 | 212 |
| 348 | 3300047443 | Ga0495687_000310 | Ga0495687_000310_20035_20673 | 212 |
| 349 | 3300047443 | Ga0495687_001079 | Ga0495687_001079_23451_24089 | 212 |
| 350 | 3300047445 | Ga0495677_0001360 | Ga0495677_0001360_1439_2104 | 212 |
| 351 | 3300047446 | Ga0495679_000003 | Ga0495679_000003_786433_787089 | 212 |
| 352 | 3300047446 | Ga0495679_074813 | Ga0495679_074813_274_939 | 212 |
| 353 | 3300047469 | Ga0495673_0000043 | Ga0495673_0000043_241523_242179 | 212 |
| 354 | 3300047469 | Ga0495673_0000474 | Ga0495673_0000474_42032_42688 | 212 |
| 355 | 3300047470 | Ga0495681_0006212 | Ga0495681_0006212_6521_7186 | 212 |
| 356 | 3300047470 | Ga0495681_0034722 | Ga0495681_0034722_605_1261 | 212 |
| 357 | 3300047472 | Ga0495686_0000213 | Ga0495686_0000213_11643_12296 | 212 |
| 358 | 3300047472 | Ga0495686_0013136 | Ga0495686_0013136_189_830 | 212 |
| 359 | 3300048903 | Ga0496100_0160019 | Ga0496100_0160019_922_1566 | 212 |
| 360 | 3300048904 | Ga0496101_0032084 | Ga0496101_0032084_568_1221 | 212 |
| 361 | 3300048904 | Ga0496101_0061284 | Ga0496101_0061284_1509_2153 | 212 |
| 362 | 3300048909 | Ga0496106_0015867 | Ga0496106_0015867_2963_3619 | 212 |
| 363 | 3300048909 | Ga0496106_0154488 | Ga0496106_0154488_1003_1677 | 212 |
| 364 | 3300048917 | Ga0496114_0101093 | Ga0496114_0101093_34_816 | 212 |
| 365 | 3300048918 | Ga0496115_0125880 | Ga0496115_0125880_1325_1978 | 212 |
| 366 | 3300048924 | Ga0496121_0000609 | Ga0496121_0000609_51785_52441 | 212 |
| 367 | 3300048924 | Ga0496121_0006326 | Ga0496121_0006326_8864_9520 | 212 |
| 368 | 3300048924 | Ga0496121_0058914 | Ga0496121_0058914_68_709 | 212 |
| 369 | 3300048924 | Ga0496121_0144078 | Ga0496121_0144078_901_1557 | 212 |
| 370 | 3300048924 | Ga0496121_0444972 | Ga0496121_0444972_68_709 | 212 |
| 371 | 3300048927 | Ga0496124_0201500 | Ga0496124_0201500_252_908 | 212 |
| 372 | 3300049459 | Ga0495678_001321 | Ga0495678_001321_18489_19145 | 212 |
| 373 | 3300049571 | Ga0501034_0059114 | Ga0501034_0059114_3148_3798 | 212 |
| 374 | 3300049572 | Ga0501036_0086814 | Ga0501036_0086814_879_1526 | 212 |
| 375 | 3300049575 | Ga0501039_0131544 | Ga0501039_0131544_398_1045 | 212 |
| 376 | 3300049579 | Ga0501043_0066159 | Ga0501043_0066159_1652_2314 | 212 |
| 377 | 3300049580 | Ga0501046_0257285 | Ga0501046_0257285_109_756 | 212 |
| 378 | 3300049581 | Ga0501047_0117468 | Ga0501047_0117468_62_709 | 212 |
| 379 | 3300049581 | Ga0501047_0801359 | Ga0501047_0801359_14_670 | 212 |
| 380 | 3300049581 | Ga0501047_0849468 | Ga0501047_0849468_16_672 | 212 |
| 381 | 3300049582 | Ga0501048_0054953 | Ga0501048_0054953_1209_1862 | 212 |
| 382 | 3300049584 | Ga0501068_0161096 | Ga0501068_0161096_649_1287 | 212 |
| 383 | 3300049589 | Ga0501073_0159844 | Ga0501073_0159844_116_763 | 212 |
| 384 | 3300049590 | Ga0501074_0150345 | Ga0501074_0150345_763_1410 | 212 |
| 385 | 3300050489 | nmdc:mga03683_17419_c1 | nmdc:mga03683_17419_c1_513_1151 | 212 |
| 386 | 3300050491 | nmdc:mga00v17_187261_c1 | nmdc:mga00v17_187261_c1_473_1126 | 212 |
| 387 | 3300050492 | nmdc:mga0yw44_53460_c1 | nmdc:mga0yw44_53460_c1_874_1518 | 212 |
| 388 | 3300050493 | nmdc:mga0k408_95_c1 | nmdc:mga0k408_95_c1_27565_28218 | 212 |
| 389 | 3300050493 | nmdc:mga0k408_9620_c1 | nmdc:mga0k408_9620_c1_3960_4598 | 212 |
| 390 | 3300050496 | nmdc:mga07m45_257421_c1 | nmdc:mga07m45_257421_c1_94_756 | 212 |
| 391 | 3300050496 | nmdc:mga07m45_90951_c1 | nmdc:mga07m45_90951_c1_717_1370 | 212 |
| 392 | 3300050510 | nmdc:mga06r32_144358_c1 | nmdc:mga06r32_144358_c1_1189_1878 | 212 |
| 393 | 3300050510 | nmdc:mga06r32_200234_c1 | nmdc:mga06r32_200234_c1_1107_1766 | 212 |
| 394 | 3300050510 | nmdc:mga06r32_514928_c1 | nmdc:mga06r32_514928_c1_440_1120 | 212 |
| 395 | 3300050511 | nmdc:mga08y16_540482_c1 | nmdc:mga08y16_540482_c1_338_1120 | 212 |
| 396 | 3300050513 | nmdc:mga0rr50_455039_c1 | nmdc:mga0rr50_455039_c1_56_709 | 212 |
| 397 | 3300053085 | Ga0495619_0041936 | Ga0495619_0041936_282_962 | 212 |
| 398 | 3300053087 | Ga0500643_000165 | Ga0500643_000165_64698_65354 | 212 |
| 399 | 3300053103 | Ga0500555_000227 | Ga0500555_000227_832_1488 | 212 |
| 400 | 3300053118 | Ga0500594_0023143 | Ga0500594_0023143_722_1375 | 212 |
| 401 | 3300053120 | Ga0500597_100909 | Ga0500597_100909_345_998 | 212 |
| 402 | 3300053122 | Ga0500608_001747 | Ga0500608_001747_5305_5958 | 212 |
| 403 | 3300053154 | Ga0500619_000064 | Ga0500619_000064_8387_9028 | 212 |
| 404 | 3300053156 | Ga0500622_0000228 | Ga0500622_0000228_21788_22444 | 212 |
| 405 | 3300053730 | Ga0500645_000646 | Ga0500645_000646_15820_16476 | 212 |
| 406 | 3300002067 | JGI24735J21928_10042435 | JGI24735J21928_100424351 | 213 |
| 407 | 3300044842 | Ga0466957_0128968 | Ga0466957_0128968_280_924 | 213 |
| 408 | 3300045049 | Ga0466959_0404095 | Ga0466959_0404095_166_834 | 213 |
| 409 | 3300045976 | Ga0466967_0209794 | Ga0466967_0209794_637_1281 | 213 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ycd-assembly1.cif.gz_A-2 | structure of a novel glutathione transferase from agrobacterium tumefaciens. | 0.9815 | 2 | 212 |
| 3lq7-assembly2.cif.gz_C-2 | crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 | 0.9769 | 2 | 208 |
| 3lq7-assembly1.cif.gz_A | crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 | 0.9749 | 1 | 210 |
| 3lq7-assembly1.cif.gz_B | crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 | 0.9712 | 1 | 211 |
| 3lq7-assembly1.cif.gz_A | crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 | 0.9559 | 1 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ycdA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9942 | 2 | 87 | 3.40.30.10 |
| 2ycdA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9828 | 2 | 87 | 3.40.30.10 |
| 3lq7A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9803 | 2 | 87 | 3.40.30.10 |
| 3lq7A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9675 | 2 | 87 | 3.40.30.10 |
| 3lq7C02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9631 | 88 | 203 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527A1T9-F1-model_v4 | Glutathione S-transferase | 1.002 | 1 | 78 |
GO:0016740
|
| AF-A0A529NGU8-F1-model_v4 | Glutathione S-transferase | 0.9983 | 1 | 108 |
GO:0016740
|
| AF-A0A086P651-F1-model_v4 | Glutathione S-transferase | 0.9971 | 1 | 109 |
GO:0016740
|
| AF-A0A4R2I9L5-F1-model_v4 | Glutathione S-transferase | 0.9937 | 1 | 210 |
GO:0016740
|
| AF-A0A5C5CUV7-F1-model_v4 | Glutathione S-transferase (EC 2.5.1.18) | 0.9921 | 2 | 210 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar