F436954

General Info

Members Datasets Scaffolds Average Seq Length
409 274 384 217

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10218744|Ga0075367_102187442
Length 226
Sequence MTITITAFERSPDGGKGLARDTRVRWALEEVGQPYEVRLVTFRAMKEPAHLALHPFGQIPTYEEGGLALFETGSIVFHIAERHAGLLPPNSDDPHSDSGADARARAITWMFAALNTVEPPILELATAKIQEGDKPWTKERLPLVEDRIRNRLASLSEHLGSADWLDGGFSAGDLMMVSVLLRLKPSGILDEYPNLAAYLARGEARPAYIRAFEAQLAVNAGKPPSS

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
3 2643221658 Variovorax sp. Root411 Isolate Unclassified
4 2718217927 Rhizobium sp. N324 Isolate Nodule
5 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
6 2718218423 Rhizobium sp. N941 Isolate Nodule
7 2721755809 Rhizobium sp. N541 Isolate Nodule
8 2734482264 Dyella sp. AD052 Isolate Unclassified
9 2738543009 Luteibacter sp. OK325 Isolate Unclassified
10 2791355256 Rhizobium sp. M10 Isolate Nodule
11 2791355262 Rhizobium sp. M1 Isolate Nodule
12 2791355267 Rhizobium sp. L18 Isolate Nodule
13 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
14 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
15 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
16 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
17 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
18 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
19 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
20 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
21 2919404418 Luteibacter sp. 3190 Isolate Unclassified
22 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
25 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
178 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
179 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
182 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
263 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
264 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
265 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
266 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
267 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
272 8005275841 Rhizobium sp. N4311 Isolate Nodule
273 8018176218 Rhizobium sp. N122 Isolate Nodule
274 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.64
Metatranscriptomes 0.24
Isolates 6.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.82
Nodule 3.91
Rhizoplane 2.69
Rhizosphere 80.44
Stem 0
Stem Tuber 0
Unclassified 5.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10042435 3300002067 Bacteria 1324
2 JGI24033J26618_1010981 3300002155 Bacteria 1074
3 Ga0006562J51391_1047541 3300003578 Bacteria 2330
4 Ga0055528_1005915 3300003790 Bacteria 5610
5 Ga0055540_1000251 3300003792 Bacteria 48933
6 Ga0065714_10002968 3300005288 Bacteria 9262
7 Ga0065712_10118861 3300005290 Bacteria 1700
8 Ga0065715_10002429 3300005293 Bacteria 7249
9 Ga0070658_10105602 3300005327 Bacteria 2330
10 Ga0070683_100002110 3300005329 Bacteria 15702
11 Ga0070683_100235608 3300005329 Bacteria 1740
12 Ga0070690_100064984 3300005330 Bacteria 2358
13 Ga0070670_100014510 3300005331 Bacteria 6763
14 Ga0070670_100057447 3300005331 Bacteria 3340
15 Ga0070670_100079005 3300005331 Bacteria 2827
16 Ga0070670_100190528 3300005331 Bacteria 1781
17 Ga0070670_100276706 3300005331 Bacteria 1465
18 Ga0068869_100024175 3300005334 Bacteria 4207
19 Ga0070680_100662962 3300005336 Bacteria 897
20 Ga0070682_100001349 3300005337 Bacteria 13850
21 Ga0068868_100056925 3300005338 Bacteria 3088
22 Ga0070660_100018261 3300005339 Bacteria 5123
23 Ga0070660_100036670 3300005339 Bacteria 3715
24 Ga0070660_100210988 3300005339 Bacteria 1577
25 Ga0070689_100000018 3300005340 Bacteria 153256
26 Ga0070689_100123818 3300005340 Bacteria 2067
27 Ga0070661_100006111 3300005344 Bacteria 8293
28 Ga0070661_100021529 3300005344 Bacteria 4607
29 Ga0070661_100022569 3300005344 Bacteria 4507
30 Ga0070661_100156381 3300005344 Bacteria 1725
31 Ga0070661_100313325 3300005344 Bacteria 1224
32 Ga0070692_10124064 3300005345 Bacteria 1444
33 Ga0070675_100765477 3300005354 Bacteria 881
34 Ga0070671_100012577 3300005355 Bacteria 6817
35 Ga0070674_100641968 3300005356 Bacteria 901
36 Ga0070673_100790782 3300005364 Bacteria 875
37 Ga0070688_100049261 3300005365 Bacteria 2621
38 Ga0070659_100000593 3300005366 Bacteria 26524
39 Ga0070659_100003492 3300005366 Bacteria 11188
40 Ga0070659_100034731 3300005366 Bacteria 3923
41 Ga0070659_100089522 3300005366 Bacteria 2465
42 Ga0070667_100120594 3300005367 Bacteria 2281
43 Ga0070701_10017600 3300005438 Bacteria 3342
44 Ga0070663_100027175 3300005455 Bacteria 3882
45 Ga0070663_100049845 3300005455 Bacteria 2976
46 Ga0070681_10003684 3300005458 Bacteria 14374
47 Ga0068867_100234028 3300005459 Bacteria 1486
48 Ga0070685_10014535 3300005466 Bacteria 4172
49 Ga0070684_100118732 3300005535 Bacteria 2377
50 Ga0070684_100396897 3300005535 Bacteria 1271
51 Ga0068853_100005463 3300005539 Bacteria 9959
52 Ga0068853_100006379 3300005539 Bacteria 9369
53 Ga0070686_100006255 3300005544 Bacteria 6613
54 Ga0070693_100000961 3300005547 Bacteria 12781
55 Ga0070665_100022090 3300005548 Bacteria 6401
56 Ga0070665_100074178 3300005548 Bacteria 3408
57 Ga0070665_100088220 3300005548 Bacteria 3108
58 Ga0070665_100534032 3300005548 Bacteria 1185
59 Ga0068855_100047177 3300005563 Bacteria 5090
60 Ga0070664_100025348 3300005564 Bacteria 4914
61 Ga0070664_100224288 3300005564 Bacteria 1682
62 Ga0070664_100282346 3300005564 Bacteria 1497
63 Ga0068857_100049201 3300005577 Bacteria 3740
64 Ga0068854_100109393 3300005578 Bacteria 2082
65 Ga0068856_100234626 3300005614 Bacteria 1850
66 Ga0068852_100494235 3300005616 Bacteria 1217
67 Ga0068864_100026854 3300005618 Bacteria 4856
68 Ga0068851_10003898 3300005834 Bacteria 6680
69 Ga0068870_10001520 3300005840 Bacteria 9411
70 Ga0068870_10246402 3300005840 Bacteria 1106
71 Ga0068863_100000020 3300005841 Bacteria 198519
72 Ga0068863_100023840 3300005841 Bacteria 5840
73 Ga0068858_100032382 3300005842 Bacteria 4855
74 Ga0068858_100237222 3300005842 Bacteria 1729
75 Ga0068862_100062221 3300005844 Bacteria 3210
76 Ga0068862_100078298 3300005844 Bacteria 2864
77 Ga0081455_10000940 3300005937 Bacteria 37224
78 Ga0081540_1008611 3300005983 Bacteria 7110
79 Ga0075365_10103043 3300006038 Bacteria 1956
80 Ga0075363_100068318 3300006048 Bacteria 1927
81 Ga0075364_10216827 3300006051 Bacteria 1298
82 Ga0075367_10087375 3300006178 Bacteria 1893
83 Ga0075367_10107815 3300006178 Bacteria 1707
84 Ga0075367_10218744 3300006178 Bacteria 1192
85 Ga0075369_10175309 3300006186 Bacteria 986
86 Ga0075366_10004948 3300006195 Bacteria 7189
87 Ga0075370_10036323 3300006353 Bacteria 2767
88 Ga0075370_10212668 3300006353 Bacteria 1142
89 Ga0075428_100935933 3300006844 Bacteria 918
90 Ga0075430_100002431 3300006846 Bacteria 15500
91 Ga0075431_100566389 3300006847 Bacteria 1122
92 Ga0075433_10046388 3300006852 Bacteria 3779
93 Ga0075429_100178243 3300006880 Bacteria 1862
94 Ga0068865_100022310 3300006881 Bacteria 4128
95 Ga0105244_10158819 3300009036 Bacteria 1080
96 Ga0105240_10704439 3300009093 Bacteria 1102
97 Ga0111539_10059772 3300009094 Bacteria 4519
98 Ga0111539_10383274 3300009094 Bacteria 1637
99 Ga0105243_10044486 3300009148 Bacteria 3483
100 Ga0105241_10064996 3300009174 Bacteria 2818
101 Ga0105242_10169262 3300009176 Bacteria 1919
102 Ga0105242_10375242 3300009176 Bacteria 1320
103 Ga0105242_10379540 3300009176 Bacteria 1313
104 Ga0105248_10007658 3300009177 Bacteria 11865
105 Ga0105237_10101398 3300009545 Bacteria 2871
106 Ga0105237_10841881 3300009545 Bacteria 924
107 Ga0105239_10010833 3300010375 Bacteria 10186
108 Ga0105239_10273340 3300010375 Bacteria 1901
109 Ga0105246_10123637 3300011119 Bacteria 1921
110 Ga0157370_10030116 3300013104 Bacteria 5320
111 Ga0157374_10160162 3300013296 Bacteria 2192
112 Ga0157374_10170344 3300013296 Bacteria 2124
113 Ga0163162_10364732 3300013306 Bacteria 1577
114 Ga0163162_10535671 3300013306 Bacteria 1300
115 Ga0157375_10193522 3300013308 Bacteria 2189
116 Ga0157375_11223629 3300013308 Bacteria 881
117 Ga0163163_10163284 3300014325 Bacteria 2273
118 Ga0157380_10001901 3300014326 Bacteria 13847
119 Ga0157380_10013862 3300014326 Bacteria 5887
120 Ga0182008_10015372 3300014497 Bacteria 3994
121 Ga0157377_10002075 3300014745 Bacteria 8800
122 Ga0157377_10375807 3300014745 Bacteria 961
123 Ga0157379_10116036 3300014968 Bacteria 2408
124 Ga0157376_10023986 3300014969 Bacteria 4784
125 Ga0157376_10308088 3300014969 Bacteria 1501
126 Ga0182006_1000181 3300015261 Bacteria 66126
127 Ga0182006_1000832 3300015261 Bacteria 20700
128 Ga0209673_1000974 3300025273 Bacteria 35340
129 Ga0207673_1016986 3300025290 Bacteria 969
130 Ga0209676_1022071 3300025292 Bacteria 2117
131 Ga0209051_1000127 3300025303 Bacteria 142254
132 Ga0209257_1003156 3300025304 Bacteria 14688
133 Ga0207697_10008216 3300025315 Bacteria 4586
134 Ga0207656_10011206 3300025321 Bacteria 3382
135 Ga0207710_10084062 3300025900 Bacteria 1481
136 Ga0207688_10020769 3300025901 Bacteria 3586
137 Ga0207647_10049374 3300025904 Bacteria 2610
138 Ga0207645_10008488 3300025907 Bacteria 7163
139 Ga0207643_10000393 3300025908 Bacteria 29099
140 Ga0207705_10015800 3300025909 Bacteria 5420
141 Ga0207654_10108750 3300025911 Bacteria 1721
142 Ga0207707_10005151 3300025912 Bacteria 11458
143 Ga0207671_10289405 3300025914 Bacteria 1293
144 Ga0207660_10497722 3300025917 Bacteria 989
145 Ga0207657_10027790 3300025919 Bacteria 5174
146 Ga0207657_10051122 3300025919 Bacteria 3593
147 Ga0207657_10108868 3300025919 Bacteria 2290
148 Ga0207649_10024237 3300025920 Bacteria 3525
149 Ga0207649_10026469 3300025920 Bacteria 3393
150 Ga0207649_10245222 3300025920 Bacteria 1288
151 Ga0207681_10588445 3300025923 Bacteria 918
152 Ga0207650_10018966 3300025925 Bacteria 4833
153 Ga0207650_10662293 3300025925 Bacteria 880
154 Ga0207659_10014895 3300025926 Bacteria 5027
155 Ga0207644_10000622 3300025931 Bacteria 22583
156 Ga0207644_10363906 3300025931 Bacteria 1177
157 Ga0207690_10001299 3300025932 Bacteria 15745
158 Ga0207690_10001599 3300025932 Bacteria 14135
159 Ga0207690_10041564 3300025932 Bacteria 3013
160 Ga0207706_10006641 3300025933 Bacteria 10703
161 Ga0207670_10000001 3300025936 Bacteria 949312
162 Ga0207670_10076065 3300025936 Bacteria 2335
163 Ga0207669_10023932 3300025937 Bacteria 3272
164 Ga0207669_10528445 3300025937 Bacteria 948
165 Ga0207711_10040633 3300025941 Bacteria 3957
166 Ga0207689_10007921 3300025942 Bacteria 9280
167 Ga0207689_10529960 3300025942 Bacteria 988
168 Ga0207661_10000484 3300025944 Bacteria 25619
169 Ga0207679_10000536 3300025945 Bacteria 25661
170 Ga0207679_10282811 3300025945 Bacteria 1423
171 Ga0207679_10461973 3300025945 Bacteria 1127
172 Ga0207667_10004555 3300025949 Bacteria 16990
173 Ga0207651_10075235 3300025960 Bacteria 2408
174 Ga0207668_10000039 3300025972 Bacteria 110049
175 Ga0207668_10635858 3300025972 Bacteria 933
176 Ga0207640_10226464 3300025981 Bacteria 1435
177 Ga0207703_10170788 3300026035 Bacteria 1912
178 Ga0207639_10012580 3300026041 Bacteria 5896
179 Ga0207639_10023413 3300026041 Bacteria 4460
180 Ga0207639_10822327 3300026041 Bacteria 866
181 Ga0207678_10020969 3300026067 Bacteria 5728
182 Ga0207678_10078227 3300026067 Bacteria 2832
183 Ga0207702_10506182 3300026078 Bacteria 1178
184 Ga0207641_10000001 3300026088 Bacteria 1180841
185 Ga0207641_10182406 3300026088 Bacteria 1923
186 Ga0207648_10022608 3300026089 Bacteria 5644
187 Ga0207676_10491728 3300026095 Bacteria 1163
188 Ga0207674_10119040 3300026116 Bacteria 2610
189 Ga0207675_100139728 3300026118 Bacteria 2300
190 Ga0207698_10070681 3300026142 Bacteria 2766
191 Ga0207698_10192970 3300026142 Bacteria 1816
192 Ga0207698_10746477 3300026142 Bacteria 977
193 Ga0268266_10073925 3300028379 Bacteria 2959
194 Ga0268266_10123888 3300028379 Bacteria 2303
195 Ga0268266_10215531 3300028379 Bacteria 1762
196 Ga0268266_10413974 3300028379 Bacteria 1276
197 Ga0268266_10602656 3300028379 Bacteria 1055
198 Ga0268265_10561167 3300028380 Bacteria 1085
199 Ga0268264_10079904 3300028381 Bacteria 2791
200 Ga0265318_10000052 3300028577 Bacteria 116086
201 Ga0307515_10000428 3300028794 Bacteria 101247
202 Ga0307515_10003157 3300028794 Bacteria 34863
203 Ga0307513_10499487 3300031456 Bacteria 934
204 Ga0307509_10220932 3300031507 Bacteria 1708
205 Ga0307408_100030173 3300031548 Bacteria 3763
206 Ga0307408_100118639 3300031548 Bacteria 2046
207 Ga0307508_10161772 3300031616 Bacteria 1842
208 Ga0307514_10010623 3300031649 Bacteria 7695
209 Ga0307405_10359513 3300031731 Bacteria 1126
210 Ga0307406_10001365 3300031901 Bacteria 13654
211 Ga0307412_10403735 3300031911 Bacteria 1113
212 Ga0307416_101025985 3300032002 Bacteria 928
213 Ga0373928_0115101 3300035084 Bacteria 715
214 Ga0373951_0048701 3300035091 Bacteria 1038
215 Ga0373927_0278851 3300035695 Bacteria 1099
216 Ga0373937_0192213 3300036401 Bacteria 1918
217 Ga0373925_0031961 3300037068 Bacteria 3872
218 Ga0373925_0904630 3300037068 Bacteria 727
219 Ga0395900_0530936 3300037418 Bacteria 1123
220 Ga0395905_0088497 3300037471 Bacteria 2902
221 Ga0395901_0438175 3300038443 Bacteria 1338
222 Ga0436361_0083282 3300039447 Bacteria 2222
223 Ga0436362_0983151 3300039453 Bacteria 724
224 Ga0451789_1143600 3300041443 Bacteria 921
225 Ga0451793_1343240 3300041452 Bacteria 2710
226 Ga0451797_0019421 3300041453 Bacteria 2451
227 Ga0451807_1038351 3300041486 Bacteria 3555
228 Ga0451833_0194768 3300041491 Bacteria 1294
229 Ga0451841_0083979 3300041498 Bacteria 1581
230 Ga0439434_0078723 3300042435 Bacteria 1044
231 Ga0466972_0129375 3300044658 Bacteria 1189
232 Ga0466957_0128968 3300044842 Bacteria 1618
233 Ga0466960_0005779 3300044901 Bacteria 4925
234 Ga0466959_0404095 3300045049 Bacteria 928
235 Ga0466967_0062002 3300045976 Bacteria 3318
236 Ga0466967_0209794 3300045976 Bacteria 1847
237 Ga0495617_000038 3300046452 Bacteria 132535
238 Ga0495590_0174040 3300046457 Bacteria 785
239 Ga0495638_0000178 3300046460 Bacteria 98340
240 Ga0495638_0108609 3300046460 Bacteria 1650
241 Ga0495650_0013078 3300046471 Bacteria 4416
242 Ga0495605_0031994 3300046474 Bacteria 2682
243 Ga0495605_0054129 3300046474 Bacteria 1945
244 Ga0495605_0094146 3300046474 Bacteria 1384
245 Ga0495584_0004432 3300046491 Bacteria 7559
246 Ga0495584_0024379 3300046491 Bacteria 3068
247 Ga0495585_0000067 3300046492 Bacteria 107222
248 Ga0495585_0000147 3300046492 Bacteria 76686
249 Ga0495585_0001277 3300046492 Bacteria 20136
250 Ga0495585_0001346 3300046492 Bacteria 19500
251 Ga0495607_0000370 3300046501 Bacteria 46319
252 Ga0495607_0040055 3300046501 Bacteria 2792
253 Ga0495583_0052158 3300046506 Bacteria 1862
254 Ga0495606_0000166 3300046507 Bacteria 116524
255 Ga0495606_0000194 3300046507 Bacteria 106498
256 Ga0495606_0005493 3300046507 Bacteria 12130
257 Ga0495606_0129614 3300046507 Bacteria 1500
258 Ga0495606_0140600 3300046507 Bacteria 1426
259 Ga0495610_0012205 3300046512 Bacteria 5188
260 Ga0495610_0048203 3300046512 Bacteria 2092
261 Ga0495616_0000005 3300046513 Bacteria 260589
262 Ga0495616_0087297 3300046513 Bacteria 1482
263 Ga0495620_0000016 3300046515 Bacteria 153638
264 Ga0495620_0001881 3300046515 Bacteria 12348
265 Ga0495631_0000032 3300046518 Bacteria 85166
266 Ga0495631_0000040 3300046518 Bacteria 79773
267 Ga0495631_0002235 3300046518 Bacteria 11129
268 Ga0495631_0078369 3300046518 Bacteria 1426
269 Ga0495632_0007802 3300046519 Bacteria 6669
270 Ga0495632_0050820 3300046519 Bacteria 2042
271 Ga0495637_0009880 3300046520 Bacteria 4641
272 Ga0495643_0027059 3300046522 Bacteria 3228
273 Ga0495644_0211172 3300046523 Bacteria 749
274 Ga0495648_0000142 3300046524 Bacteria 85573
275 Ga0495648_0001532 3300046524 Bacteria 22598
276 Ga0495642_0011883 3300046528 Bacteria 3354
277 Ga0495642_0023051 3300046528 Bacteria 2456
278 Ga0495642_0124661 3300046528 Bacteria 1106
279 Ga0495609_0022162 3300046538 Bacteria 2927
280 Ga0495609_0025278 3300046538 Bacteria 2724
281 Ga0495621_0120579 3300046539 Bacteria 1013
282 Ga0495597_0000198 3300046542 Bacteria 55237
283 Ga0495597_0000774 3300046542 Bacteria 25307
284 Ga0495597_0086997 3300046542 Bacteria 1330
285 Ga0495633_0002418 3300046558 Bacteria 13198
286 Ga0495633_0162420 3300046558 Bacteria 1030
287 Ga0495668_0001933 3300046616 Bacteria 18432
288 Ga0495668_0002249 3300046616 Bacteria 16281
289 Ga0495668_0024727 3300046616 Bacteria 3416
290 Ga0495668_0177701 3300046616 Bacteria 1166
291 Ga0495611_0000002 3300046648 Bacteria 705677
292 Ga0495611_0000036 3300046648 Bacteria 102447
293 Ga0495611_0010576 3300046648 Bacteria 3903
294 Ga0495625_0000002 3300046660 Bacteria 813323
295 Ga0495625_0000056 3300046660 Bacteria 186024
296 Ga0495625_0003027 3300046660 Bacteria 17240
297 Ga0495625_0478836 3300046660 Bacteria 764
298 Ga0495661_0000462 3300046665 Bacteria 43107
299 Ga0495661_0000539 3300046665 Bacteria 39123
300 Ga0495661_0000679 3300046665 Bacteria 33935
301 Ga0495661_0052744 3300046665 Bacteria 2448
302 Ga0495670_0000301 3300046691 Bacteria 23331
303 Ga0495670_0005668 3300046691 Bacteria 6123
304 Ga0495670_0008472 3300046691 Bacteria 5057
305 Ga0495671_0000120 3300046692 Bacteria 71279
306 Ga0495671_0157908 3300046692 Bacteria 1103
307 Ga0495589_0000014 3300046794 Bacteria 246197
308 Ga0495589_0013983 3300046794 Bacteria 4138
309 Ga0495660_0000105 3300046810 Bacteria 90404
310 Ga0495660_0000138 3300046810 Bacteria 79645
311 Ga0495672_0002970 3300047320 Bacteria 14923
312 Ga0495672_0073151 3300047320 Bacteria 1934
313 Ga0495683_0000439 3300047323 Bacteria 32988
314 Ga0495687_000310 3300047443 Bacteria 63709
315 Ga0495687_001079 3300047443 Bacteria 26839
316 Ga0495677_0001360 3300047445 Bacteria 9771
317 Ga0495679_000003 3300047446 Bacteria 787868
318 Ga0495679_074813 3300047446 Bacteria 970
319 Ga0495673_0000043 3300047469 Bacteria 284984
320 Ga0495673_0000291 3300047469 Bacteria 67241
321 Ga0495673_0000474 3300047469 Bacteria 43418
322 Ga0495673_0056553 3300047469 Bacteria 1697
323 Ga0495681_0006212 3300047470 Bacteria 7878
324 Ga0495681_0034722 3300047470 Bacteria 2510
325 Ga0495686_0000213 3300047472 Bacteria 107285
326 Ga0495686_0013136 3300047472 Bacteria 5762
327 Ga0495686_0061868 3300047472 Bacteria 2323
328 Ga0496100_0160019 3300048903 Bacteria 1613
329 Ga0496101_0032084 3300048904 Bacteria 3695
330 Ga0496101_0061284 3300048904 Bacteria 2732
331 Ga0496106_0015867 3300048909 Bacteria 5572
332 Ga0496106_0154488 3300048909 Bacteria 1811
333 Ga0496114_0101093 3300048917 Bacteria 2461
334 Ga0496115_0125880 3300048918 Bacteria 2111
335 Ga0496121_0000184 3300048924 Bacteria 138791
336 Ga0496121_0000609 3300048924 Bacteria 67016
337 Ga0496121_0006326 3300048924 Bacteria 14767
338 Ga0496121_0058914 3300048924 Bacteria 3170
339 Ga0496121_0144078 3300048924 Bacteria 1763
340 Ga0496121_0444972 3300048924 Bacteria 836
341 Ga0496124_0201500 3300048927 Bacteria 1513
342 Ga0495678_001321 3300049459 Bacteria 19875
343 Ga0501031_0590587 3300049568 Bacteria 715
344 Ga0501034_0059114 3300049571 Bacteria 3851
345 Ga0501036_0086814 3300049572 Bacteria 2644
346 Ga0501037_0137437 3300049573 Bacteria 1750
347 Ga0501038_0252002 3300049574 Bacteria 1398
348 Ga0501039_0131544 3300049575 Bacteria 1964
349 Ga0501043_0066159 3300049579 Bacteria 2838
350 Ga0501046_0027563 3300049580 Bacteria 4634
351 Ga0501046_0257285 3300049580 Bacteria 1283
352 Ga0501047_0117468 3300049581 Bacteria 2541
353 Ga0501047_0801359 3300049581 Bacteria 757
354 Ga0501047_0849468 3300049581 Bacteria 727
355 Ga0501048_0054953 3300049582 Bacteria 2828
356 Ga0501068_0161096 3300049584 Bacteria 1414
357 Ga0501072_0005226 3300049588 Bacteria 9881
358 Ga0501073_0159844 3300049589 Bacteria 1561
359 Ga0501074_0150345 3300049590 Bacteria 1665
360 Ga0501083_0267286 3300049744 Bacteria 1112
361 Ga0501035_0423152 3300049822 Bacteria 1105
362 nmdc:mga03683_17419_c1 3300050489 Bacteria 2719
363 nmdc:mga00v17_187261_c1 3300050491 Bacteria 1336
364 nmdc:mga0yw44_53460_c1 3300050492 Bacteria 2453
365 nmdc:mga0k408_95_c1 3300050493 Bacteria 37179
366 nmdc:mga0k408_9620_c1 3300050493 Bacteria 5216
367 nmdc:mga07m45_257421_c1 3300050496 Bacteria 1015
368 nmdc:mga07m45_90951_c1 3300050496 Bacteria 1748
369 nmdc:mga06r32_144358_c1 3300050510 Bacteria 2357
370 nmdc:mga06r32_200234_c1 3300050510 Bacteria 1985
371 nmdc:mga06r32_514928_c1 3300050510 Bacteria 1172
372 nmdc:mga08y16_540482_c1 3300050511 Bacteria 1180
373 nmdc:mga0rr50_455039_c1 3300050513 Bacteria 1085
374 Ga0495619_0041936 3300053085 Bacteria 2995
375 Ga0500643_000165 3300053087 Bacteria 66133
376 Ga0500555_000227 3300053103 Bacteria 25228
377 Ga0500594_0023143 3300053118 Bacteria 1572
378 Ga0500597_100909 3300053120 Bacteria 1255
379 Ga0500608_001747 3300053122 Bacteria 7762
380 Ga0500619_000064 3300053154 Bacteria 32285
381 Ga0500622_0000228 3300053156 Bacteria 58436
382 Ga0500633_0002549 3300053160 Bacteria 3778
383 Ga0500645_000646 3300053730 Bacteria 22127
384 Ga0466962_0025890 3300061719 Bacteria 2816

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0129375 Ga0466972_0129375_16_570 180
2 3300049568 Ga0501031_0590587 Ga0501031_0590587_94_687 184
3 3300039453 Ga0436362_0983151 Ga0436362_0983151_10_594 191
4 3300046539 Ga0495621_0120579 Ga0495621_0120579_408_998 191
5 3300037068 Ga0373925_0904630 Ga0373925_0904630_51_707 196
6 3300009094 Ga0111539_10059772 Ga0111539_100597725 197
7 3300046528 Ga0495642_0011883 Ga0495642_0011883_1838_2488 198
8 3300049573 Ga0501037_0137437 Ga0501037_0137437_318_956 199
9 3300049574 Ga0501038_0252002 Ga0501038_0252002_17_655 199
10 3300049580 Ga0501046_0027563 Ga0501046_0027563_1022_1660 199
11 3300049822 Ga0501035_0423152 Ga0501035_0423152_118_756 199
12 3300046506 Ga0495583_0052158 Ga0495583_0052158_552_1199 203
13 3300028577 Ga0265318_10000052 Ga0265318_1000005292 206
14 3300061719 Ga0466962_0025890 Ga0466962_0025890_32_700 208
15 iso_pu_bacteria 2509276021 2509387987 208
16 iso_pu_bacteria 2510917030 2511196660 208
17 iso_pu_bacteria 2643221658 2644325352 208
18 iso_pu_bacteria 2718217927 2719384599 208
19 iso_pu_bacteria 2718218334 2721029390 208
20 iso_pu_bacteria 2718218423 2721398309 208
21 iso_pu_bacteria 2721755809 2724037122 208
22 iso_pu_bacteria 2734482264 2735834994 208
23 iso_pu_bacteria 2738543009 2739227862 208
24 iso_pu_bacteria 2791355256 2793299663 208
25 iso_pu_bacteria 2791355262 2793332700 208
26 iso_pu_bacteria 2791355267 2793368190 208
27 iso_pu_bacteria 2824773399 2824780504 208
28 iso_pu_bacteria 2841864319 2841870565 208
29 iso_pu_bacteria 2842205361 2842206673 208
30 iso_pu_bacteria 2842278818 2842280634 208
31 iso_pu_bacteria 2842341865 2842348552 208
32 iso_pu_bacteria 2844002411 2844007778 208
33 iso_pu_bacteria 2881147464 2881154210 208
34 iso_pu_bacteria 2919100787 2919107226 208
35 iso_pu_bacteria 2919404418 2919407982 208
36 iso_pu_bacteria 2945945610 2945950532 208
37 iso_pu_bacteria 8005275841 8005279314 208
38 iso_pu_bacteria 8018176218 8018178176 208
39 iso_pu_bacteria 8056375014 8056379298 208
40 3300005367 Ga0070667_100120594 Ga0070667_1001205945 210
41 3300005548 Ga0070665_100088220 Ga0070665_1000882202 210
42 3300009177 Ga0105248_10007658 Ga0105248_1000765814 210
43 3300014969 Ga0157376_10023986 Ga0157376_100239864 210
44 3300028379 Ga0268266_10073925 Ga0268266_100739257 210
45 3300037068 Ga0373925_0031961 Ga0373925_0031961_2883_3527 210
46 3300005547 Ga0070693_100000961 Ga0070693_1000009612 211
47 3300036401 Ga0373937_0192213 Ga0373937_0192213_1042_1692 211
48 3300046460 Ga0495638_0108609 Ga0495638_0108609_131_784 211
49 3300046471 Ga0495650_0013078 Ga0495650_0013078_1346_1999 211
50 3300046474 Ga0495605_0054129 Ga0495605_0054129_66_719 211
51 3300046491 Ga0495584_0024379 Ga0495584_0024379_1895_2548 211
52 3300046492 Ga0495585_0001346 Ga0495585_0001346_3385_4038 211
53 3300046507 Ga0495606_0000166 Ga0495606_0000166_36857_37510 211
54 3300046507 Ga0495606_0129614 Ga0495606_0129614_188_841 211
55 3300046512 Ga0495610_0012205 Ga0495610_0012205_3687_4340 211
56 3300046513 Ga0495616_0000005 Ga0495616_0000005_220224_220877 211
57 3300046513 Ga0495616_0087297 Ga0495616_0087297_696_1358 211
58 3300046515 Ga0495620_0001881 Ga0495620_0001881_9142_9780 211
59 3300046518 Ga0495631_0000032 Ga0495631_0000032_25714_26367 211
60 3300046519 Ga0495632_0007802 Ga0495632_0007802_5785_6438 211
61 3300046519 Ga0495632_0050820 Ga0495632_0050820_1361_2014 211
62 3300046524 Ga0495648_0001532 Ga0495648_0001532_2492_3145 211
63 3300046648 Ga0495611_0000036 Ga0495611_0000036_59812_60465 211
64 3300046660 Ga0495625_0478836 Ga0495625_0478836_24_677 211
65 3300046691 Ga0495670_0005668 Ga0495670_0005668_2184_2837 211
66 3300047323 Ga0495683_0000439 Ga0495683_0000439_14647_15300 211
67 3300047469 Ga0495673_0000291 Ga0495673_0000291_10109_10762 211
68 3300047469 Ga0495673_0056553 Ga0495673_0056553_405_1058 211
69 3300047472 Ga0495686_0061868 Ga0495686_0061868_1039_1692 211
70 3300048924 Ga0496121_0000184 Ga0496121_0000184_82873_83526 211
71 3300049588 Ga0501072_0005226 Ga0501072_0005226_8460_9095 211
72 3300049744 Ga0501083_0267286 Ga0501083_0267286_254_889 211
73 3300053160 Ga0500633_0002549 Ga0500633_0002549_2985_3638 211
74 3300002155 JGI24033J26618_1010981 JGI24033J26618_10109811 212
75 3300003578 Ga0006562J51391_1047541 Ga0006562J51391_10475413 212
76 3300003790 Ga0055528_1005915 Ga0055528_10059156 212
77 3300003792 Ga0055540_1000251 Ga0055540_100025116 212
78 3300005288 Ga0065714_10002968 Ga0065714_100029689 212
79 3300005290 Ga0065712_10118861 Ga0065712_101188612 212
80 3300005293 Ga0065715_10002429 Ga0065715_100024295 212
81 3300005327 Ga0070658_10105602 Ga0070658_101056022 212
82 3300005329 Ga0070683_100002110 Ga0070683_1000021109 212
83 3300005329 Ga0070683_100235608 Ga0070683_1002356082 212
84 3300005330 Ga0070690_100064984 Ga0070690_1000649842 212
85 3300005331 Ga0070670_100014510 Ga0070670_1000145105 212
86 3300005331 Ga0070670_100057447 Ga0070670_1000574472 212
87 3300005331 Ga0070670_100079005 Ga0070670_1000790054 212
88 3300005331 Ga0070670_100190528 Ga0070670_1001905282 212
89 3300005331 Ga0070670_100276706 Ga0070670_1002767062 212
90 3300005334 Ga0068869_100024175 Ga0068869_1000241752 212
91 3300005336 Ga0070680_100662962 Ga0070680_1006629621 212
92 3300005337 Ga0070682_100001349 Ga0070682_10000134914 212
93 3300005338 Ga0068868_100056925 Ga0068868_1000569252 212
94 3300005339 Ga0070660_100018261 Ga0070660_1000182615 212
95 3300005339 Ga0070660_100036670 Ga0070660_1000366703 212
96 3300005339 Ga0070660_100210988 Ga0070660_1002109882 212
97 3300005340 Ga0070689_100000018 Ga0070689_100000018109 212
98 3300005340 Ga0070689_100123818 Ga0070689_1001238182 212
99 3300005344 Ga0070661_100006111 Ga0070661_1000061112 212
100 3300005344 Ga0070661_100021529 Ga0070661_1000215294 212
101 3300005344 Ga0070661_100022569 Ga0070661_1000225694 212
102 3300005344 Ga0070661_100156381 Ga0070661_1001563812 212
103 3300005344 Ga0070661_100313325 Ga0070661_1003133252 212
104 3300005345 Ga0070692_10124064 Ga0070692_101240642 212
105 3300005354 Ga0070675_100765477 Ga0070675_1007654771 212
106 3300005355 Ga0070671_100012577 Ga0070671_1000125774 212
107 3300005356 Ga0070674_100641968 Ga0070674_1006419682 212
108 3300005364 Ga0070673_100790782 Ga0070673_1007907821 212
109 3300005365 Ga0070688_100049261 Ga0070688_1000492612 212
110 3300005366 Ga0070659_100000593 Ga0070659_10000059318 212
111 3300005366 Ga0070659_100003492 Ga0070659_1000034928 212
112 3300005366 Ga0070659_100034731 Ga0070659_1000347312 212
113 3300005366 Ga0070659_100089522 Ga0070659_1000895223 212
114 3300005438 Ga0070701_10017600 Ga0070701_100176002 212
115 3300005455 Ga0070663_100027175 Ga0070663_1000271754 212
116 3300005455 Ga0070663_100049845 Ga0070663_1000498453 212
117 3300005458 Ga0070681_10003684 Ga0070681_1000368419 212
118 3300005459 Ga0068867_100234028 Ga0068867_1002340282 212
119 3300005466 Ga0070685_10014535 Ga0070685_100145352 212
120 3300005535 Ga0070684_100118732 Ga0070684_1001187322 212
121 3300005535 Ga0070684_100396897 Ga0070684_1003968972 212
122 3300005539 Ga0068853_100005463 Ga0068853_1000054637 212
123 3300005539 Ga0068853_100006379 Ga0068853_1000063798 212
124 3300005544 Ga0070686_100006255 Ga0070686_1000062552 212
125 3300005548 Ga0070665_100022090 Ga0070665_1000220906 212
126 3300005548 Ga0070665_100074178 Ga0070665_1000741782 212
127 3300005548 Ga0070665_100534032 Ga0070665_1005340322 212
128 3300005563 Ga0068855_100047177 Ga0068855_1000471774 212
129 3300005564 Ga0070664_100025348 Ga0070664_1000253483 212
130 3300005564 Ga0070664_100224288 Ga0070664_1002242882 212
131 3300005564 Ga0070664_100282346 Ga0070664_1002823462 212
132 3300005577 Ga0068857_100049201 Ga0068857_1000492013 212
133 3300005578 Ga0068854_100109393 Ga0068854_1001093931 212
134 3300005614 Ga0068856_100234626 Ga0068856_1002346262 212
135 3300005616 Ga0068852_100494235 Ga0068852_1004942352 212
136 3300005618 Ga0068864_100026854 Ga0068864_1000268544 212
137 3300005834 Ga0068851_10003898 Ga0068851_100038985 212
138 3300005840 Ga0068870_10001520 Ga0068870_100015205 212
139 3300005840 Ga0068870_10246402 Ga0068870_102464022 212
140 3300005841 Ga0068863_100000020 Ga0068863_100000020209 212
141 3300005841 Ga0068863_100023840 Ga0068863_1000238402 212
142 3300005842 Ga0068858_100032382 Ga0068858_1000323824 212
143 3300005842 Ga0068858_100237222 Ga0068858_1002372222 212
144 3300005844 Ga0068862_100062221 Ga0068862_1000622213 212
145 3300005844 Ga0068862_100078298 Ga0068862_1000782982 212
146 3300005937 Ga0081455_10000940 Ga0081455_1000094021 212
147 3300005983 Ga0081540_1008611 Ga0081540_10086117 212
148 3300006038 Ga0075365_10103043 Ga0075365_101030433 212
149 3300006048 Ga0075363_100068318 Ga0075363_1000683183 212
150 3300006051 Ga0075364_10216827 Ga0075364_102168271 212
151 3300006178 Ga0075367_10087375 Ga0075367_100873753 212
152 3300006178 Ga0075367_10107815 Ga0075367_101078152 212
153 3300006178 Ga0075367_10218744 Ga0075367_102187442 212
154 3300006186 Ga0075369_10175309 Ga0075369_101753091 212
155 3300006195 Ga0075366_10004948 Ga0075366_100049482 212
156 3300006353 Ga0075370_10036323 Ga0075370_100363232 212
157 3300006353 Ga0075370_10212668 Ga0075370_102126682 212
158 3300006844 Ga0075428_100935933 Ga0075428_1009359332 212
159 3300006846 Ga0075430_100002431 Ga0075430_10000243112 212
160 3300006847 Ga0075431_100566389 Ga0075431_1005663892 212
161 3300006852 Ga0075433_10046388 Ga0075433_100463881 212
162 3300006880 Ga0075429_100178243 Ga0075429_1001782433 212
163 3300006881 Ga0068865_100022310 Ga0068865_1000223102 212
164 3300009036 Ga0105244_10158819 Ga0105244_101588192 212
165 3300009093 Ga0105240_10704439 Ga0105240_107044391 212
166 3300009094 Ga0111539_10383274 Ga0111539_103832742 212
167 3300009148 Ga0105243_10044486 Ga0105243_100444862 212
168 3300009174 Ga0105241_10064996 Ga0105241_100649963 212
169 3300009176 Ga0105242_10169262 Ga0105242_101692622 212
170 3300009176 Ga0105242_10375242 Ga0105242_103752422 212
171 3300009176 Ga0105242_10379540 Ga0105242_103795402 212
172 3300009545 Ga0105237_10101398 Ga0105237_101013983 212
173 3300009545 Ga0105237_10841881 Ga0105237_108418811 212
174 3300010375 Ga0105239_10010833 Ga0105239_100108336 212
175 3300010375 Ga0105239_10273340 Ga0105239_102733403 212
176 3300011119 Ga0105246_10123637 Ga0105246_101236372 212
177 3300013104 Ga0157370_10030116 Ga0157370_100301165 212
178 3300013296 Ga0157374_10160162 Ga0157374_101601622 212
179 3300013296 Ga0157374_10170344 Ga0157374_101703442 212
180 3300013306 Ga0163162_10364732 Ga0163162_103647322 212
181 3300013306 Ga0163162_10535671 Ga0163162_105356713 212
182 3300013308 Ga0157375_10193522 Ga0157375_101935222 212
183 3300013308 Ga0157375_11223629 Ga0157375_112236292 212
184 3300014325 Ga0163163_10163284 Ga0163163_101632842 212
185 3300014326 Ga0157380_10001901 Ga0157380_1000190112 212
186 3300014326 Ga0157380_10013862 Ga0157380_100138622 212
187 3300014497 Ga0182008_10015372 Ga0182008_100153724 212
188 3300014745 Ga0157377_10002075 Ga0157377_100020754 212
189 3300014745 Ga0157377_10375807 Ga0157377_103758071 212
190 3300014968 Ga0157379_10116036 Ga0157379_101160362 212
191 3300014969 Ga0157376_10308088 Ga0157376_103080882 212
192 3300015261 Ga0182006_1000181 Ga0182006_100018155 212
193 3300015261 Ga0182006_1000832 Ga0182006_100083217 212
194 3300025273 Ga0209673_1000974 Ga0209673_100097413 212
195 3300025290 Ga0207673_1016986 Ga0207673_10169861 212
196 3300025292 Ga0209676_1022071 Ga0209676_10220712 212
197 3300025303 Ga0209051_1000127 Ga0209051_1000127144 212
198 3300025304 Ga0209257_1003156 Ga0209257_10031563 212
199 3300025315 Ga0207697_10008216 Ga0207697_100082161 212
200 3300025321 Ga0207656_10011206 Ga0207656_100112062 212
201 3300025900 Ga0207710_10084062 Ga0207710_100840622 212
202 3300025901 Ga0207688_10020769 Ga0207688_100207692 212
203 3300025904 Ga0207647_10049374 Ga0207647_100493742 212
204 3300025907 Ga0207645_10008488 Ga0207645_100084884 212
205 3300025908 Ga0207643_10000393 Ga0207643_1000039314 212
206 3300025909 Ga0207705_10015800 Ga0207705_100158003 212
207 3300025911 Ga0207654_10108750 Ga0207654_101087501 212
208 3300025912 Ga0207707_10005151 Ga0207707_1000515116 212
209 3300025914 Ga0207671_10289405 Ga0207671_102894051 212
210 3300025917 Ga0207660_10497722 Ga0207660_104977221 212
211 3300025919 Ga0207657_10027790 Ga0207657_100277905 212
212 3300025919 Ga0207657_10051122 Ga0207657_100511222 212
213 3300025919 Ga0207657_10108868 Ga0207657_101088682 212
214 3300025920 Ga0207649_10024237 Ga0207649_100242371 212
215 3300025920 Ga0207649_10026469 Ga0207649_100264693 212
216 3300025920 Ga0207649_10245222 Ga0207649_102452222 212
217 3300025923 Ga0207681_10588445 Ga0207681_105884451 212
218 3300025925 Ga0207650_10018966 Ga0207650_100189663 212
219 3300025925 Ga0207650_10662293 Ga0207650_106622932 212
220 3300025926 Ga0207659_10014895 Ga0207659_100148952 212
221 3300025931 Ga0207644_10000622 Ga0207644_1000062210 212
222 3300025931 Ga0207644_10363906 Ga0207644_103639063 212
223 3300025932 Ga0207690_10001299 Ga0207690_1000129911 212
224 3300025932 Ga0207690_10001599 Ga0207690_100015999 212
225 3300025932 Ga0207690_10041564 Ga0207690_100415644 212
226 3300025933 Ga0207706_10006641 Ga0207706_100066418 212
227 3300025936 Ga0207670_10000001 Ga0207670_10000001108 212
228 3300025936 Ga0207670_10076065 Ga0207670_100760651 212
229 3300025937 Ga0207669_10023932 Ga0207669_100239321 212
230 3300025937 Ga0207669_10528445 Ga0207669_105284452 212
231 3300025941 Ga0207711_10040633 Ga0207711_100406332 212
232 3300025942 Ga0207689_10007921 Ga0207689_100079216 212
233 3300025942 Ga0207689_10529960 Ga0207689_105299602 212
234 3300025944 Ga0207661_10000484 Ga0207661_1000048419 212
235 3300025945 Ga0207679_10000536 Ga0207679_100005363 212
236 3300025945 Ga0207679_10282811 Ga0207679_102828112 212
237 3300025945 Ga0207679_10461973 Ga0207679_104619731 212
238 3300025949 Ga0207667_10004555 Ga0207667_100045554 212
239 3300025960 Ga0207651_10075235 Ga0207651_100752352 212
240 3300025972 Ga0207668_10000039 Ga0207668_1000003990 212
241 3300025972 Ga0207668_10635858 Ga0207668_106358582 212
242 3300025981 Ga0207640_10226464 Ga0207640_102264641 212
243 3300026035 Ga0207703_10170788 Ga0207703_101707882 212
244 3300026041 Ga0207639_10012580 Ga0207639_100125807 212
245 3300026041 Ga0207639_10023413 Ga0207639_100234136 212
246 3300026041 Ga0207639_10822327 Ga0207639_108223272 212
247 3300026067 Ga0207678_10020969 Ga0207678_100209691 212
248 3300026067 Ga0207678_10078227 Ga0207678_100782273 212
249 3300026078 Ga0207702_10506182 Ga0207702_105061822 212
250 3300026088 Ga0207641_10000001 Ga0207641_100000011155 212
251 3300026088 Ga0207641_10182406 Ga0207641_101824062 212
252 3300026089 Ga0207648_10022608 Ga0207648_100226085 212
253 3300026095 Ga0207676_10491728 Ga0207676_104917281 212
254 3300026116 Ga0207674_10119040 Ga0207674_101190402 212
255 3300026118 Ga0207675_100139728 Ga0207675_1001397284 212
256 3300026142 Ga0207698_10070681 Ga0207698_100706814 212
257 3300026142 Ga0207698_10192970 Ga0207698_101929702 212
258 3300026142 Ga0207698_10746477 Ga0207698_107464772 212
259 3300028379 Ga0268266_10123888 Ga0268266_101238882 212
260 3300028379 Ga0268266_10215531 Ga0268266_102155312 212
261 3300028379 Ga0268266_10413974 Ga0268266_104139743 212
262 3300028379 Ga0268266_10602656 Ga0268266_106026562 212
263 3300028380 Ga0268265_10561167 Ga0268265_105611671 212
264 3300028381 Ga0268264_10079904 Ga0268264_100799044 212
265 3300028794 Ga0307515_10000428 Ga0307515_1000042870 212
266 3300028794 Ga0307515_10003157 Ga0307515_1000315717 212
267 3300031456 Ga0307513_10499487 Ga0307513_104994872 212
268 3300031507 Ga0307509_10220932 Ga0307509_102209322 212
269 3300031548 Ga0307408_100030173 Ga0307408_1000301735 212
270 3300031548 Ga0307408_100118639 Ga0307408_1001186392 212
271 3300031616 Ga0307508_10161772 Ga0307508_101617723 212
272 3300031649 Ga0307514_10010623 Ga0307514_100106235 212
273 3300031731 Ga0307405_10359513 Ga0307405_103595132 212
274 3300031901 Ga0307406_10001365 Ga0307406_100013655 212
275 3300031911 Ga0307412_10403735 Ga0307412_104037351 212
276 3300032002 Ga0307416_101025985 Ga0307416_1010259851 212
277 3300035084 Ga0373928_0115101 Ga0373928_0115101_47_700 212
278 3300035091 Ga0373951_0048701 Ga0373951_0048701_89_742 212
279 3300035695 Ga0373927_0278851 Ga0373927_0278851_191_844 212
280 3300037418 Ga0395900_0530936 Ga0395900_0530936_172_819 212
281 3300037471 Ga0395905_0088497 Ga0395905_0088497_321_968 212
282 3300038443 Ga0395901_0438175 Ga0395901_0438175_159_812 212
283 3300039447 Ga0436361_0083282 Ga0436361_0083282_1013_1663 212
284 3300041443 Ga0451789_1143600 Ga0451789_1143600_255_908 212
285 3300041452 Ga0451793_1343240 Ga0451793_1343240_1909_2583 212
286 3300041453 Ga0451797_0019421 Ga0451797_0019421_1038_1712 212
287 3300041486 Ga0451807_1038351 Ga0451807_1038351_416_1090 212
288 3300041491 Ga0451833_0194768 Ga0451833_0194768_340_981 212
289 3300041498 Ga0451841_0083979 Ga0451841_0083979_142_792 212
290 3300042435 Ga0439434_0078723 Ga0439434_0078723_14_667 212
291 3300044901 Ga0466960_0005779 Ga0466960_0005779_1771_2454 212
292 3300045976 Ga0466967_0062002 Ga0466967_0062002_317_961 212
293 3300046452 Ga0495617_000038 Ga0495617_000038_33633_34274 212
294 3300046457 Ga0495590_0174040 Ga0495590_0174040_29_685 212
295 3300046460 Ga0495638_0000178 Ga0495638_0000178_66146_66802 212
296 3300046474 Ga0495605_0031994 Ga0495605_0031994_1847_2494 212
297 3300046474 Ga0495605_0094146 Ga0495605_0094146_643_1299 212
298 3300046491 Ga0495584_0004432 Ga0495584_0004432_6277_6942 212
299 3300046492 Ga0495585_0000067 Ga0495585_0000067_42391_43047 212
300 3300046492 Ga0495585_0000147 Ga0495585_0000147_74321_74971 212
301 3300046492 Ga0495585_0001277 Ga0495585_0001277_16794_17459 212
302 3300046501 Ga0495607_0000370 Ga0495607_0000370_18785_19441 212
303 3300046501 Ga0495607_0040055 Ga0495607_0040055_189_836 212
304 3300046507 Ga0495606_0000194 Ga0495606_0000194_42093_42734 212
305 3300046507 Ga0495606_0005493 Ga0495606_0005493_5446_6096 212
306 3300046507 Ga0495606_0140600 Ga0495606_0140600_723_1376 212
307 3300046512 Ga0495610_0048203 Ga0495610_0048203_964_1620 212
308 3300046515 Ga0495620_0000016 Ga0495620_0000016_53186_53827 212
309 3300046518 Ga0495631_0000040 Ga0495631_0000040_13868_14524 212
310 3300046518 Ga0495631_0002235 Ga0495631_0002235_7875_8540 212
311 3300046518 Ga0495631_0078369 Ga0495631_0078369_752_1399 212
312 3300046520 Ga0495637_0009880 Ga0495637_0009880_830_1486 212
313 3300046522 Ga0495643_0027059 Ga0495643_0027059_2123_2779 212
314 3300046523 Ga0495644_0211172 Ga0495644_0211172_52_717 212
315 3300046524 Ga0495648_0000142 Ga0495648_0000142_2923_3579 212
316 3300046528 Ga0495642_0023051 Ga0495642_0023051_773_1429 212
317 3300046528 Ga0495642_0124661 Ga0495642_0124661_209_859 212
318 3300046538 Ga0495609_0022162 Ga0495609_0022162_1131_1787 212
319 3300046538 Ga0495609_0025278 Ga0495609_0025278_751_1398 212
320 3300046542 Ga0495597_0000198 Ga0495597_0000198_50114_50761 212
321 3300046542 Ga0495597_0000774 Ga0495597_0000774_16353_17009 212
322 3300046542 Ga0495597_0086997 Ga0495597_0086997_309_959 212
323 3300046558 Ga0495633_0002418 Ga0495633_0002418_1442_2107 212
324 3300046558 Ga0495633_0162420 Ga0495633_0162420_258_908 212
325 3300046616 Ga0495668_0001933 Ga0495668_0001933_6270_6926 212
326 3300046616 Ga0495668_0002249 Ga0495668_0002249_13958_14614 212
327 3300046616 Ga0495668_0024727 Ga0495668_0024727_2274_2924 212
328 3300046616 Ga0495668_0177701 Ga0495668_0177701_74_730 212
329 3300046648 Ga0495611_0000002 Ga0495611_0000002_731_1387 212
330 3300046648 Ga0495611_0010576 Ga0495611_0010576_1258_1923 212
331 3300046660 Ga0495625_0000002 Ga0495625_0000002_731_1387 212
332 3300046660 Ga0495625_0000056 Ga0495625_0000056_68089_68742 212
333 3300046660 Ga0495625_0003027 Ga0495625_0003027_1503_2144 212
334 3300046665 Ga0495661_0000462 Ga0495661_0000462_42272_42919 212
335 3300046665 Ga0495661_0000539 Ga0495661_0000539_14542_15207 212
336 3300046665 Ga0495661_0000679 Ga0495661_0000679_2358_3014 212
337 3300046665 Ga0495661_0052744 Ga0495661_0052744_94_744 212
338 3300046691 Ga0495670_0000301 Ga0495670_0000301_5802_6467 212
339 3300046691 Ga0495670_0008472 Ga0495670_0008472_1470_2126 212
340 3300046692 Ga0495671_0000120 Ga0495671_0000120_47546_48202 212
341 3300046692 Ga0495671_0157908 Ga0495671_0157908_361_1011 212
342 3300046794 Ga0495589_0000014 Ga0495589_0000014_731_1387 212
343 3300046794 Ga0495589_0013983 Ga0495589_0013983_254_910 212
344 3300046810 Ga0495660_0000105 Ga0495660_0000105_32078_32734 212
345 3300046810 Ga0495660_0000138 Ga0495660_0000138_42266_42922 212
346 3300047320 Ga0495672_0002970 Ga0495672_0002970_11929_12585 212
347 3300047320 Ga0495672_0073151 Ga0495672_0073151_341_979 212
348 3300047443 Ga0495687_000310 Ga0495687_000310_20035_20673 212
349 3300047443 Ga0495687_001079 Ga0495687_001079_23451_24089 212
350 3300047445 Ga0495677_0001360 Ga0495677_0001360_1439_2104 212
351 3300047446 Ga0495679_000003 Ga0495679_000003_786433_787089 212
352 3300047446 Ga0495679_074813 Ga0495679_074813_274_939 212
353 3300047469 Ga0495673_0000043 Ga0495673_0000043_241523_242179 212
354 3300047469 Ga0495673_0000474 Ga0495673_0000474_42032_42688 212
355 3300047470 Ga0495681_0006212 Ga0495681_0006212_6521_7186 212
356 3300047470 Ga0495681_0034722 Ga0495681_0034722_605_1261 212
357 3300047472 Ga0495686_0000213 Ga0495686_0000213_11643_12296 212
358 3300047472 Ga0495686_0013136 Ga0495686_0013136_189_830 212
359 3300048903 Ga0496100_0160019 Ga0496100_0160019_922_1566 212
360 3300048904 Ga0496101_0032084 Ga0496101_0032084_568_1221 212
361 3300048904 Ga0496101_0061284 Ga0496101_0061284_1509_2153 212
362 3300048909 Ga0496106_0015867 Ga0496106_0015867_2963_3619 212
363 3300048909 Ga0496106_0154488 Ga0496106_0154488_1003_1677 212
364 3300048917 Ga0496114_0101093 Ga0496114_0101093_34_816 212
365 3300048918 Ga0496115_0125880 Ga0496115_0125880_1325_1978 212
366 3300048924 Ga0496121_0000609 Ga0496121_0000609_51785_52441 212
367 3300048924 Ga0496121_0006326 Ga0496121_0006326_8864_9520 212
368 3300048924 Ga0496121_0058914 Ga0496121_0058914_68_709 212
369 3300048924 Ga0496121_0144078 Ga0496121_0144078_901_1557 212
370 3300048924 Ga0496121_0444972 Ga0496121_0444972_68_709 212
371 3300048927 Ga0496124_0201500 Ga0496124_0201500_252_908 212
372 3300049459 Ga0495678_001321 Ga0495678_001321_18489_19145 212
373 3300049571 Ga0501034_0059114 Ga0501034_0059114_3148_3798 212
374 3300049572 Ga0501036_0086814 Ga0501036_0086814_879_1526 212
375 3300049575 Ga0501039_0131544 Ga0501039_0131544_398_1045 212
376 3300049579 Ga0501043_0066159 Ga0501043_0066159_1652_2314 212
377 3300049580 Ga0501046_0257285 Ga0501046_0257285_109_756 212
378 3300049581 Ga0501047_0117468 Ga0501047_0117468_62_709 212
379 3300049581 Ga0501047_0801359 Ga0501047_0801359_14_670 212
380 3300049581 Ga0501047_0849468 Ga0501047_0849468_16_672 212
381 3300049582 Ga0501048_0054953 Ga0501048_0054953_1209_1862 212
382 3300049584 Ga0501068_0161096 Ga0501068_0161096_649_1287 212
383 3300049589 Ga0501073_0159844 Ga0501073_0159844_116_763 212
384 3300049590 Ga0501074_0150345 Ga0501074_0150345_763_1410 212
385 3300050489 nmdc:mga03683_17419_c1 nmdc:mga03683_17419_c1_513_1151 212
386 3300050491 nmdc:mga00v17_187261_c1 nmdc:mga00v17_187261_c1_473_1126 212
387 3300050492 nmdc:mga0yw44_53460_c1 nmdc:mga0yw44_53460_c1_874_1518 212
388 3300050493 nmdc:mga0k408_95_c1 nmdc:mga0k408_95_c1_27565_28218 212
389 3300050493 nmdc:mga0k408_9620_c1 nmdc:mga0k408_9620_c1_3960_4598 212
390 3300050496 nmdc:mga07m45_257421_c1 nmdc:mga07m45_257421_c1_94_756 212
391 3300050496 nmdc:mga07m45_90951_c1 nmdc:mga07m45_90951_c1_717_1370 212
392 3300050510 nmdc:mga06r32_144358_c1 nmdc:mga06r32_144358_c1_1189_1878 212
393 3300050510 nmdc:mga06r32_200234_c1 nmdc:mga06r32_200234_c1_1107_1766 212
394 3300050510 nmdc:mga06r32_514928_c1 nmdc:mga06r32_514928_c1_440_1120 212
395 3300050511 nmdc:mga08y16_540482_c1 nmdc:mga08y16_540482_c1_338_1120 212
396 3300050513 nmdc:mga0rr50_455039_c1 nmdc:mga0rr50_455039_c1_56_709 212
397 3300053085 Ga0495619_0041936 Ga0495619_0041936_282_962 212
398 3300053087 Ga0500643_000165 Ga0500643_000165_64698_65354 212
399 3300053103 Ga0500555_000227 Ga0500555_000227_832_1488 212
400 3300053118 Ga0500594_0023143 Ga0500594_0023143_722_1375 212
401 3300053120 Ga0500597_100909 Ga0500597_100909_345_998 212
402 3300053122 Ga0500608_001747 Ga0500608_001747_5305_5958 212
403 3300053154 Ga0500619_000064 Ga0500619_000064_8387_9028 212
404 3300053156 Ga0500622_0000228 Ga0500622_0000228_21788_22444 212
405 3300053730 Ga0500645_000646 Ga0500645_000646_15820_16476 212
406 3300002067 JGI24735J21928_10042435 JGI24735J21928_100424351 213
407 3300044842 Ga0466957_0128968 Ga0466957_0128968_280_924 213
408 3300045049 Ga0466959_0404095 Ga0466959_0404095_166_834 213
409 3300045976 Ga0466967_0209794 Ga0466967_0209794_637_1281 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

22

89

0.94

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

15

81

0.92

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

100

201

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

22

82

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.9815 2 212
3lq7-assembly2.cif.gz_C-2 crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9769 2 208
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9749 1 210
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9712 1 211
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9559 1 210
ID Description Score Start End Superfamily
2ycdA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9942 2 87 3.40.30.10
2ycdA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9828 2 87 3.40.30.10
3lq7A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9803 2 87 3.40.30.10
3lq7A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9675 2 87 3.40.30.10
3lq7C02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9631 88 203 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A527A1T9-F1-model_v4 Glutathione S-transferase 1.002 1 78 GO:0016740
AF-A0A529NGU8-F1-model_v4 Glutathione S-transferase 0.9983 1 108 GO:0016740
AF-A0A086P651-F1-model_v4 Glutathione S-transferase 0.9971 1 109 GO:0016740
AF-A0A4R2I9L5-F1-model_v4 Glutathione S-transferase 0.9937 1 210 GO:0016740
AF-A0A5C5CUV7-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9921 2 210 GO:0016740

Feature Viewer

pLDDT pTM Quality
93.65 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map