F436890

General Info

Members Datasets Scaffolds Average Seq Length
409 332 818 147

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10074362|rootH2_100743622
Length 169
Sequence MRYWLAGNSFQQTRSTVTITTDNERLQATAQIARHPLHPMLVPVPIVCFIGALLTDITYYVSAEMMWADFSAWLLVVGVIVGVLAACAGLVDFLGSRSIRAQAPAWPHMLGNALVLVLSFFNALIHTRDAWTSVVPVGLILSVIVVLILPVTGWLGWSMVYRHGVGVLR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
60 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
110 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
111 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
112 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
113 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
114 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
115 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
170 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
171 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
182 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
183 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
184 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
185 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
186 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
187 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
188 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
189 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
190 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
191 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
192 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
193 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
194 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
195 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
196 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
197 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
198 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
199 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
200 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
201 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
202 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
203 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
204 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
205 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
206 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
207 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
208 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
209 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
210 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
211 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
212 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
213 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
214 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
215 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
216 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
217 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
218 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
219 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
220 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
221 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
222 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
223 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
224 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
225 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
226 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
227 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
228 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
229 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
230 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
231 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
232 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
233 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
234 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
235 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
236 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
237 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
238 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
239 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
240 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
241 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
242 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
243 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
244 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
245 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
246 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
247 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
248 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
249 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
250 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
251 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
252 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
253 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
254 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
255 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
256 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
257 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
258 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
259 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
260 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
261 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
262 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
263 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
264 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
265 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
266 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
267 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
268 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
269 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
270 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
271 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
272 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
273 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
274 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
275 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
276 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
277 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
278 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
279 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
280 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
281 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
282 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
283 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
284 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
285 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
286 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
287 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
288 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
289 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
290 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
291 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
292 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
293 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
294 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
295 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
296 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
297 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
298 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
299 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
300 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
301 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
302 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
303 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
304 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
305 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
306 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
307 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
308 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
309 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
310 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
311 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
312 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
313 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
314 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
315 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
316 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
317 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
318 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
319 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
320 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
321 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
322 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
323 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
324 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
325 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
326 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
327 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
328 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
329 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
330 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
331 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
332 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.72
Metatranscriptomes 6.11
Isolates 37.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.31
Nodule 29.58
Rhizoplane 6.36
Rhizosphere 42.3
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10074362 3300003320 Bacteria 1598
2 JGI25158J39367_1000215 3300002739 Bacteria 13642
3 JGI25152J39213_1007734 3300002773 Bacteria 2751
4 JGI25159J45721_1003208 3300002987 Bacteria 5856
5 JGI25153J46596_10002381 3300003215 Bacteria 10874
6 JGI25153J46596_10006758 3300003215 Bacteria 5753
7 rootH1_10007528 3300003323 Bacteria 2955
8 rootH1_10212791 3300003323 Bacteria 2002
9 JGI25160J50197_1010466 3300003354 Bacteria 3354
10 JGI25161J50226_1000130 3300003374 Bacteria 53291
11 Ga0055526_1006129 3300003771 Bacteria 6627
12 Ga0055524_1003117 3300003775 Bacteria 8183
13 Ga0055528_1003855 3300003790 Bacteria 7377
14 Ga0055540_1006230 3300003792 Bacteria 4788
15 Ga0055531_10068495 3300003794 Bacteria 829
16 Ga0055543_1000045 3300004625 Bacteria 115098
17 Ga0058861_11264322 3300004800 Bacteria 745
18 Ga0065165_1007634 3300005262 Bacteria 5261
19 Ga0065165_1023817 3300005262 Bacteria 2068
20 Ga0070680_100869572 3300005336 Bacteria 777
21 Ga0070671_100384738 3300005355 Bacteria 1199
22 Ga0070709_10003412 3300005434 Bacteria 8529
23 Ga0070714_100025457 3300005435 Bacteria 4883
24 Ga0070714_100398720 3300005435 Bacteria 1300
25 Ga0070713_100005373 3300005436 Bacteria 8750
26 Ga0070713_100042875 3300005436 Bacteria 3696
27 Ga0070710_10090787 3300005437 Bacteria 1801
28 Ga0070711_100001942 3300005439 Bacteria 11587
29 Ga0070711_100007208 3300005439 Bacteria 6755
30 Ga0070663_100115408 3300005455 Bacteria 2023
31 Ga0070662_100816199 3300005457 Unclassified 793
32 Ga0070681_10039046 3300005458 Bacteria 4760
33 Ga0070681_10055888 3300005458 Bacteria 3929
34 Ga0070681_10142561 3300005458 Bacteria 2325
35 Ga0070679_100154412 3300005530 Bacteria 2271
36 Ga0070679_100321311 3300005530 Bacteria 1497
37 Ga0070684_100410093 3300005535 Bacteria 1250
38 Ga0068853_100013789 3300005539 Bacteria 6604
39 Ga0070686_100421041 3300005544 Bacteria 1020
40 Ga0068855_100734311 3300005563 Bacteria 1054
41 Ga0068855_101421888 3300005563 Bacteria 714
42 Ga0068857_100111702 3300005577 Bacteria 2457
43 Ga0068854_100314953 3300005578 Bacteria 1270
44 Ga0068856_100000376 3300005614 Bacteria 49155
45 Ga0068856_100954309 3300005614 Bacteria 876
46 Ga0068856_100994709 3300005614 Bacteria 857
47 Ga0068856_101428099 3300005614 Bacteria 706
48 Ga0068856_101897265 3300005614 Bacteria 607
49 Ga0068852_100531953 3300005616 Bacteria 1174
50 Ga0081540_1038284 3300005983 Bacteria 2529
51 Ga0070717_10061682 3300006028 Bacteria 3108
52 Ga0070716_100009365 3300006173 Bacteria 4879
53 Ga0070716_100031365 3300006173 Bacteria 2890
54 Ga0070716_100089326 3300006173 Bacteria 1861
55 Ga0105240_10010256 3300009093 Bacteria 13188
56 Ga0105240_10049134 3300009093 Bacteria 5327
57 Ga0105241_10388082 3300009174 Bacteria 1222
58 Ga0105237_10013225 3300009545 Bacteria 8657
59 Ga0105237_10303759 3300009545 Bacteria 1599
60 Ga0105238_10003765 3300009551 Bacteria 15071
61 Ga0105238_10064869 3300009551 Bacteria 3652
62 Ga0105238_10348723 3300009551 Bacteria 1469
63 Ga0105239_10009954 3300010375 Bacteria 10675
64 Ga0105239_10780675 3300010375 Bacteria 1094
65 Ga0157370_10107719 3300013104 Bacteria 2606
66 Ga0157369_10008239 3300013105 Bacteria 11948
67 Ga0157369_10163281 3300013105 Bacteria 2350
68 Ga0157374_10228600 3300013296 Bacteria 1827
69 Ga0157378_10281253 3300013297 Bacteria 1604
70 Ga0157372_10020442 3300013307 Bacteria 7142
71 Ga0157372_10266761 3300013307 Bacteria 1988
72 Ga0157372_11047985 3300013307 Bacteria 944
73 Ga0163163_10370836 3300014325 Bacteria 1488
74 Ga0163163_12244358 3300014325 Bacteria 605
75 Ga0182008_10221650 3300014497 Bacteria 968
76 Ga0157377_11503025 3300014745 Bacteria 535
77 Ga0157379_10265307 3300014968 Bacteria 1561
78 Ga0157379_10682396 3300014968 Bacteria 963
79 Ga0182006_1033315 3300015261 Bacteria 2066
80 Ga0182006_1199374 3300015261 Bacteria 663
81 Ga0182007_10124314 3300015262 Bacteria 865
82 Ga0182005_1034136 3300015265 Bacteria 1384
83 Ga0197907_10254214 3300020069 Bacteria 905
84 Ga0197907_11016332 3300020069 Bacteria 3320
85 Ga0206356_10813323 3300020070 Bacteria 610
86 Ga0206349_1360181 3300020075 Bacteria 727
87 Ga0206355_1367570 3300020076 Bacteria 1235
88 Ga0206351_10223311 3300020077 Bacteria 680
89 Ga0206352_10289930 3300020078 Bacteria 2051
90 Ga0206352_10471493 3300020078 Bacteria 1750
91 Ga0206350_10257721 3300020080 Bacteria 1213
92 Ga0206354_11513569 3300020081 Bacteria 719
93 Ga0206353_11720301 3300020082 Bacteria 675
94 Ga0213872_10020534 3300021361 Bacteria 3045
95 Ga0213874_10009021 3300021377 Bacteria 2452
96 Ga0224712_10002957 3300022467 Bacteria 4309
97 Ga0224712_10013791 3300022467 Bacteria 2585
98 Ga0209436_100004 3300025208 Bacteria 196698
99 Ga0207425_1012475 3300025245 Bacteria 1993
100 Ga0209148_1019176 3300025254 Bacteria 1139
101 Ga0209129_1002819 3300025258 Bacteria 8069
102 Ga0209233_1005955 3300025261 Bacteria 3989
103 Ga0209673_1002561 3300025273 Bacteria 12378
104 Ga0209130_1000001 3300025284 Bacteria 831557
105 Ga0209564_1000785 3300025295 Bacteria 43975
106 Ga0209758_1000065 3300025297 Bacteria 306288
107 Ga0209758_1029150 3300025297 Bacteria 2314
108 Ga0209256_1007270 3300025299 Bacteria 5521
109 Ga0207426_1000045 3300025302 Bacteria 422847
110 Ga0207426_1078007 3300025302 Bacteria 905
111 Ga0209051_1004271 3300025303 Bacteria 8895
112 Ga0209051_1053305 3300025303 Bacteria 1329
113 Ga0209257_1003057 3300025304 Bacteria 15079
114 Ga0209257_1027252 3300025304 Bacteria 1905
115 Ga0207656_10290313 3300025321 Bacteria 808
116 Ga0207692_10002189 3300025898 Bacteria 7472
117 Ga0207685_10030451 3300025905 Bacteria 1921
118 Ga0207699_10003853 3300025906 Bacteria 7162
119 Ga0207699_10157562 3300025906 Bacteria 1508
120 Ga0207699_10173644 3300025906 Bacteria 1444
121 Ga0207707_10129995 3300025912 Bacteria 2203
122 Ga0207707_10235914 3300025912 Bacteria 1591
123 Ga0207707_10386774 3300025912 Bacteria 1202
124 Ga0207695_10089653 3300025913 Bacteria 3092
125 Ga0207695_10376855 3300025913 Bacteria 1305
126 Ga0207671_10012361 3300025914 Bacteria 6869
127 Ga0207671_10429767 3300025914 Bacteria 1051
128 Ga0207693_10007293 3300025915 Bacteria 9099
129 Ga0207663_10028767 3300025916 Bacteria 3257
130 Ga0207649_10229072 3300025920 Bacteria 1328
131 Ga0207694_10002785 3300025924 Bacteria 14117
132 Ga0207700_10003099 3300025928 Bacteria 9599
133 Ga0207700_10812991 3300025928 Bacteria 836
134 Ga0207664_10010759 3300025929 Bacteria 6471
135 Ga0207665_10075057 3300025939 Bacteria 2315
136 Ga0207665_10163352 3300025939 Bacteria 1603
137 Ga0207667_10224554 3300025949 Bacteria 1924
138 Ga0207667_10281662 3300025949 Bacteria 1699
139 Ga0207640_10299309 3300025981 Bacteria 1272
140 Ga0207639_10014720 3300026041 Bacteria 5509
141 Ga0207639_10044006 3300026041 Bacteria 3356
142 Ga0207702_10000187 3300026078 Bacteria 74357
143 Ga0207674_10045620 3300026116 Bacteria 4507
144 Ga0207698_10347874 3300026142 Bacteria 1399
145 Ga0207698_11431385 3300026142 Bacteria 706
146 Ga0373937_1933334 3300036401 Bacteria 536
147 Ga0395900_0010655 3300037418 Bacteria 9402
148 Ga0395900_0012916 3300037418 Bacteria 8531
149 Ga0395900_0081841 3300037418 Bacteria 3317
150 Ga0395898_0030455 3300037466 Bacteria 5399
151 Ga0395898_0136337 3300037466 Bacteria 2350
152 Ga0436364_0518303 3300037853 Bacteria 1079
153 Ga0395901_0716109 3300038443 Bacteria 997
154 Ga0436365_0874842 3300039437 Bacteria 2843
155 Ga0436365_1022371 3300039437 Bacteria 1267
156 Ga0436361_0505596 3300039447 Bacteria 2249
157 Ga0436361_1154438 3300039447 Bacteria 7129
158 Ga0436363_0090161 3300039450 Bacteria 6009
159 Ga0451802_1420415 3300041460 Bacteria 839
160 Ga0451839_0901039 3300041496 Bacteria 2861
161 Ga0451841_0819178 3300041498 Bacteria 817
162 Ga0451845_0197904 3300041501 Bacteria 3145
163 Ga0451849_0686886 3300041505 Bacteria 2292
164 Ga0451851_0004103 3300041507 Bacteria 3530
165 Ga0451843_0199863 3300041509 Bacteria 2119
166 Ga0439431_0024781 3300041997 Bacteria 1462
167 Ga0439445_0050455 3300042004 Bacteria 1122
168 Ga0466972_0005727 3300044658 Bacteria 6227
169 Ga0466972_0101311 3300044658 Bacteria 1363
170 Ga0466972_0615933 3300044658 Bacteria 514
171 Ga0466964_0065123 3300044706 Bacteria 1526
172 Ga0466964_0162060 3300044706 Bacteria 1046
173 Ga0466968_0002940 3300044735 Bacteria 6298
174 Ga0466970_0085781 3300044765 Bacteria 1706
175 Ga0466970_0110224 3300044765 Bacteria 1503
176 Ga0466960_0281294 3300044901 Bacteria 932
177 Ga0466960_0495007 3300044901 Bacteria 716
178 Ga0466960_0934432 3300044901 Bacteria 530
179 Ga0466959_0043583 3300045049 Bacteria 3307
180 Ga0495606_0063895 3300046507 Bacteria 2345
181 Ga0495610_0137319 3300046512 Bacteria 1056
182 Ga0495628_0490791 3300046516 Bacteria 888
183 Ga0495630_0912707 3300046517 Bacteria 669
184 Ga0495645_0728049 3300046543 Bacteria 600
185 Ga0495646_0326207 3300046680 Bacteria 808
186 Ga0496100_0000929 3300048903 Bacteria 13991
187 Ga0496100_1060101 3300048903 Unclassified 638
188 Ga0496101_0013132 3300048904 Bacteria 5541
189 Ga0496102_0005229 3300048905 Bacteria 11017
190 Ga0496102_0231788 3300048905 Bacteria 1741
191 Ga0496104_0002648 3300048907 Bacteria 15407
192 Ga0496105_0368936 3300048908 Bacteria 1144
193 Ga0496106_0001345 3300048909 Bacteria 18426
194 Ga0496107_0068996 3300048910 Bacteria 2565
195 Ga0496108_0002665 3300048911 Bacteria 14307
196 Ga0496109_0007560 3300048912 Bacteria 9209
197 Ga0496109_0093304 3300048912 Bacteria 2786
198 Ga0496110_0000729 3300048913 Bacteria 22689
199 Ga0496110_0081903 3300048913 Bacteria 2877
200 Ga0496110_0277833 3300048913 Bacteria 1525
201 Ga0496111_0005622 3300048914 Bacteria 8063
202 Ga0496111_0102754 3300048914 Bacteria 2101
203 Ga0496111_0776680 3300048914 Bacteria 694
204 Ga0496112_0007571 3300048915 Bacteria 9645
205 Ga0496112_0033919 3300048915 Bacteria 4965
206 Ga0496112_0558473 3300048915 Bacteria 1078
207 Ga0496113_0005263 3300048916 Bacteria 8057
208 Ga0496113_0099209 3300048916 Bacteria 2255
209 Ga0496113_0913981 3300048916 Bacteria 694
210 Ga0496114_1046593 3300048917 Bacteria 700
211 Ga0496119_0501850 3300048922 Unclassified 564
212 Ga0496121_0065895 3300048924 Bacteria 2944
213 Ga0496122_0000009 3300048925 Bacteria 584024
214 Ga0496123_0000020 3300048926 Bacteria 388748
215 Ga0496123_0120850 3300048926 Bacteria 1474
216 Ga0496124_0013592 3300048927 Bacteria 7938
217 Ga0496124_0262203 3300048927 Unclassified 1271
218 Ga0496125_0165237 3300048928 Bacteria 1497
219 Ga0496125_0257543 3300048928 Bacteria 1096
220 Ga0496126_0023799 3300048929 Bacteria 5929
221 Ga0496126_0269567 3300048929 Bacteria 1413
222 Ga0501032_0036036 3300049569 Bacteria 3379
223 Ga0501033_0020750 3300049570 Bacteria 4963
224 Ga0501033_0171142 3300049570 Bacteria 1560
225 Ga0501034_0007247 3300049571 Bacteria 11836
226 Ga0501034_0316884 3300049571 Bacteria 1493
227 Ga0501036_0040814 3300049572 Bacteria 3926
228 Ga0501037_0533568 3300049573 Unclassified 793
229 Ga0501038_0010201 3300049574 Bacteria 8596
230 Ga0501039_0087556 3300049575 Bacteria 2426
231 Ga0501043_0047555 3300049579 Bacteria 3373
232 Ga0501046_0681633 3300049580 Bacteria 725
233 Ga0501047_0004685 3300049581 Bacteria 12861
234 Ga0501047_0571450 3300049581 Bacteria 954
235 Ga0501048_0255860 3300049582 Bacteria 1244
236 Ga0501068_0916148 3300049584 Bacteria 577
237 Ga0501070_0019497 3300049586 Bacteria 5688
238 Ga0501080_0066262 3300049742 Bacteria 3359
239 Ga0501080_0325418 3300049742 Bacteria 1391
240 Ga0501035_0128416 3300049822 Bacteria 2211
241 Ga0501044_0025914 3300049823 Bacteria 6214
242 Ga0501044_0789247 3300049823 Unclassified 830
243 Ga0495601_0377368 3300053077 Bacteria 920
244 Ga0495595_0117325 3300053084 Bacteria 1295
245 Ga0500578_0368767 3300053086 Bacteria 835
246 Ga0500604_0172256 3300053151 Bacteria 740
247 Ga0587073_0000978 3300059492 Bacteria 3066
248 Ga0587083_0162305 3300059505 Bacteria 612
249 Ga0587088_000890 3300059508 Bacteria 2827
250 Ga0587088_042300 3300059508 Bacteria 863
251 Ga0587109_062928 3300059624 Bacteria 786
252 Ga0587128_051519 3300059630 Bacteria 753
253 Ga0587067_086158 3300059640 Bacteria 704
254 Ga0587072_080593 3300059643 Bacteria 702
255 Ga0587107_082939 3300059652 Bacteria 606
256 Ga0587114_019416 3300059655 Bacteria 943
257 Ga0587120_011546 3300059659 Bacteria 761
258 2509074215 2508501114 Bacteria 7082538
259 2509152003 2508501128 Bacteria 8613869
260 2509373225 2509276018 Bacteria 6910194
261 2510317184 2510065059 Bacteria 6847884
262 2511399606 2511231028 Bacteria 8046582
263 2513628737 2513237092 Bacteria 8341956
264 2513704889 2513237102 Bacteria 7703324
265 2513875927 2513237139 Bacteria 8737671
266 2515630842 2515154112 Bacteria 8294334
267 2517103453 2517093001 Bacteria 9002274
268 2524440987 2524023205 Bacteria 8918781
269 2524457475 2524023209 Bacteria 6679728
270 2528852517 2528768022 Bacteria 10457665
271 2585994755 2585427633 Bacteria 6413184
272 2617349372 2617270735 Bacteria 9163226
273 2643754576 2643221547 Bacteria 4740017
274 2688599190 2687453392 Bacteria 6880454
275 2793060174 2791355196 Bacteria 7323613
276 2805917543 2802429603 Bacteria 8777136
277 2819644091 2818991453 Bacteria 7181617
278 2824602052 2824600985 Bacteria 8488197
279 2824610040 2824609381 Bacteria 8672835
280 2824682445 2824679649 Bacteria 8248951
281 2824697040 2824696289 Bacteria 8335049
282 2824706633 2824704595 Bacteria 9667483
283 2824759375 2824753945 Bacteria 9787441
284 2824769611 2824763712 Bacteria 9792355
285 2824774106 2824773399 Bacteria 8360218
286 2835315097 2835312727 Bacteria 7413381
287 2841941328 2841941048 Bacteria 8688029
288 2841967464 2841966195 Bacteria 8673214
289 2841979139 2841974524 Bacteria 8931498
290 2842038554 2842038055 Bacteria 8002051
291 2842048501 2842045827 Bacteria 8006841
292 2842298967 2842298080 Bacteria 6123127
293 2842358432 2842357229 Bacteria 6485165
294 2844004525 2844002411 Bacteria 7168230
295 2844317948 2844315083 Bacteria 8138177
296 2844538418 2844533157 Bacteria 7517899
297 2847934790 2847930680 Bacteria 9342022
298 2847945325 2847939898 Bacteria 8606328
299 2849080483 2849076700 Bacteria 7039503
300 2856329138 2856328259 Bacteria 6528202
301 2856341949 2856334872 Bacteria 7037011
302 2857369412 2857367948 Bacteria 6965560
303 2857510166 2857509624 Bacteria 7472071
304 2869175095 2869169390 Bacteria 6659796
305 2869249212 2869242130 Bacteria 6609239
306 2869249685 2869249662 Bacteria 6868783
307 2869268133 2869264136 Bacteria 6880765
308 2869273691 2869271264 Bacteria 6908218
309 2871463150 2871459585 Bacteria 6866887
310 2871488652 2871481445 Bacteria 6700002
311 2874122587 2874116593 Bacteria 6674494
312 2874134263 2874131515 Bacteria 6820270
313 2874164187 2874162495 Bacteria 6174670
314 2874592065 2874590934 Bacteria 8299676
315 2874632646 2874628541 Bacteria 8630250
316 2874653376 2874645413 Bacteria 8214782
317 2876390536 2876386047 Bacteria 6698674
318 2876403374 2876399893 Bacteria 6927900
319 2876412713 2876406927 Bacteria 6191900
320 2876421586 2876420981 Bacteria 6687741
321 2876768594 2876761206 Bacteria 10111113
322 2876772258 2876771140 Bacteria 8287509
323 2876823819 2876818435 Bacteria 8274608
324 2878779309 2878774303 Bacteria 6108671
325 2878785311 2878781027 Bacteria 6834456
326 2879080447 2879074833 Bacteria 8279565
327 2879088099 2879083081 Bacteria 8587928
328 2879127717 2879127579 Bacteria 8294491
329 2879142931 2879142872 Bacteria 8267021
330 2881673662 2881665667 Bacteria 8175609
331 2888423232 2888419890 Bacteria 7857137
332 2903729742 2903727486 Bacteria 8281579
333 2904716715 2904711408 Bacteria 9771557
334 2906363816 2906363423 Bacteria 6856682
335 2906371759 2906370794 Bacteria 6881062
336 2906389033 2906386501 Bacteria 5977019
337 2906394752 2906393657 Bacteria 6790866
338 2906402840 2906401398 Bacteria 6693206
339 2906414320 2906408224 Bacteria 6162342
340 2906433795 2906427513 Bacteria 6375796
341 2906607470 2906602504 Bacteria 8295279
342 2906644154 2906643746 Bacteria 8722424
343 2922155358 2922151315 Bacteria 6902399
344 2922173063 2922172374 Bacteria 6167644
345 2922395158 2922393267 Bacteria 8285685
346 2924747207 2924741084 Bacteria 6661321
347 2924752145 2924748358 Bacteria 6154725
348 2932800966 2932794094 Bacteria 7915132
349 2932804618 2932801729 Bacteria 7987968
350 2935775321 2935769743 Bacteria 7878163
351 2935791481 2935785616 Bacteria 7962367
352 2935799793 2935793552 Bacteria 8012592
353 2935885151 2935883170 Bacteria 7964738
354 2937851244 2937848649 Bacteria 6983481
355 2937867116 2937861824 Bacteria 6660327
356 2937870595 2937868953 Bacteria 6639878
357 2937986435 2937980651 Bacteria 6517427
358 2958113251 2958108152 Bacteria 6681128
359 2958128393 2958122699 Bacteria 7280457
360 2958138339 2958137437 Bacteria 6050276
361 2958159964 2958158011 Bacteria 6058449
362 2961142986 2961136820 Bacteria 6775228
363 2961184803 2961183825 Bacteria 6688536
364 2965029291 2965025482 Bacteria 6532201
365 2965034600 2965032056 Bacteria 6887443
366 2965047045 2965040258 Bacteria 6855979
367 2965050803 2965047637 Bacteria 6623551
368 2965089558 2965089291 Bacteria 6866420
369 2965109490 2965102966 Bacteria 6800987
370 2965114727 2965110997 Bacteria 6693150
371 2970489833 2970489779 Bacteria 6517260
372 2970539279 2970532167 Bacteria 6553173
373 2970551883 2970547951 Bacteria 6931819
374 2970627217 2970627176 Bacteria 6680862
375 2977851386 2977851361 Bacteria 6694324
376 2977877466 2977872689 Bacteria 7270173
377 2977910701 2977907340 Bacteria 6577984
378 2977918947 2977915119 Bacteria 6829656
379 2977924885 2977922695 Bacteria 6956781
380 2977937574 2977935797 Bacteria 6252826
381 2977953963 2977950692 Bacteria 6893264
382 2977962998 2977957713 Bacteria 6877875
383 2979768518 2979764755 Bacteria 6610066
384 2979777792 2979772303 Bacteria 6618277
385 2979795588 2979793036 Bacteria 6808957
386 2987646035 2987645492 Bacteria 6117018
387 2987675348 2987673487 Bacteria 6884027
388 3004198370 3004195979 Bacteria 6776956
389 3004212385 3004211236 Bacteria 7417683
390 3004224260 3004218560 Bacteria 7421728
391 3005488106 3005483717 Bacteria 7877331
392 3005590539 3005587118 Bacteria 7794411
393 8004306770 8004300914 Bacteria 6132239
394 8004318549 8004312739 Bacteria 7444653
395 8004366629 8004361976 Bacteria 6858373
396 8004698458 8004695233 Bacteria 6731676
397 8004729085 8004727605 Bacteria 6643904
398 8016530845 8016522445 Bacteria 8156687
399 8016536137 8016530956 Bacteria 8155261
400 8016552819 8016548790 Bacteria 8155074
401 8016561199 8016557553 Bacteria 8154380
402 8016574491 8016566248 Bacteria 8158151
403 8016578581 8016575299 Bacteria 8154085
404 8016599056 8016595262 Bacteria 8149947
405 8016628043 8016622563 Bacteria 7999408
406 8019555156 8019547302 Bacteria 7996444
407 8019626775 8019619141 Bacteria 9218857
408 8019643947 8019638758 Bacteria 9062356
409 8019656947 8019648815 Bacteria 10014479
410 rootH2_10074362
411 JGI25158J39367_1000215
412 JGI25152J39213_1007734
413 JGI25159J45721_1003208
414 JGI25153J46596_10002381
415 JGI25153J46596_10006758
416 rootH1_10007528
417 rootH1_10212791
418 JGI25160J50197_1010466
419 JGI25161J50226_1000130
420 Ga0055526_1006129
421 Ga0055524_1003117
422 Ga0055528_1003855
423 Ga0055540_1006230
424 Ga0055531_10068495
425 Ga0055543_1000045
426 Ga0058861_11264322
427 Ga0065165_1007634
428 Ga0065165_1023817
429 Ga0070680_100869572
430 Ga0070671_100384738
431 Ga0070709_10003412
432 Ga0070714_100025457
433 Ga0070714_100398720
434 Ga0070713_100005373
435 Ga0070713_100042875
436 Ga0070710_10090787
437 Ga0070711_100001942
438 Ga0070711_100007208
439 Ga0070663_100115408
440 Ga0070662_100816199
441 Ga0070681_10039046
442 Ga0070681_10055888
443 Ga0070681_10142561
444 Ga0070679_100154412
445 Ga0070679_100321311
446 Ga0070684_100410093
447 Ga0068853_100013789
448 Ga0070686_100421041
449 Ga0068855_100734311
450 Ga0068855_101421888
451 Ga0068857_100111702
452 Ga0068854_100314953
453 Ga0068856_100000376
454 Ga0068856_100954309
455 Ga0068856_100994709
456 Ga0068856_101428099
457 Ga0068856_101897265
458 Ga0068852_100531953
459 Ga0081540_1038284
460 Ga0070717_10061682
461 Ga0070716_100009365
462 Ga0070716_100031365
463 Ga0070716_100089326
464 Ga0105240_10010256
465 Ga0105240_10049134
466 Ga0105241_10388082
467 Ga0105237_10013225
468 Ga0105237_10303759
469 Ga0105238_10003765
470 Ga0105238_10064869
471 Ga0105238_10348723
472 Ga0105239_10009954
473 Ga0105239_10780675
474 Ga0157370_10107719
475 Ga0157369_10008239
476 Ga0157369_10163281
477 Ga0157374_10228600
478 Ga0157378_10281253
479 Ga0157372_10020442
480 Ga0157372_10266761
481 Ga0157372_11047985
482 Ga0163163_10370836
483 Ga0163163_12244358
484 Ga0182008_10221650
485 Ga0157377_11503025
486 Ga0157379_10265307
487 Ga0157379_10682396
488 Ga0182006_1033315
489 Ga0182006_1199374
490 Ga0182007_10124314
491 Ga0182005_1034136
492 Ga0197907_10254214
493 Ga0197907_11016332
494 Ga0206356_10813323
495 Ga0206349_1360181
496 Ga0206355_1367570
497 Ga0206351_10223311
498 Ga0206352_10289930
499 Ga0206352_10471493
500 Ga0206350_10257721
501 Ga0206354_11513569
502 Ga0206353_11720301
503 Ga0213872_10020534
504 Ga0213874_10009021
505 Ga0224712_10002957
506 Ga0224712_10013791
507 Ga0209436_100004
508 Ga0207425_1012475
509 Ga0209148_1019176
510 Ga0209129_1002819
511 Ga0209233_1005955
512 Ga0209673_1002561
513 Ga0209130_1000001
514 Ga0209564_1000785
515 Ga0209758_1000065
516 Ga0209758_1029150
517 Ga0209256_1007270
518 Ga0207426_1000045
519 Ga0207426_1078007
520 Ga0209051_1004271
521 Ga0209051_1053305
522 Ga0209257_1003057
523 Ga0209257_1027252
524 Ga0207656_10290313
525 Ga0207692_10002189
526 Ga0207685_10030451
527 Ga0207699_10003853
528 Ga0207699_10157562
529 Ga0207699_10173644
530 Ga0207707_10129995
531 Ga0207707_10235914
532 Ga0207707_10386774
533 Ga0207695_10089653
534 Ga0207695_10376855
535 Ga0207671_10012361
536 Ga0207671_10429767
537 Ga0207693_10007293
538 Ga0207663_10028767
539 Ga0207649_10229072
540 Ga0207694_10002785
541 Ga0207700_10003099
542 Ga0207700_10812991
543 Ga0207664_10010759
544 Ga0207665_10075057
545 Ga0207665_10163352
546 Ga0207667_10224554
547 Ga0207667_10281662
548 Ga0207640_10299309
549 Ga0207639_10014720
550 Ga0207639_10044006
551 Ga0207702_10000187
552 Ga0207674_10045620
553 Ga0207698_10347874
554 Ga0207698_11431385
555 Ga0373937_1933334
556 Ga0395900_0010655
557 Ga0395900_0012916
558 Ga0395900_0081841
559 Ga0395898_0030455
560 Ga0395898_0136337
561 Ga0436364_0518303
562 Ga0395901_0716109
563 Ga0436365_0874842
564 Ga0436365_1022371
565 Ga0436361_0505596
566 Ga0436361_1154438
567 Ga0436363_0090161
568 Ga0451802_1420415
569 Ga0451839_0901039
570 Ga0451841_0819178
571 Ga0451845_0197904
572 Ga0451849_0686886
573 Ga0451851_0004103
574 Ga0451843_0199863
575 Ga0439431_0024781
576 Ga0439445_0050455
577 Ga0466972_0005727
578 Ga0466972_0101311
579 Ga0466972_0615933
580 Ga0466964_0065123
581 Ga0466964_0162060
582 Ga0466968_0002940
583 Ga0466970_0085781
584 Ga0466970_0110224
585 Ga0466960_0281294
586 Ga0466960_0495007
587 Ga0466960_0934432
588 Ga0466959_0043583
589 Ga0495606_0063895
590 Ga0495610_0137319
591 Ga0495628_0490791
592 Ga0495630_0912707
593 Ga0495645_0728049
594 Ga0495646_0326207
595 Ga0496100_0000929
596 Ga0496100_1060101
597 Ga0496101_0013132
598 Ga0496102_0005229
599 Ga0496102_0231788
600 Ga0496104_0002648
601 Ga0496105_0368936
602 Ga0496106_0001345
603 Ga0496107_0068996
604 Ga0496108_0002665
605 Ga0496109_0007560
606 Ga0496109_0093304
607 Ga0496110_0000729
608 Ga0496110_0081903
609 Ga0496110_0277833
610 Ga0496111_0005622
611 Ga0496111_0102754
612 Ga0496111_0776680
613 Ga0496112_0007571
614 Ga0496112_0033919
615 Ga0496112_0558473
616 Ga0496113_0005263
617 Ga0496113_0099209
618 Ga0496113_0913981
619 Ga0496114_1046593
620 Ga0496119_0501850
621 Ga0496121_0065895
622 Ga0496122_0000009
623 Ga0496123_0000020
624 Ga0496123_0120850
625 Ga0496124_0013592
626 Ga0496124_0262203
627 Ga0496125_0165237
628 Ga0496125_0257543
629 Ga0496126_0023799
630 Ga0496126_0269567
631 Ga0501032_0036036
632 Ga0501033_0020750
633 Ga0501033_0171142
634 Ga0501034_0007247
635 Ga0501034_0316884
636 Ga0501036_0040814
637 Ga0501037_0533568
638 Ga0501038_0010201
639 Ga0501039_0087556
640 Ga0501043_0047555
641 Ga0501046_0681633
642 Ga0501047_0004685
643 Ga0501047_0571450
644 Ga0501048_0255860
645 Ga0501068_0916148
646 Ga0501070_0019497
647 Ga0501080_0066262
648 Ga0501080_0325418
649 Ga0501035_0128416
650 Ga0501044_0025914
651 Ga0501044_0789247
652 Ga0495601_0377368
653 Ga0495595_0117325
654 Ga0500578_0368767
655 Ga0500604_0172256
656 Ga0587073_0000978
657 Ga0587083_0162305
658 Ga0587088_000890
659 Ga0587088_042300
660 Ga0587109_062928
661 Ga0587128_051519
662 Ga0587067_086158
663 Ga0587072_080593
664 Ga0587107_082939
665 Ga0587114_019416
666 Ga0587120_011546
667 2509074215
668 2509152003
669 2509373225
670 2510317184
671 2511399606
672 2513628737
673 2513704889
674 2513875927
675 2515630842
676 2517103453
677 2524440987
678 2524457475
679 2528852517
680 2585994755
681 2617349372
682 2643754576
683 2688599190
684 2793060174
685 2805917543
686 2819644091
687 2824602052
688 2824610040
689 2824682445
690 2824697040
691 2824706633
692 2824759375
693 2824769611
694 2824774106
695 2835315097
696 2841941328
697 2841967464
698 2841979139
699 2842038554
700 2842048501
701 2842298967
702 2842358432
703 2844004525
704 2844317948
705 2844538418
706 2847934790
707 2847945325
708 2849080483
709 2856329138
710 2856341949
711 2857369412
712 2857510166
713 2869175095
714 2869249212
715 2869249685
716 2869268133
717 2869273691
718 2871463150
719 2871488652
720 2874122587
721 2874134263
722 2874164187
723 2874592065
724 2874632646
725 2874653376
726 2876390536
727 2876403374
728 2876412713
729 2876421586
730 2876768594
731 2876772258
732 2876823819
733 2878779309
734 2878785311
735 2879080447
736 2879088099
737 2879127717
738 2879142931
739 2881673662
740 2888423232
741 2903729742
742 2904716715
743 2906363816
744 2906371759
745 2906389033
746 2906394752
747 2906402840
748 2906414320
749 2906433795
750 2906607470
751 2906644154
752 2922155358
753 2922173063
754 2922395158
755 2924747207
756 2924752145
757 2932800966
758 2932804618
759 2935775321
760 2935791481
761 2935799793
762 2935885151
763 2937851244
764 2937867116
765 2937870595
766 2937986435
767 2958113251
768 2958128393
769 2958138339
770 2958159964
771 2961142986
772 2961184803
773 2965029291
774 2965034600
775 2965047045
776 2965050803
777 2965089558
778 2965109490
779 2965114727
780 2970489833
781 2970539279
782 2970551883
783 2970627217
784 2977851386
785 2977877466
786 2977910701
787 2977918947
788 2977924885
789 2977937574
790 2977953963
791 2977962998
792 2979768518
793 2979777792
794 2979795588
795 2987646035
796 2987675348
797 3004198370
798 3004212385
799 3004224260
800 3005488106
801 3005590539
802 8004306770
803 8004318549
804 8004366629
805 8004698458
806 8004729085
807 8016530845
808 8016536137
809 8016552819
810 8016561199
811 8016574491
812 8016578581
813 8016599056
814 8016628043
815 8019555156
816 8019626775
817 8019643947
818 8019656947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09990

DUF2231

Predicted membrane protein (DUF2231)

34

169

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7au3-assembly1.cif.gz_C cytochrome c oxidase structure in f-state 0.7189 12 138
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.7079 18 139
7ldd-assembly1.cif.gz_E native ampa receptor 0.7007 22 144
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.6984 21 134
8q1b-assembly1.cif.gz_c iii2-iv1 respiratory supercomplex from s. pombe 0.6972 17 145
ID Description Score Start End Superfamily
af_Q501A1_10_104_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7324 17 103 1.20.58.90
af_Q0JGZ0_269_434_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7244 20 131 1.20.120.1770
af_K7TUB1_192_388_3.30.760.10 Alpha Beta;2-Layer Sandwich;RNA Cap, Translation Initiation Factor Eif4e;RNA Cap, Translation Initiation Factor Eif4e 0.7159 20 144 3.30.760.10
af_P14575_77_269_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7094 11 145 1.20.120.80
1qleC02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.693 20 138 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A4R2X572-F1-model_v4 deleted 0.967 15 145
AF-A0A1U9Y4X9-F1-model_v4 deleted 0.9565 17 136
AF-A0A3C0M104-F1-model_v4 deleted 0.945 16 134
AF-A0A0Q8MQ24-F1-model_v4 DUF2231 domain-containing protein 0.939 13 144 GO:0016020
AF-A0A7G9SG92-F1-model_v4 DUF2231 domain-containing protein 0.9389 15 134 GO:0016020

Map