F436844

General Info

Members Datasets Scaffolds Average Seq Length
408 213 816 275

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_2856_c1|nmdc:mga0n895_2856_c1_5915_6844
Length 309
Sequence MRFCQSAAVTRSARFWIRRQEGGEQMAEVVTLRDAVAELVADGDTVALEGFTHLIPHAAGHELIRQRRRGLTLVRLTPDVIYDQMIGMGCAERMIFSWGGNPGVGSLHRFRDAVESGWPVPLAIEEHSHAGMAAAYAAGAANLPFGVLRGYAGTDLPGHTASAGWVDCPFTGERLAAVRALRPDVAIVHAQQADRAGNVQLWGISGVQKEAVLAARRSIVTVEELVDELAPRPGAVVIPTWVVTAVAEAPGGAHPSYAHGYYDRDNRFYTAWDAISRDRERFTAWMQRHVLDTADVREYAALLREGSPA

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
122 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
123 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
124 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
125 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
126 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
127 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
211 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
212 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
213 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 1.23
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.22
Rhizosphere 85.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_2856_c1 3300050512 Bacteria 13688
2 Ga0070658_10005869 3300005327 Bacteria 9957
3 Ga0070683_100004938 3300005329 Bacteria 11060
4 Ga0070683_100200721 3300005329 Bacteria 1894
5 Ga0070683_100304383 3300005329 Bacteria 1517
6 Ga0070690_100094808 3300005330 Bacteria 1970
7 Ga0070680_100045165 3300005336 Bacteria 3581
8 Ga0070680_100182310 3300005336 Bacteria 1768
9 Ga0070682_100103300 3300005337 Bacteria 1885
10 Ga0068868_100356127 3300005338 Bacteria 1254
11 Ga0070660_100016735 3300005339 Bacteria 5331
12 Ga0070660_100054109 3300005339 Bacteria 3098
13 Ga0070691_10072341 3300005341 Bacteria 1675
14 Ga0070692_10123449 3300005345 Bacteria 1447
15 Ga0070709_10319702 3300005434 Bacteria 1139
16 Ga0070714_100012756 3300005435 Bacteria 6714
17 Ga0070714_100023308 3300005435 Bacteria 5083
18 Ga0070714_100178334 3300005435 Bacteria 1932
19 Ga0070714_100262216 3300005435 Bacteria 1600
20 Ga0070714_100284921 3300005435 Bacteria 1536
21 Ga0070714_100402745 3300005435 Bacteria 1294
22 Ga0070713_100385490 3300005436 Bacteria 1306
23 Ga0070711_100011580 3300005439 Bacteria 5484
24 Ga0070711_100238947 3300005439 Bacteria 1420
25 Ga0070711_100244848 3300005439 Bacteria 1404
26 Ga0070708_100001234 3300005445 Bacteria 19676
27 Ga0070681_10006166 3300005458 Bacteria 11644
28 Ga0070681_10059914 3300005458 Bacteria 3786
29 Ga0070681_10080757 3300005458 Bacteria 3207
30 Ga0070681_10191934 3300005458 Bacteria 1962
31 Ga0070685_10108749 3300005466 Bacteria 1704
32 Ga0070706_100002363 3300005467 Bacteria 19041
33 Ga0070706_100029550 3300005467 Bacteria 5049
34 Ga0070706_100290549 3300005467 Bacteria 1525
35 Ga0070707_100000043 3300005468 Bacteria 108893
36 Ga0070707_100002621 3300005468 Bacteria 17098
37 Ga0070707_100020775 3300005468 Bacteria 6198
38 Ga0070707_100505130 3300005468 Bacteria 1171
39 Ga0070698_100000072 3300005471 Bacteria 75715
40 Ga0070698_100000309 3300005471 Bacteria 49509
41 Ga0070698_100005619 3300005471 Bacteria 13714
42 Ga0070699_100305777 3300005518 Bacteria 1427
43 Ga0070679_100001190 3300005530 Bacteria 22847
44 Ga0070679_100049189 3300005530 Bacteria 4199
45 Ga0070679_100074239 3300005530 Bacteria 3391
46 Ga0070684_100002475 3300005535 Bacteria 13601
47 Ga0070684_100003183 3300005535 Bacteria 12276
48 Ga0070684_100121492 3300005535 Bacteria 2350
49 Ga0070684_100402302 3300005535 Bacteria 1262
50 Ga0070697_100016026 3300005536 Bacteria 5893
51 Ga0070695_100093341 3300005545 Bacteria 2014
52 Ga0070693_100005640 3300005547 Bacteria 6035
53 Ga0070693_100020404 3300005547 Bacteria 3494
54 Ga0070704_100064322 3300005549 Bacteria 2636
55 Ga0068855_100023031 3300005563 Bacteria 7464
56 Ga0068855_100039391 3300005563 Bacteria 5610
57 Ga0070664_100072495 3300005564 Bacteria 2954
58 Ga0068856_100003599 3300005614 Bacteria 15594
59 Ga0068856_100204699 3300005614 Bacteria 1988
60 Ga0068856_100250961 3300005614 Bacteria 1784
61 Ga0068856_100353783 3300005614 Bacteria 1487
62 Ga0070702_100028663 3300005615 Bacteria 3019
63 Ga0068852_100111659 3300005616 Bacteria 2486
64 Ga0068852_100593273 3300005616 Bacteria 1111
65 Ga0068858_100204552 3300005842 Bacteria 1868
66 Ga0081455_10001517 3300005937 Bacteria 28624
67 Ga0081455_10010420 3300005937 Bacteria 9438
68 Ga0081455_10032791 3300005937 Bacteria 4676
69 Ga0081538_10106468 3300005981 Bacteria 1392
70 Ga0070717_10060745 3300006028 Bacteria 3130
71 Ga0070717_10550690 3300006028 Bacteria 1045
72 Ga0070716_100136657 3300006173 Bacteria 1557
73 Ga0070712_100058783 3300006175 Bacteria 2705
74 Ga0070712_100286924 3300006175 Bacteria 1327
75 Ga0075428_100015994 3300006844 Bacteria 8297
76 Ga0075428_100199059 3300006844 Bacteria 2166
77 Ga0075431_100023965 3300006847 Bacteria 6248
78 Ga0075431_100346466 3300006847 Bacteria 1494
79 Ga0075433_10077482 3300006852 Bacteria 2928
80 Ga0075433_10113083 3300006852 Bacteria 2408
81 Ga0075433_10572780 3300006852 Bacteria 992
82 Ga0075434_100008246 3300006871 Bacteria 9674
83 Ga0075434_100038806 3300006871 Bacteria 4719
84 Ga0075434_100173178 3300006871 Bacteria 2178
85 Ga0075434_100264771 3300006871 Bacteria 1738
86 Ga0075436_100009473 3300006914 Bacteria 6658
87 Ga0075436_100035774 3300006914 Bacteria 3425
88 Ga0075435_100003560 3300007076 Bacteria 10579
89 Ga0075435_100019029 3300007076 Bacteria 5233
90 Ga0105240_10012796 3300009093 Bacteria 11561
91 Ga0105240_10029982 3300009093 Bacteria 7076
92 Ga0105240_10062922 3300009093 Bacteria 4618
93 Ga0105245_10105711 3300009098 Bacteria 2611
94 Ga0105245_10110481 3300009098 Bacteria 2556
95 Ga0105247_10020240 3300009101 Bacteria 4001
96 Ga0114129_10558838 3300009147 Bacteria 1487
97 Ga0105243_10148192 3300009148 Bacteria 2010
98 Ga0105241_10085371 3300009174 Bacteria 2481
99 Ga0105237_10033363 3300009545 Bacteria 5215
100 Ga0105237_10262427 3300009545 Bacteria 1730
101 Ga0105238_10014693 3300009551 Bacteria 7915
102 Ga0105238_10520830 3300009551 Bacteria 1191
103 Ga0105238_10890909 3300009551 Bacteria 908
104 Ga0105239_10157363 3300010375 Bacteria 2538
105 Ga0105239_10315054 3300010375 Bacteria 1764
106 Ga0105246_10010988 3300011119 Bacteria 5613
107 Ga0105246_10133835 3300011119 Bacteria 1855
108 Ga0105246_10480144 3300011119 Bacteria 1051
109 Ga0157371_10095744 3300013102 Bacteria 2104
110 Ga0157370_10055467 3300013104 Bacteria 3774
111 Ga0157369_10001378 3300013105 Bacteria 29916
112 Ga0157369_10005496 3300013105 Bacteria 14724
113 Ga0157369_10084680 3300013105 Bacteria 3389
114 Ga0157369_10320181 3300013105 Bacteria 1612
115 Ga0157369_10486127 3300013105 Bacteria 1278
116 Ga0157369_10629319 3300013105 Bacteria 1107
117 Ga0157369_10659133 3300013105 Bacteria 1079
118 Ga0157374_10037102 3300013296 Bacteria 4470
119 Ga0157374_10078022 3300013296 Bacteria 3136
120 Ga0157372_10018773 3300013307 Bacteria 7438
121 Ga0157372_10057080 3300013307 Bacteria 4363
122 Ga0157372_10066345 3300013307 Bacteria 4054
123 Ga0157375_10089496 3300013308 Bacteria 3134
124 Ga0163163_10034691 3300014325 Bacteria 4889
125 Ga0182008_10003115 3300014497 Bacteria 10148
126 Ga0182008_10038327 3300014497 Bacteria 2396
127 Ga0182008_10245407 3300014497 Bacteria 922
128 Ga0157377_10025049 3300014745 Bacteria 3179
129 Ga0157379_10172835 3300014968 Bacteria 1950
130 Ga0157379_10473390 3300014968 Bacteria 1159
131 Ga0197907_10553923 3300020069 Bacteria 1833
132 Ga0206356_11301837 3300020070 Bacteria 2735
133 Ga0206354_11320388 3300020081 Bacteria 2617
134 Ga0206353_10560634 3300020082 Bacteria 2687
135 Ga0224712_10035883 3300022467 Bacteria 1833
136 Ga0207692_10085682 3300025898 Bacteria 1696
137 Ga0207688_10019053 3300025901 Bacteria 3734
138 Ga0207688_10110873 3300025901 Bacteria 1593
139 Ga0207685_10178924 3300025905 Bacteria 982
140 Ga0207699_10137655 3300025906 Bacteria 1601
141 Ga0207699_10197904 3300025906 Bacteria 1360
142 Ga0207705_10106778 3300025909 Bacteria 2065
143 Ga0207684_10040691 3300025910 Bacteria 3940
144 Ga0207684_10043532 3300025910 Bacteria 3807
145 Ga0207684_10254205 3300025910 Bacteria 1516
146 Ga0207654_10135493 3300025911 Bacteria 1564
147 Ga0207707_10019870 3300025912 Bacteria 5862
148 Ga0207707_10156760 3300025912 Bacteria 1991
149 Ga0207707_10217267 3300025912 Bacteria 1664
150 Ga0207695_10054984 3300025913 Bacteria 4152
151 Ga0207695_10177696 3300025913 Bacteria 2051
152 Ga0207695_10192166 3300025913 Bacteria 1959
153 Ga0207671_10122583 3300025914 Bacteria 1988
154 Ga0207671_10152941 3300025914 Bacteria 1783
155 Ga0207693_10041124 3300025915 Bacteria 3640
156 Ga0207693_10060979 3300025915 Bacteria 2955
157 Ga0207693_10070940 3300025915 Bacteria 2726
158 Ga0207660_10031904 3300025917 Bacteria 3633
159 Ga0207660_10047652 3300025917 Bacteria 3031
160 Ga0207662_10018290 3300025918 Bacteria 3974
161 Ga0207657_10003088 3300025919 Bacteria 17820
162 Ga0207657_10276396 3300025919 Bacteria 1334
163 Ga0207649_10225882 3300025920 Bacteria 1336
164 Ga0207649_10253944 3300025920 Bacteria 1267
165 Ga0207652_10006583 3300025921 Bacteria 9365
166 Ga0207652_10080163 3300025921 Bacteria 2853
167 Ga0207646_10000300 3300025922 Bacteria 67365
168 Ga0207646_10000647 3300025922 Bacteria 45144
169 Ga0207646_10211627 3300025922 Bacteria 1751
170 Ga0207694_10432660 3300025924 Bacteria 1097
171 Ga0207687_10010512 3300025927 Bacteria 6047
172 Ga0207687_10069491 3300025927 Bacteria 2512
173 Ga0207700_10091149 3300025928 Bacteria 2407
174 Ga0207664_10031730 3300025929 Bacteria 4044
175 Ga0207664_10090555 3300025929 Bacteria 2506
176 Ga0207664_10244761 3300025929 Bacteria 1563
177 Ga0207664_10374919 3300025929 Bacteria 1262
178 Ga0207690_10032932 3300025932 Bacteria 3329
179 Ga0207686_10107352 3300025934 Bacteria 1876
180 Ga0207686_10352778 3300025934 Bacteria 1108
181 Ga0207665_10064506 3300025939 Bacteria 2489
182 Ga0207661_10053511 3300025944 Bacteria 3230
183 Ga0207661_10151928 3300025944 Bacteria 2002
184 Ga0207679_10121835 3300025945 Bacteria 2078
185 Ga0207679_10313679 3300025945 Bacteria 1356
186 Ga0207667_10071005 3300025949 Bacteria 3623
187 Ga0207667_10098290 3300025949 Bacteria 3020
188 Ga0207667_10213533 3300025949 Bacteria 1977
189 Ga0207712_10140698 3300025961 Bacteria 1851
190 Ga0207640_10072276 3300025981 Bacteria 2326
191 Ga0207640_10134144 3300025981 Bacteria 1794
192 Ga0207639_10638694 3300026041 Bacteria 984
193 Ga0207678_10170774 3300026067 Bacteria 1856
194 Ga0207702_10002784 3300026078 Bacteria 16389
195 Ga0207702_10009134 3300026078 Bacteria 8344
196 Ga0207702_10036928 3300026078 Bacteria 4087
197 Ga0207702_10194280 3300026078 Bacteria 1877
198 Ga0207702_10208124 3300026078 Bacteria 1817
199 Ga0207702_10357431 3300026078 Bacteria 1399
200 Ga0207676_10390486 3300026095 Bacteria 1298
201 Ga0207683_10074153 3300026121 Bacteria 3010
202 Ga0207698_10082504 3300026142 Bacteria 2599
203 Ga0207698_10376069 3300026142 Bacteria 1350
204 Ga0268265_10584978 3300028380 Bacteria 1065
205 Ga0307416_100556161 3300032002 Bacteria 1221
206 Ga0307415_100054411 3300032126 Bacteria 2732
207 Ga0373944_0022256 3300035089 Bacteria 1841
208 Ga0373945_0025154 3300035116 Bacteria 2067
209 Ga0373954_0105364 3300035118 Bacteria 1362
210 Ga0373956_0103741 3300035119 Bacteria 1321
211 Ga0373962_0064333 3300035242 Bacteria 1084
212 Ga0373924_0069977 3300035410 Bacteria 1479
213 Ga0373931_0074268 3300035691 Bacteria 1863
214 Ga0373947_0070156 3300035725 Bacteria 2146
215 Ga0395899_0254540 3300037312 Bacteria 1203
216 Ga0395899_0365463 3300037312 Bacteria 962
217 Ga0395900_0030933 3300037418 Bacteria 5498
218 Ga0395900_0054269 3300037418 Bacteria 4126
219 Ga0395898_0004319 3300037466 Bacteria 15574
220 Ga0395898_0079013 3300037466 Bacteria 3174
221 Ga0395898_0164472 3300037466 Bacteria 2122
222 Ga0395898_0165100 3300037466 Bacteria 2118
223 Ga0395898_0221987 3300037466 Bacteria 1802
224 Ga0395898_0332600 3300037466 Bacteria 1448
225 Ga0395898_0410760 3300037466 Bacteria 1290
226 Ga0395905_0057406 3300037471 Bacteria 3641
227 Ga0395905_0135415 3300037471 Bacteria 2317
228 Ga0395905_0206880 3300037471 Bacteria 1839
229 Ga0395905_0251816 3300037471 Bacteria 1650
230 Ga0395901_0005243 3300038443 Bacteria 13086
231 Ga0395901_0008010 3300038443 Bacteria 10669
232 Ga0395901_0009859 3300038443 Bacteria 9682
233 Ga0395901_0018656 3300038443 Bacteria 7085
234 Ga0395901_0098459 3300038443 Bacteria 3066
235 Ga0395901_0589492 3300038443 Bacteria 1122
236 Ga0439436_0047782 3300041404 Bacteria 1215
237 Ga0439439_0004255 3300041406 Bacteria 3213
238 Ga0439433_0004900 3300041999 Bacteria 2876
239 Ga0439442_007351 3300042002 Bacteria 2214
240 Ga0439449_0016102 3300042007 Bacteria 2811
241 Ga0439449_0088002 3300042007 Bacteria 1146
242 Ga0439462_0012196 3300042015 Bacteria 2194
243 Ga0439446_0004066 3300042156 Bacteria 3682
244 Ga0466963_0000290 3300044694 Bacteria 22659
245 Ga0466963_0003485 3300044694 Bacteria 9024
246 Ga0466963_0008344 3300044694 Bacteria 6206
247 Ga0466963_0015736 3300044694 Bacteria 4692
248 Ga0466963_0025016 3300044694 Bacteria 3804
249 Ga0466963_0028050 3300044694 Bacteria 3611
250 Ga0466963_0132820 3300044694 Bacteria 1720
251 Ga0466963_0141142 3300044694 Bacteria 1669
252 Ga0466964_0072700 3300044706 Bacteria 1458
253 Ga0466971_0036131 3300044719 Bacteria 2216
254 Ga0466968_0008375 3300044735 Bacteria 3959
255 Ga0466957_0125482 3300044842 Bacteria 1640
256 Ga0466960_0002023 3300044901 Bacteria 7527
257 Ga0466958_0006526 3300045836 Bacteria 6358
258 Ga0466958_0017141 3300045836 Bacteria 4182
259 Ga0466958_0048893 3300045836 Bacteria 2557
260 Ga0466967_0001173 3300045976 Bacteria 14701
261 Ga0466967_0002931 3300045976 Bacteria 10891
262 Ga0466967_0003601 3300045976 Bacteria 10170
263 Ga0466967_0042805 3300045976 Bacteria 3916
264 Ga0466967_0103281 3300045976 Bacteria 2608
265 Ga0466967_0566810 3300045976 Bacteria 1118
266 Ga0495641_0008247 3300046461 Bacteria 6378
267 Ga0495651_0127941 3300046462 Bacteria 1858
268 Ga0495653_0030282 3300046463 Bacteria 4312
269 Ga0495582_0066181 3300046473 Bacteria 1996
270 Ga0495664_0068587 3300046477 Bacteria 2116
271 Ga0495664_0073970 3300046477 Bacteria 2038
272 Ga0495594_0013711 3300046499 Bacteria 4237
273 Ga0495618_0207089 3300046514 Bacteria 1240
274 Ga0495628_0208579 3300046516 Bacteria 1470
275 Ga0495628_0366093 3300046516 Bacteria 1058
276 Ga0495644_0088815 3300046523 Bacteria 1166
277 Ga0495666_0099651 3300046526 Bacteria 1369
278 Ga0495665_0123912 3300046531 Bacteria 1353
279 Ga0495640_0069077 3300046533 Bacteria 2377
280 Ga0495640_0200660 3300046533 Bacteria 1264
281 Ga0495587_0191094 3300046536 Bacteria 1159
282 Ga0495645_0054361 3300046543 Bacteria 2909
283 Ga0495667_0087562 3300046559 Bacteria 2019
284 Ga0495667_0091008 3300046559 Bacteria 1976
285 Ga0495656_0020396 3300046615 Bacteria 2570
286 Ga0495634_0062420 3300046642 Bacteria 2474
287 Ga0495635_0079594 3300046663 Bacteria 2242
288 Ga0495646_0059348 3300046680 Bacteria 2285
289 Ga0495647_0084797 3300046681 Bacteria 1290
290 Ga0495647_0092233 3300046681 Bacteria 1243
291 Ga0495613_0013369 3300046689 Bacteria 6096
292 Ga0495604_0083454 3300047317 Bacteria 2388
293 Ga0495674_0132741 3300047319 Bacteria 2097
294 Ga0495674_0225502 3300047319 Bacteria 1548
295 Ga0495676_0098470 3300047321 Bacteria 2169
296 Ga0495680_0049738 3300047322 Bacteria 3282
297 Ga0495680_0292191 3300047322 Bacteria 1146
298 Ga0495684_0030723 3300047471 Bacteria 4124
299 Ga0495614_0025867 3300048089 Bacteria 2530
300 Ga0496100_0012077 3300048903 Bacteria 4940
301 Ga0496100_0030033 3300048903 Bacteria 3367
302 Ga0496101_0000811 3300048904 Bacteria 18424
303 Ga0496101_0007646 3300048904 Bacteria 7016
304 Ga0496101_0060771 3300048904 Bacteria 2743
305 Ga0496102_0012838 3300048905 Bacteria 7250
306 Ga0496102_0055530 3300048905 Bacteria 3611
307 Ga0496102_0488167 3300048905 Bacteria 1153
308 Ga0496102_0632431 3300048905 Bacteria 993
309 Ga0496102_0656554 3300048905 Bacteria 972
310 Ga0496103_0018693 3300048906 Bacteria 4157
311 Ga0496103_0233625 3300048906 Bacteria 1183
312 Ga0496104_0002998 3300048907 Bacteria 14549
313 Ga0496104_0016128 3300048907 Bacteria 6781
314 Ga0496104_0030990 3300048907 Bacteria 4971
315 Ga0496104_0249144 3300048907 Bacteria 1689
316 Ga0496105_0019940 3300048908 Bacteria 5412
317 Ga0496105_0029327 3300048908 Bacteria 4503
318 Ga0496105_0056255 3300048908 Bacteria 3247
319 Ga0496105_0099125 3300048908 Bacteria 2406
320 Ga0496105_0331188 3300048908 Bacteria 1219
321 Ga0496106_0002649 3300048909 Bacteria 13321
322 Ga0496106_0427257 3300048909 Bacteria 1065
323 Ga0496107_0014981 3300048910 Bacteria 5430
324 Ga0496107_0026856 3300048910 Bacteria 4085
325 Ga0496107_0039847 3300048910 Bacteria 3371
326 Ga0496107_0247565 3300048910 Bacteria 1326
327 Ga0496108_0015244 3300048911 Bacteria 6272
328 Ga0496108_0034576 3300048911 Bacteria 4199
329 Ga0496108_0043149 3300048911 Bacteria 3767
330 Ga0496109_0003941 3300048912 Bacteria 12400
331 Ga0496109_0039172 3300048912 Bacteria 4288
332 Ga0496109_0045150 3300048912 Bacteria 3997
333 Ga0496109_0073032 3300048912 Bacteria 3152
334 Ga0496109_0135543 3300048912 Bacteria 2300
335 Ga0496110_0000093 3300048913 Bacteria 48032
336 Ga0496110_0027871 3300048913 Bacteria 4846
337 Ga0496110_0055276 3300048913 Bacteria 3492
338 Ga0496110_0279185 3300048913 Bacteria 1521
339 Ga0496111_0003100 3300048914 Bacteria 10224
340 Ga0496111_0005371 3300048914 Bacteria 8196
341 Ga0496111_0011602 3300048914 Bacteria 5942
342 Ga0496111_0127794 3300048914 Bacteria 1880
343 Ga0496112_0028668 3300048915 Bacteria 5376
344 Ga0496112_0064584 3300048915 Bacteria 3612
345 Ga0496112_0102078 3300048915 Bacteria 2838
346 Ga0496112_0375562 3300048915 Bacteria 1363
347 Ga0496113_0007166 3300048916 Bacteria 7144
348 Ga0496113_0030564 3300048916 Bacteria 3900
349 Ga0496113_0043586 3300048916 Bacteria 3321
350 Ga0496113_0094675 3300048916 Bacteria 2308
351 Ga0496113_0145439 3300048916 Bacteria 1867
352 Ga0496114_0039125 3300048917 Bacteria 3924
353 Ga0496114_0079346 3300048917 Bacteria 2770
354 Ga0496114_0576291 3300048917 Bacteria 993
355 Ga0496115_0018635 3300048918 Bacteria 5334
356 Ga0496115_0151698 3300048918 Bacteria 1914
357 Ga0496115_0215826 3300048918 Bacteria 1584
358 Ga0496119_0160389 3300048922 Bacteria 1196
359 Ga0501036_0010769 3300049572 Bacteria 7560
360 Ga0501039_0004666 3300049575 Bacteria 10364
361 Ga0501040_0004142 3300049576 Bacteria 9434
362 Ga0501041_0021679 3300049577 Bacteria 3849
363 Ga0501042_0032869 3300049578 Bacteria 3675
364 Ga0501046_0018389 3300049580 Bacteria 5816
365 Ga0501048_0070646 3300049582 Bacteria 2465
366 Ga0501067_0007874 3300049583 Bacteria 5921
367 Ga0501067_0022908 3300049583 Bacteria 3458
368 Ga0501067_0106658 3300049583 Bacteria 1557
369 Ga0501069_0013252 3300049585 Bacteria 4392
370 Ga0501069_0017986 3300049585 Bacteria 3811
371 Ga0501071_0219888 3300049587 Bacteria 1429
372 Ga0501072_0006387 3300049588 Bacteria 8979
373 Ga0501075_0077657 3300049591 Bacteria 2512
374 Ga0501076_0002026 3300049592 Bacteria 13863
375 Ga0501077_0048679 3300049593 Bacteria 2693
376 Ga0501079_0007200 3300049741 Bacteria 8400
377 Ga0501080_0027414 3300049742 Bacteria 5296
378 Ga0501081_0011842 3300049743 Bacteria 5713
379 Ga0501035_0180966 3300049822 Bacteria 1816
380 Ga0501045_0228975 3300049824 Bacteria 1383
381 nmdc:mga05p37_222917_c1 3300050507 Bacteria 2275
382 nmdc:mga05p37_379726_c1 3300050507 Bacteria 1656
383 nmdc:mga08y16_338738_c1 3300050511 Bacteria 1546
384 nmdc:mga0n895_114841_c1 3300050512 Bacteria 2710
385 nmdc:mga0n895_152331_c1 3300050512 Bacteria 2343
386 nmdc:mga0n895_178960_c1 3300050512 Bacteria 2152
387 nmdc:mga0n895_6961_c1 3300050512 Bacteria 9652
388 nmdc:mga0n895_82734_c1 3300050512 Bacteria 3200
389 nmdc:mga0rr50_13936_c1 3300050513 Bacteria 5253
390 nmdc:mga0rr50_174872_c1 3300050513 Bacteria 1752
391 nmdc:mga08x19_11539_c1 3300050514 Bacteria 5318
392 nmdc:mga08x19_1421_c1 3300050514 Bacteria 14790
393 nmdc:mga0a205_171200_c1 3300050515 Bacteria 2067
394 nmdc:mga0a205_17292_c1 3300050515 Bacteria 6756
395 Ga0495601_0046687 3300053077 Bacteria 2726
396 Ga0495601_0144069 3300053077 Bacteria 1555
397 Ga0495601_0222705 3300053077 Bacteria 1232
398 Ga0495612_0037152 3300053078 Bacteria 1978
399 Ga0495612_0100643 3300053078 Bacteria 1230
400 Ga0495595_0118284 3300053084 Bacteria 1289
401 Ga0501084_0003836 3300054114 Bacteria 12232
402 Ga0501082_0013581 3300060353 Bacteria 6997
403 Ga0466962_0050643 3300061719 Bacteria 1985
404 Ga0530510_0008822 3300061734 Bacteria 7055
405 Ga0530510_0037052 3300061734 Bacteria 3515
406 2558910243 2558860112 Bacteria 9931328
407 2687583669 2687453130 Bacteria 4227172
408 2873317325 2873314349 Bacteria 8512634
409 nmdc:mga0n895_2856_c1
410 Ga0070658_10005869
411 Ga0070683_100004938
412 Ga0070683_100200721
413 Ga0070683_100304383
414 Ga0070690_100094808
415 Ga0070680_100045165
416 Ga0070680_100182310
417 Ga0070682_100103300
418 Ga0068868_100356127
419 Ga0070660_100016735
420 Ga0070660_100054109
421 Ga0070691_10072341
422 Ga0070692_10123449
423 Ga0070709_10319702
424 Ga0070714_100012756
425 Ga0070714_100023308
426 Ga0070714_100178334
427 Ga0070714_100262216
428 Ga0070714_100284921
429 Ga0070714_100402745
430 Ga0070713_100385490
431 Ga0070711_100011580
432 Ga0070711_100238947
433 Ga0070711_100244848
434 Ga0070708_100001234
435 Ga0070681_10006166
436 Ga0070681_10059914
437 Ga0070681_10080757
438 Ga0070681_10191934
439 Ga0070685_10108749
440 Ga0070706_100002363
441 Ga0070706_100029550
442 Ga0070706_100290549
443 Ga0070707_100000043
444 Ga0070707_100002621
445 Ga0070707_100020775
446 Ga0070707_100505130
447 Ga0070698_100000072
448 Ga0070698_100000309
449 Ga0070698_100005619
450 Ga0070699_100305777
451 Ga0070679_100001190
452 Ga0070679_100049189
453 Ga0070679_100074239
454 Ga0070684_100002475
455 Ga0070684_100003183
456 Ga0070684_100121492
457 Ga0070684_100402302
458 Ga0070697_100016026
459 Ga0070695_100093341
460 Ga0070693_100005640
461 Ga0070693_100020404
462 Ga0070704_100064322
463 Ga0068855_100023031
464 Ga0068855_100039391
465 Ga0070664_100072495
466 Ga0068856_100003599
467 Ga0068856_100204699
468 Ga0068856_100250961
469 Ga0068856_100353783
470 Ga0070702_100028663
471 Ga0068852_100111659
472 Ga0068852_100593273
473 Ga0068858_100204552
474 Ga0081455_10001517
475 Ga0081455_10010420
476 Ga0081455_10032791
477 Ga0081538_10106468
478 Ga0070717_10060745
479 Ga0070717_10550690
480 Ga0070716_100136657
481 Ga0070712_100058783
482 Ga0070712_100286924
483 Ga0075428_100015994
484 Ga0075428_100199059
485 Ga0075431_100023965
486 Ga0075431_100346466
487 Ga0075433_10077482
488 Ga0075433_10113083
489 Ga0075433_10572780
490 Ga0075434_100008246
491 Ga0075434_100038806
492 Ga0075434_100173178
493 Ga0075434_100264771
494 Ga0075436_100009473
495 Ga0075436_100035774
496 Ga0075435_100003560
497 Ga0075435_100019029
498 Ga0105240_10012796
499 Ga0105240_10029982
500 Ga0105240_10062922
501 Ga0105245_10105711
502 Ga0105245_10110481
503 Ga0105247_10020240
504 Ga0114129_10558838
505 Ga0105243_10148192
506 Ga0105241_10085371
507 Ga0105237_10033363
508 Ga0105237_10262427
509 Ga0105238_10014693
510 Ga0105238_10520830
511 Ga0105238_10890909
512 Ga0105239_10157363
513 Ga0105239_10315054
514 Ga0105246_10010988
515 Ga0105246_10133835
516 Ga0105246_10480144
517 Ga0157371_10095744
518 Ga0157370_10055467
519 Ga0157369_10001378
520 Ga0157369_10005496
521 Ga0157369_10084680
522 Ga0157369_10320181
523 Ga0157369_10486127
524 Ga0157369_10629319
525 Ga0157369_10659133
526 Ga0157374_10037102
527 Ga0157374_10078022
528 Ga0157372_10018773
529 Ga0157372_10057080
530 Ga0157372_10066345
531 Ga0157375_10089496
532 Ga0163163_10034691
533 Ga0182008_10003115
534 Ga0182008_10038327
535 Ga0182008_10245407
536 Ga0157377_10025049
537 Ga0157379_10172835
538 Ga0157379_10473390
539 Ga0197907_10553923
540 Ga0206356_11301837
541 Ga0206354_11320388
542 Ga0206353_10560634
543 Ga0224712_10035883
544 Ga0207692_10085682
545 Ga0207688_10019053
546 Ga0207688_10110873
547 Ga0207685_10178924
548 Ga0207699_10137655
549 Ga0207699_10197904
550 Ga0207705_10106778
551 Ga0207684_10040691
552 Ga0207684_10043532
553 Ga0207684_10254205
554 Ga0207654_10135493
555 Ga0207707_10019870
556 Ga0207707_10156760
557 Ga0207707_10217267
558 Ga0207695_10054984
559 Ga0207695_10177696
560 Ga0207695_10192166
561 Ga0207671_10122583
562 Ga0207671_10152941
563 Ga0207693_10041124
564 Ga0207693_10060979
565 Ga0207693_10070940
566 Ga0207660_10031904
567 Ga0207660_10047652
568 Ga0207662_10018290
569 Ga0207657_10003088
570 Ga0207657_10276396
571 Ga0207649_10225882
572 Ga0207649_10253944
573 Ga0207652_10006583
574 Ga0207652_10080163
575 Ga0207646_10000300
576 Ga0207646_10000647
577 Ga0207646_10211627
578 Ga0207694_10432660
579 Ga0207687_10010512
580 Ga0207687_10069491
581 Ga0207700_10091149
582 Ga0207664_10031730
583 Ga0207664_10090555
584 Ga0207664_10244761
585 Ga0207664_10374919
586 Ga0207690_10032932
587 Ga0207686_10107352
588 Ga0207686_10352778
589 Ga0207665_10064506
590 Ga0207661_10053511
591 Ga0207661_10151928
592 Ga0207679_10121835
593 Ga0207679_10313679
594 Ga0207667_10071005
595 Ga0207667_10098290
596 Ga0207667_10213533
597 Ga0207712_10140698
598 Ga0207640_10072276
599 Ga0207640_10134144
600 Ga0207639_10638694
601 Ga0207678_10170774
602 Ga0207702_10002784
603 Ga0207702_10009134
604 Ga0207702_10036928
605 Ga0207702_10194280
606 Ga0207702_10208124
607 Ga0207702_10357431
608 Ga0207676_10390486
609 Ga0207683_10074153
610 Ga0207698_10082504
611 Ga0207698_10376069
612 Ga0268265_10584978
613 Ga0307416_100556161
614 Ga0307415_100054411
615 Ga0373944_0022256
616 Ga0373945_0025154
617 Ga0373954_0105364
618 Ga0373956_0103741
619 Ga0373962_0064333
620 Ga0373924_0069977
621 Ga0373931_0074268
622 Ga0373947_0070156
623 Ga0395899_0254540
624 Ga0395899_0365463
625 Ga0395900_0030933
626 Ga0395900_0054269
627 Ga0395898_0004319
628 Ga0395898_0079013
629 Ga0395898_0164472
630 Ga0395898_0165100
631 Ga0395898_0221987
632 Ga0395898_0332600
633 Ga0395898_0410760
634 Ga0395905_0057406
635 Ga0395905_0135415
636 Ga0395905_0206880
637 Ga0395905_0251816
638 Ga0395901_0005243
639 Ga0395901_0008010
640 Ga0395901_0009859
641 Ga0395901_0018656
642 Ga0395901_0098459
643 Ga0395901_0589492
644 Ga0439436_0047782
645 Ga0439439_0004255
646 Ga0439433_0004900
647 Ga0439442_007351
648 Ga0439449_0016102
649 Ga0439449_0088002
650 Ga0439462_0012196
651 Ga0439446_0004066
652 Ga0466963_0000290
653 Ga0466963_0003485
654 Ga0466963_0008344
655 Ga0466963_0015736
656 Ga0466963_0025016
657 Ga0466963_0028050
658 Ga0466963_0132820
659 Ga0466963_0141142
660 Ga0466964_0072700
661 Ga0466971_0036131
662 Ga0466968_0008375
663 Ga0466957_0125482
664 Ga0466960_0002023
665 Ga0466958_0006526
666 Ga0466958_0017141
667 Ga0466958_0048893
668 Ga0466967_0001173
669 Ga0466967_0002931
670 Ga0466967_0003601
671 Ga0466967_0042805
672 Ga0466967_0103281
673 Ga0466967_0566810
674 Ga0495641_0008247
675 Ga0495651_0127941
676 Ga0495653_0030282
677 Ga0495582_0066181
678 Ga0495664_0068587
679 Ga0495664_0073970
680 Ga0495594_0013711
681 Ga0495618_0207089
682 Ga0495628_0208579
683 Ga0495628_0366093
684 Ga0495644_0088815
685 Ga0495666_0099651
686 Ga0495665_0123912
687 Ga0495640_0069077
688 Ga0495640_0200660
689 Ga0495587_0191094
690 Ga0495645_0054361
691 Ga0495667_0087562
692 Ga0495667_0091008
693 Ga0495656_0020396
694 Ga0495634_0062420
695 Ga0495635_0079594
696 Ga0495646_0059348
697 Ga0495647_0084797
698 Ga0495647_0092233
699 Ga0495613_0013369
700 Ga0495604_0083454
701 Ga0495674_0132741
702 Ga0495674_0225502
703 Ga0495676_0098470
704 Ga0495680_0049738
705 Ga0495680_0292191
706 Ga0495684_0030723
707 Ga0495614_0025867
708 Ga0496100_0012077
709 Ga0496100_0030033
710 Ga0496101_0000811
711 Ga0496101_0007646
712 Ga0496101_0060771
713 Ga0496102_0012838
714 Ga0496102_0055530
715 Ga0496102_0488167
716 Ga0496102_0632431
717 Ga0496102_0656554
718 Ga0496103_0018693
719 Ga0496103_0233625
720 Ga0496104_0002998
721 Ga0496104_0016128
722 Ga0496104_0030990
723 Ga0496104_0249144
724 Ga0496105_0019940
725 Ga0496105_0029327
726 Ga0496105_0056255
727 Ga0496105_0099125
728 Ga0496105_0331188
729 Ga0496106_0002649
730 Ga0496106_0427257
731 Ga0496107_0014981
732 Ga0496107_0026856
733 Ga0496107_0039847
734 Ga0496107_0247565
735 Ga0496108_0015244
736 Ga0496108_0034576
737 Ga0496108_0043149
738 Ga0496109_0003941
739 Ga0496109_0039172
740 Ga0496109_0045150
741 Ga0496109_0073032
742 Ga0496109_0135543
743 Ga0496110_0000093
744 Ga0496110_0027871
745 Ga0496110_0055276
746 Ga0496110_0279185
747 Ga0496111_0003100
748 Ga0496111_0005371
749 Ga0496111_0011602
750 Ga0496111_0127794
751 Ga0496112_0028668
752 Ga0496112_0064584
753 Ga0496112_0102078
754 Ga0496112_0375562
755 Ga0496113_0007166
756 Ga0496113_0030564
757 Ga0496113_0043586
758 Ga0496113_0094675
759 Ga0496113_0145439
760 Ga0496114_0039125
761 Ga0496114_0079346
762 Ga0496114_0576291
763 Ga0496115_0018635
764 Ga0496115_0151698
765 Ga0496115_0215826
766 Ga0496119_0160389
767 Ga0501036_0010769
768 Ga0501039_0004666
769 Ga0501040_0004142
770 Ga0501041_0021679
771 Ga0501042_0032869
772 Ga0501046_0018389
773 Ga0501048_0070646
774 Ga0501067_0007874
775 Ga0501067_0022908
776 Ga0501067_0106658
777 Ga0501069_0013252
778 Ga0501069_0017986
779 Ga0501071_0219888
780 Ga0501072_0006387
781 Ga0501075_0077657
782 Ga0501076_0002026
783 Ga0501077_0048679
784 Ga0501079_0007200
785 Ga0501080_0027414
786 Ga0501081_0011842
787 Ga0501035_0180966
788 Ga0501045_0228975
789 nmdc:mga05p37_222917_c1
790 nmdc:mga05p37_379726_c1
791 nmdc:mga08y16_338738_c1
792 nmdc:mga0n895_114841_c1
793 nmdc:mga0n895_152331_c1
794 nmdc:mga0n895_178960_c1
795 nmdc:mga0n895_6961_c1
796 nmdc:mga0n895_82734_c1
797 nmdc:mga0rr50_13936_c1
798 nmdc:mga0rr50_174872_c1
799 nmdc:mga08x19_11539_c1
800 nmdc:mga08x19_1421_c1
801 nmdc:mga0a205_171200_c1
802 nmdc:mga0a205_17292_c1
803 Ga0495601_0046687
804 Ga0495601_0144069
805 Ga0495601_0222705
806 Ga0495612_0037152
807 Ga0495612_0100643
808 Ga0495595_0118284
809 Ga0501084_0003836
810 Ga0501082_0013581
811 Ga0466962_0050643
812 Ga0530510_0008822
813 Ga0530510_0037052
814 2558910243
815 2687583669
816 2873317325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

29

249

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mzx-assembly1.cif.gz_C crystal structure of the decarboxylase aiba/aibb in complex with 4'-diphospho pantetheine 0.9018 2 263
1poi-assembly1.cif.gz_A crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution 0.8998 2 265
1poi-assembly1.cif.gz_A crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution 0.8867 2 265
6con-assembly2.cif.gz_G crystal structure of mycobacterium tuberculosis ipdab 0.8824 2 264
5mzx-assembly1.cif.gz_C crystal structure of the decarboxylase aiba/aibb in complex with 4'-diphospho pantetheine 0.8726 2 263
ID Description Score Start End Superfamily
1poiA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8816 2 265 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8488 1 220 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8409 2 220 3.40.1080.10
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8369 2 221 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8305 1 222 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A1X2KGS1-F1-model_v4 3-oxoadipate--succinyl-CoA transferase subunit A 0.9899 160 240 GO:0008410
AF-A0A7C3QNR2-F1-model_v4 CoA transferase subunit A 0.988 1 68 GO:0016020
GO:0016740
AF-A0A429IFB1-F1-model_v4 3-oxoadipate--succinyl-CoA transferase subunit A 0.9879 148 266 GO:0008410
AF-A0A5M3XL13-F1-model_v4 3-oxoadipate--succinyl-CoA transferase subunit A 0.985 1 265 GO:0008410
AF-A0A561W4S8-F1-model_v4 Glutaconate CoA-transferase subunit A 0.9845 1 264 GO:0008410

Map