F436779

General Info

Members Datasets Scaffolds Average Seq Length
408 197 816 236

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1823474|Ga0436365_1823474_77_790
Length 231
Sequence MSTSTTAITSSSPYTTPAFWERLWRTSGIQFVGLFILAYLIYGYQPPVGASADDLVAFYDGHRTRILIATVISGLNLLNLMWFAAALRTTLANAGQDGWGAAATGALFLLHITLLAALAYSIAGAANHVLTSALNDFTWSLLVLTSFPRAMLIMSGAFGLWRAGLISNALFGAGVAAVVLAVLGGTTWVSGGIWAPDGAYTRFVSPLLLLVWAVVVSRVLLTRAPTTRAAW

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
173 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.15
Rhizosphere 93.38
Stem 0
Stem Tuber 0
Unclassified 17.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1823474 3300039437 Bacteria 1183
2 MBSR1b_contig_8321982 2162886012 Bacteria 2496
3 JGI24752J21851_1015819 3300001976 Unclassified 983
4 JGI24743J22301_10012400 3300001991 Unclassified 1550
5 Ga0065712_10074284 3300005290 Bacteria 4136
6 Ga0065715_10010158 3300005293 Bacteria 3094
7 Ga0065715_10090983 3300005293 Bacteria 6247
8 Ga0065715_10439890 3300005293 Bacteria 821
9 Ga0070658_10617013 3300005327 Unclassified 940
10 Ga0070676_10009945 3300005328 Bacteria 5148
11 Ga0070676_10013309 3300005328 Viruses 4508
12 Ga0070683_100012220 3300005329 Bacteria 7455
13 Ga0070690_100012835 3300005330 Unclassified 4936
14 Ga0070670_100017662 3300005331 Bacteria 6121
15 Ga0070670_100089678 3300005331 Unclassified 2643
16 Ga0068869_100009650 3300005334 Bacteria 6268
17 Ga0068869_100150675 3300005334 Bacteria 1804
18 Ga0070682_100001834 3300005337 Bacteria 11841
19 Ga0068868_100049211 3300005338 Bacteria 3308
20 Ga0068868_100370414 3300005338 Unclassified 1231
21 Ga0070660_100038349 3300005339 Bacteria 3638
22 Ga0070689_100010215 3300005340 Bacteria 6687
23 Ga0070689_100073970 3300005340 Bacteria 2666
24 Ga0070689_100097601 3300005340 Unclassified 2324
25 Ga0070687_100010029 3300005343 Unclassified 4078
26 Ga0070661_100004345 3300005344 Bacteria 9780
27 Ga0070661_100009136 3300005344 Bacteria 6852
28 Ga0070661_100146931 3300005344 Bacteria 1780
29 Ga0070692_10120498 3300005345 Unclassified 1462
30 Ga0070668_100010415 3300005347 Bacteria 6908
31 Ga0070668_100022087 3300005347 Unclassified 4810
32 Ga0070669_100005165 3300005353 Bacteria 9445
33 Ga0070669_100191765 3300005353 Bacteria 1603
34 Ga0070669_100254581 3300005353 Bacteria 1399
35 Ga0070675_100003559 3300005354 Bacteria 11833
36 Ga0070675_100018091 3300005354 Bacteria 5608
37 Ga0070674_100008272 3300005356 Bacteria 6186
38 Ga0070674_100016529 3300005356 Bacteria 4626
39 Ga0070673_100008152 3300005364 Bacteria 6951
40 Ga0070688_100010773 3300005365 Bacteria 5053
41 Ga0070659_100013608 3300005366 Bacteria 6061
42 Ga0070667_100627311 3300005367 Bacteria 991
43 Ga0070709_10213086 3300005434 Bacteria 1374
44 Ga0070714_100532052 3300005435 Unclassified 1123
45 Ga0070714_100595363 3300005435 Bacteria 1061
46 Ga0070711_100448159 3300005439 Bacteria 1056
47 Ga0070705_100036057 3300005440 Bacteria 2777
48 Ga0070700_100089476 3300005441 Unclassified 2006
49 Ga0070700_100105922 3300005441 Bacteria 1860
50 Ga0070694_100158140 3300005444 Bacteria 1660
51 Ga0070708_100002465 3300005445 Bacteria 14307
52 Ga0070708_100012697 3300005445 Bacteria 6879
53 Ga0070708_100073875 3300005445 Bacteria 3074
54 Ga0070708_100116017 3300005445 Bacteria 2465
55 Ga0070708_100359413 3300005445 Bacteria 1372
56 Ga0070708_100386114 3300005445 Bacteria 1320
57 Ga0070708_100663267 3300005445 Bacteria 983
58 Ga0070663_100011097 3300005455 Bacteria 5641
59 Ga0070663_100424324 3300005455 Bacteria 1091
60 Ga0070678_100243646 3300005456 Bacteria 1504
61 Ga0070678_100360012 3300005456 Bacteria 1253
62 Ga0070662_100000224 3300005457 Bacteria 33436
63 Ga0070662_100000346 3300005457 Bacteria 27732
64 Ga0070662_100022078 3300005457 Bacteria 4352
65 Ga0070662_100055089 3300005457 Bacteria 2884
66 Ga0070681_10014612 3300005458 Bacteria 7814
67 Ga0070681_10053405 3300005458 Bacteria 4027
68 Ga0068867_100017140 3300005459 Bacteria 5146
69 Ga0070685_10021109 3300005466 Bacteria 3536
70 Ga0070706_100069276 3300005467 Bacteria 3263
71 Ga0070706_100089213 3300005467 Bacteria 2859
72 Ga0070706_100116798 3300005467 Bacteria 2485
73 Ga0070706_100417113 3300005467 Unclassified 1249
74 Ga0070706_100801323 3300005467 Bacteria 872
75 Ga0070707_100005821 3300005468 Bacteria 11498
76 Ga0070707_100046518 3300005468 Bacteria 4153
77 Ga0070707_100327522 3300005468 Bacteria 1488
78 Ga0070707_100437478 3300005468 Bacteria 1268
79 Ga0070698_100029612 3300005471 Bacteria 5685
80 Ga0070698_100137283 3300005471 Bacteria 2399
81 Ga0070698_100273085 3300005471 Bacteria 1622
82 Ga0070699_100001714 3300005518 Bacteria 19979
83 Ga0070699_100205215 3300005518 Bacteria 1753
84 Ga0070684_100009922 3300005535 Bacteria 7526
85 Ga0070684_100061419 3300005535 Unclassified 3289
86 Ga0070697_100145668 3300005536 Bacteria 1993
87 Ga0070697_100178119 3300005536 Unclassified 1801
88 Ga0070697_100399953 3300005536 Bacteria 1192
89 Ga0068853_100116483 3300005539 Unclassified 2379
90 Ga0068853_100196173 3300005539 Bacteria 1836
91 Ga0068853_100348486 3300005539 Bacteria 1377
92 Ga0068853_100398373 3300005539 Bacteria 1288
93 Ga0068853_100399449 3300005539 Bacteria 1286
94 Ga0070672_100026947 3300005543 Viruses 4284
95 Ga0070672_100310549 3300005543 Bacteria 1338
96 Ga0070686_100102066 3300005544 Bacteria 1939
97 Ga0070695_100002324 3300005545 Bacteria 10909
98 Ga0070695_100056890 3300005545 Bacteria 2525
99 Ga0070665_100136065 3300005548 Bacteria 2460
100 Ga0070665_100610037 3300005548 Bacteria 1104
101 Ga0068855_100003148 3300005563 Bacteria 20186
102 Ga0068855_100008312 3300005563 Bacteria 12543
103 Ga0068855_100045772 3300005563 Bacteria 5173
104 Ga0068855_100218454 3300005563 Unclassified 2139
105 Ga0070664_100016861 3300005564 Bacteria 5996
106 Ga0070664_100035630 3300005564 Bacteria 4177
107 Ga0070664_100164781 3300005564 Unclassified 1963
108 Ga0068857_100013951 3300005577 Bacteria 6992
109 Ga0068857_100018586 3300005577 Bacteria 6098
110 Ga0068857_100057014 3300005577 Bacteria 3467
111 Ga0068857_100179260 3300005577 Unclassified 1928
112 Ga0068854_100064793 3300005578 Bacteria 2655
113 Ga0068859_100036984 3300005617 Bacteria 4900
114 Ga0068859_100309901 3300005617 Bacteria 1672
115 Ga0068859_100443737 3300005617 Bacteria 1394
116 Ga0068864_100024757 3300005618 Bacteria 5050
117 Ga0068864_100060566 3300005618 Bacteria 3277
118 Ga0068866_10005065 3300005718 Bacteria 5428
119 Ga0068861_100031536 3300005719 Bacteria 3894
120 Ga0068861_100113110 3300005719 Bacteria 2177
121 Ga0068861_100483512 3300005719 Bacteria 1116
122 Ga0068851_10050580 3300005834 Bacteria 2110
123 Ga0068870_10003268 3300005840 Bacteria 6845
124 Ga0068870_10128849 3300005840 Bacteria 1467
125 Ga0068863_100014559 3300005841 Bacteria 7572
126 Ga0068863_100030303 3300005841 Bacteria 5167
127 Ga0068863_100142506 3300005841 Bacteria 2291
128 Ga0068863_100216634 3300005841 Bacteria 1844
129 Ga0068863_100251419 3300005841 Bacteria 1707
130 Ga0068858_100091338 3300005842 Bacteria 2834
131 Ga0068858_100146299 3300005842 Bacteria 2219
132 Ga0068858_100153529 3300005842 Bacteria 2166
133 Ga0068860_100027399 3300005843 Bacteria 5489
134 Ga0068862_100000841 3300005844 Bacteria 30209
135 Ga0068862_100019998 3300005844 Bacteria 5589
136 Ga0070717_10215415 3300006028 Unclassified 1686
137 Ga0070712_100273168 3300006175 Bacteria 1359
138 Ga0097621_100007861 3300006237 Bacteria 7648
139 Ga0075428_100008215 3300006844 Bacteria 11578
140 Ga0075428_100017292 3300006844 Bacteria 7969
141 Ga0075428_100045024 3300006844 Bacteria 4849
142 Ga0075428_100270137 3300006844 Bacteria 1830
143 Ga0075430_100000382 3300006846 Bacteria 32598
144 Ga0075431_100000509 3300006847 Bacteria 32501
145 Ga0075431_100124406 3300006847 Bacteria 2661
146 Ga0075433_10081066 3300006852 Bacteria 2861
147 Ga0075433_10090256 3300006852 Bacteria 2708
148 Ga0075433_10168720 3300006852 Unclassified 1948
149 Ga0075433_10364204 3300006852 Bacteria 1277
150 Ga0075434_100117026 3300006871 Bacteria 2678
151 Ga0075434_100151201 3300006871 Unclassified 2342
152 Ga0075434_100210864 3300006871 Bacteria 1963
153 Ga0075429_100295517 3300006880 Bacteria 1418
154 Ga0068865_100144618 3300006881 Unclassified 1797
155 Ga0075436_100535864 3300006914 Bacteria 859
156 Ga0097620_100036986 3300006931 Bacteria 4900
157 Ga0097620_100309891 3300006931 Bacteria 1672
158 Ga0097620_100443721 3300006931 Bacteria 1394
159 Ga0075435_100341169 3300007076 Unclassified 1284
160 Ga0099794_10166912 3300007265 Unclassified 1121
161 Ga0099794_10242994 3300007265 Unclassified 928
162 Ga0105240_10050942 3300009093 Bacteria 5214
163 Ga0111539_10550631 3300009094 Bacteria 1344
164 Ga0111539_10861734 3300009094 Unclassified 1054
165 Ga0105245_10157101 3300009098 Bacteria 2155
166 Ga0105245_10189644 3300009098 Bacteria 1968
167 Ga0105245_10752722 3300009098 Bacteria 1010
168 Ga0105247_10011585 3300009101 Bacteria 5311
169 Ga0114129_10010795 3300009147 Bacteria 13011
170 Ga0114129_10040906 3300009147 Bacteria 6532
171 Ga0114129_10073250 3300009147 Bacteria 4771
172 Ga0114129_10113949 3300009147 Bacteria 3728
173 Ga0114129_10122854 3300009147 Bacteria 3572
174 Ga0114129_10321438 3300009147 Bacteria 2057
175 Ga0114129_10487480 3300009147 Unclassified 1612
176 Ga0114129_10561340 3300009147 Unclassified 1483
177 Ga0105243_10624185 3300009148 Bacteria 1041
178 Ga0105243_10819303 3300009148 Unclassified 919
179 Ga0105241_10013058 3300009174 Bacteria 6090
180 Ga0105242_10081903 3300009176 Bacteria 2700
181 Ga0105242_10606391 3300009176 Bacteria 1058
182 Ga0105248_10003307 3300009177 Bacteria 17889
183 Ga0105248_10467547 3300009177 Unclassified 1422
184 Ga0105248_10755441 3300009177 Bacteria 1097
185 Ga0105237_10102323 3300009545 Unclassified 2856
186 Ga0105237_10708883 3300009545 Bacteria 1013
187 Ga0105238_10773442 3300009551 Bacteria 975
188 Ga0105249_10003626 3300009553 Bacteria 13349
189 Ga0105249_10017579 3300009553 Bacteria 6349
190 Ga0105249_10027948 3300009553 Bacteria 5091
191 Ga0105249_10034798 3300009553 Bacteria 4566
192 Ga0105249_10159505 3300009553 Bacteria 2178
193 Ga0105249_10207764 3300009553 Unclassified 1919
194 Ga0099796_10004715 3300010159 Plasmid 3330
195 Ga0099796_10110188 3300010159 Bacteria 1047
196 Ga0105239_10045354 3300010375 Bacteria 4817
197 Ga0105239_10055658 3300010375 Bacteria 4339
198 Ga0105239_10268852 3300010375 Bacteria 1917
199 Ga0105246_10003806 3300011119 Bacteria 9144
200 Ga0157373_10111873 3300013100 Bacteria 1920
201 Ga0157371_10039726 3300013102 Unclassified 3364
202 Ga0157371_10079562 3300013102 Bacteria 2322
203 Ga0157369_10040986 3300013105 Bacteria 5054
204 Ga0157374_10177186 3300013296 Unclassified 2081
205 Ga0157378_10138767 3300013297 Bacteria 2256
206 Ga0157378_10610211 3300013297 Unclassified 1103
207 Ga0163162_10004413 3300013306 Bacteria 13541
208 Ga0163162_10121029 3300013306 Unclassified 2722
209 Ga0157372_10005183 3300013307 Bacteria 13862
210 Ga0157372_10014366 3300013307 Bacteria 8467
211 Ga0157372_10067598 3300013307 Bacteria 4016
212 Ga0157372_10316564 3300013307 Bacteria 1817
213 Ga0157375_10019898 3300013308 Bacteria 6120
214 Ga0157375_10047698 3300013308 Bacteria 4185
215 Ga0157375_10561995 3300013308 Bacteria 1302
216 Ga0163163_10022087 3300014325 Bacteria 6019
217 Ga0163163_10060712 3300014325 Bacteria 3744
218 Ga0157380_10023400 3300014326 Bacteria 4660
219 Ga0157380_10425515 3300014326 Unclassified 1268
220 Ga0157377_10003727 3300014745 Bacteria 6919
221 Ga0157379_10287053 3300014968 Bacteria 1498
222 Ga0157379_10563126 3300014968 Bacteria 1061
223 Ga0157376_10102089 3300014969 Bacteria 2508
224 Ga0163161_10004335 3300017792 Bacteria 9888
225 Ga0163161_10081236 3300017792 Bacteria 2387
226 Ga0163161_10373457 3300017792 Bacteria 1138
227 Ga0213875_10078624 3300021388 Unclassified 1539
228 Ga0207697_10048882 3300025315 Bacteria 1746
229 Ga0207697_10074263 3300025315 Bacteria 1428
230 Ga0207656_10002265 3300025321 Bacteria 6447
231 Ga0207653_10008484 3300025885 Bacteria 3202
232 Ga0207642_10068201 3300025899 Bacteria 1682
233 Ga0207710_10126898 3300025900 Unclassified 1223
234 Ga0207688_10050937 3300025901 Unclassified 2319
235 Ga0207699_10014089 3300025906 Bacteria 4110
236 Ga0207699_10273496 3300025906 Bacteria 1171
237 Ga0207645_10012484 3300025907 Bacteria 5761
238 Ga0207645_10047087 3300025907 Bacteria 2754
239 Ga0207643_10006038 3300025908 Bacteria 6475
240 Ga0207705_10245881 3300025909 Bacteria 1363
241 Ga0207684_10003596 3300025910 Bacteria 15085
242 Ga0207684_10107082 3300025910 Bacteria 2392
243 Ga0207684_10118779 3300025910 Bacteria 2266
244 Ga0207684_10306849 3300025910 Bacteria 1368
245 Ga0207684_10673222 3300025910 Bacteria 881
246 Ga0207707_10022408 3300025912 Bacteria 5521
247 Ga0207707_10385754 3300025912 Unclassified 1204
248 Ga0207695_10066059 3300025913 Bacteria 3717
249 Ga0207671_10136325 3300025914 Bacteria 1887
250 Ga0207662_10167092 3300025918 Unclassified 1409
251 Ga0207657_10007532 3300025919 Bacteria 11155
252 Ga0207657_10299426 3300025919 Bacteria 1274
253 Ga0207649_10002275 3300025920 Bacteria 10801
254 Ga0207649_10492488 3300025920 Bacteria 931
255 Ga0207649_10517502 3300025920 Unclassified 909
256 Ga0207646_10003721 3300025922 Bacteria 17014
257 Ga0207646_10032937 3300025922 Bacteria 4687
258 Ga0207646_10072545 3300025922 Bacteria 3075
259 Ga0207646_10105889 3300025922 Bacteria 2522
260 Ga0207681_10002162 3300025923 Bacteria 12527
261 Ga0207681_10124450 3300025923 Bacteria 1896
262 Ga0207681_10561146 3300025923 Unclassified 940
263 Ga0207650_10008111 3300025925 Bacteria 7159
264 Ga0207687_10231932 3300025927 Bacteria 1458
265 Ga0207700_10011240 3300025928 Bacteria 5699
266 Ga0207700_10876177 3300025928 Bacteria 803
267 Ga0207644_10449435 3300025931 Unclassified 1058
268 Ga0207690_10226046 3300025932 Unclassified 1434
269 Ga0207706_10000099 3300025933 Bacteria 90874
270 Ga0207706_10000259 3300025933 Bacteria 57912
271 Ga0207706_10006391 3300025933 Bacteria 10946
272 Ga0207706_10024936 3300025933 Bacteria 5361
273 Ga0207686_10023499 3300025934 Bacteria 3562
274 Ga0207686_10082815 3300025934 Bacteria 2098
275 Ga0207670_10110162 3300025936 Bacteria 1983
276 Ga0207670_10439613 3300025936 Bacteria 1050
277 Ga0207669_10246788 3300025937 Bacteria 1327
278 Ga0207704_10084657 3300025938 Unclassified 2061
279 Ga0207704_10108760 3300025938 Bacteria 1868
280 Ga0207665_10091609 3300025939 Bacteria 2108
281 Ga0207691_10015684 3300025940 Bacteria 7202
282 Ga0207691_10033224 3300025940 Bacteria 4803
283 Ga0207691_10040807 3300025940 Viruses 4288
284 Ga0207711_10007200 3300025941 Bacteria 9323
285 Ga0207711_10008397 3300025941 Bacteria 8640
286 Ga0207711_10331063 3300025941 Bacteria 1408
287 Ga0207689_10013644 3300025942 Bacteria 6928
288 Ga0207689_10201257 3300025942 Bacteria 1644
289 Ga0207661_10004501 3300025944 Bacteria 9771
290 Ga0207679_10007352 3300025945 Bacteria 6984
291 Ga0207679_10044074 3300025945 Unclassified 3217
292 Ga0207679_10071421 3300025945 Bacteria 2618
293 Ga0207679_10401757 3300025945 Unclassified 1205
294 Ga0207667_10008510 3300025949 Bacteria 12184
295 Ga0207667_10179207 3300025949 Archaea 2176
296 Ga0207651_10009522 3300025960 Bacteria 5327
297 Ga0207712_10012271 3300025961 Bacteria 5474
298 Ga0207712_10020194 3300025961 Bacteria 4361
299 Ga0207712_10039630 3300025961 Unclassified 3229
300 Ga0207712_10229605 3300025961 Unclassified 1489
301 Ga0207668_10002391 3300025972 Bacteria 10971
302 Ga0207668_10278263 3300025972 Unclassified 1371
303 Ga0207668_10427499 3300025972 Unclassified 1125
304 Ga0207668_10652733 3300025972 Unclassified 921
305 Ga0207640_10420013 3300025981 Unclassified 1094
306 Ga0207677_10036264 3300026023 Bacteria 3212
307 Ga0207677_10836153 3300026023 Bacteria 826
308 Ga0207703_10074729 3300026035 Bacteria 2807
309 Ga0207703_10082982 3300026035 Bacteria 2676
310 Ga0207703_10141901 3300026035 Bacteria 2086
311 Ga0207639_10087832 3300026041 Bacteria 2479
312 Ga0207639_10235597 3300026041 Bacteria 1589
313 Ga0207639_10419785 3300026041 Bacteria 1209
314 Ga0207639_10498366 3300026041 Bacteria 1112
315 Ga0207678_10014070 3300026067 Bacteria 7036
316 Ga0207678_10208964 3300026067 Bacteria 1670
317 Ga0207708_10087040 3300026075 Bacteria 2405
318 Ga0207708_10143225 3300026075 Unclassified 1877
319 Ga0207641_10000203 3300026088 Bacteria 79544
320 Ga0207641_10079072 3300026088 Bacteria 2850
321 Ga0207641_10444703 3300026088 Unclassified 1252
322 Ga0207648_10028567 3300026089 Unclassified 4944
323 Ga0207676_10001181 3300026095 Bacteria 19575
324 Ga0207676_10007869 3300026095 Bacteria 7580
325 Ga0207674_10001648 3300026116 Bacteria 28724
326 Ga0207674_10021604 3300026116 Bacteria 6928
327 Ga0207674_10204373 3300026116 Bacteria 1925
328 Ga0207675_100011784 3300026118 Bacteria 8174
329 Ga0207675_100015714 3300026118 Bacteria 7060
330 Ga0207675_100045770 3300026118 Bacteria 4087
331 Ga0207675_100052754 3300026118 Bacteria 3794
332 Ga0207683_10282189 3300026121 Bacteria 1518
333 Ga0207683_10421918 3300026121 Bacteria 1229
334 Ga0268266_10024068 3300028379 Bacteria 5182
335 Ga0268265_10010871 3300028380 Bacteria 6147
336 Ga0268265_10199393 3300028380 Bacteria 1735
337 Ga0307408_100008078 3300031548 Bacteria 6956
338 Ga0373961_0017049 3300035241 Bacteria 1878
339 Ga0373931_0016078 3300035691 Bacteria 3679
340 Ga0395899_0081207 3300037312 Bacteria 2359
341 Ga0395898_0056033 3300037466 Bacteria 3844
342 Ga0395898_0309370 3300037466 Unclassified 1507
343 Ga0395905_0005431 3300037471 Bacteria 13023
344 Ga0395905_0299700 3300037471 Bacteria 1495
345 Ga0436364_1072056 3300037853 Unclassified 1766
346 Ga0395901_0002280 3300038443 Bacteria 19557
347 Ga0436365_1650166 3300039437 Bacteria 1238
348 Ga0436363_1254722 3300039450 Bacteria 3054
349 Ga0451839_1003149 3300041496 Unclassified 1028
350 Ga0439460_0096682 3300042461 Bacteria 944
351 Ga0453683_0023074 3300044673 Bacteria 3966
352 Ga0453684_0181852 3300044712 Bacteria 2468
353 Ga0451576_0511511 3300045051 Bacteria 1261
354 Ga0496104_0010293 3300048907 Bacteria 8351
355 Ga0496104_0553292 3300048907 Unclassified 1061
356 Ga0496104_0721239 3300048907 Unclassified 904
357 Ga0496106_0504059 3300048909 Unclassified 972
358 Ga0496108_0000508 3300048911 Bacteria 30623
359 Ga0496108_0001213 3300048911 Bacteria 20213
360 Ga0496108_0006400 3300048911 Bacteria 9549
361 Ga0496109_0001374 3300048912 Bacteria 20185
362 Ga0496109_0001824 3300048912 Bacteria 17691
363 Ga0496109_0012458 3300048912 Bacteria 7341
364 Ga0496110_0001232 3300048913 Bacteria 18262
365 Ga0496110_0014447 3300048913 Bacteria 6558
366 Ga0496110_0014742 3300048913 Bacteria 6494
367 Ga0496111_0214973 3300048914 Unclassified 1428
368 Ga0496111_0453903 3300048914 Unclassified 945
369 Ga0496112_0000050 3300048915 Bacteria 83676
370 Ga0496112_0000930 3300048915 Bacteria 21188
371 Ga0496112_0148210 3300048915 Bacteria 2314
372 Ga0496113_0000148 3300048916 Bacteria 30471
373 Ga0496113_0001707 3300048916 Bacteria 12440
374 Ga0496115_0012700 3300048918 Bacteria 6347
375 Ga0501068_0008896 3300049584 Bacteria 5602
376 Ga0501069_0079850 3300049585 Bacteria 1842
377 Ga0501072_0000998 3300049588 Bacteria 20926
378 nmdc:mga05p37_11180_c1 3300050507 Bacteria 10669
379 nmdc:mga05p37_198751_c1 3300050507 Bacteria 2430
380 nmdc:mga05p37_23091_c1 3300050507 Bacteria 7547
381 nmdc:mga05p37_244650_c1 3300050507 Bacteria 2154
382 nmdc:mga05p37_2568_c1 3300050507 Bacteria 21102
383 nmdc:mga05p37_386830_c1 3300050507 Unclassified 1637
384 nmdc:mga05p37_412204_c1 3300050507 Bacteria 1575
385 nmdc:mga05p37_524444_c1 3300050507 Bacteria 1354
386 nmdc:mga05p37_56524_c1 3300050507 Bacteria 4832
387 nmdc:mga05p37_95521_c1 3300050507 Unclassified 3662
388 nmdc:mga09592_41919_c1 3300050508 Bacteria 3850
389 nmdc:mga0qj67_561_c1 3300050509 Bacteria 25309
390 nmdc:mga06r32_124912_c1 3300050510 Bacteria 2540
391 nmdc:mga06r32_52815_c1 3300050510 Bacteria 3893
392 nmdc:mga06r32_569_c1 3300050510 Bacteria 32069
393 nmdc:mga06r32_969638_c1 3300050510 Bacteria 804
394 nmdc:mga08y16_294823_c1 3300050511 Unclassified 1672
395 nmdc:mga08y16_600881_c1 3300050511 Bacteria 1109
396 nmdc:mga08y16_642337_c1 3300050511 Bacteria 1066
397 nmdc:mga0n895_1050491_c1 3300050512 Unclassified 794
398 nmdc:mga0n895_230989_c1 3300050512 Bacteria 1878
399 nmdc:mga0n895_32224_c1 3300050512 Bacteria 5029
400 nmdc:mga0n895_402419_c1 3300050512 Bacteria 1384
401 nmdc:mga0n895_645157_c1 3300050512 Bacteria 1058
402 nmdc:mga0n895_91476_c1 3300050512 Bacteria 3045
403 nmdc:mga0rr50_409266_c1 3300050513 Bacteria 1146
404 nmdc:mga0a205_15498_c1 3300050515 Bacteria 7123
405 nmdc:mga0a205_192710_c1 3300050515 Unclassified 1930
406 nmdc:mga0a205_23791_c2 3300050515 Unclassified 2258
407 nmdc:mga0a205_86768_c1 3300050515 Bacteria 3023
408 Ga0495655_0001103 3300053083 Bacteria 4181
409 Ga0436365_1823474
410 MBSR1b_contig_8321982
411 JGI24752J21851_1015819
412 JGI24743J22301_10012400
413 Ga0065712_10074284
414 Ga0065715_10010158
415 Ga0065715_10090983
416 Ga0065715_10439890
417 Ga0070658_10617013
418 Ga0070676_10009945
419 Ga0070676_10013309
420 Ga0070683_100012220
421 Ga0070690_100012835
422 Ga0070670_100017662
423 Ga0070670_100089678
424 Ga0068869_100009650
425 Ga0068869_100150675
426 Ga0070682_100001834
427 Ga0068868_100049211
428 Ga0068868_100370414
429 Ga0070660_100038349
430 Ga0070689_100010215
431 Ga0070689_100073970
432 Ga0070689_100097601
433 Ga0070687_100010029
434 Ga0070661_100004345
435 Ga0070661_100009136
436 Ga0070661_100146931
437 Ga0070692_10120498
438 Ga0070668_100010415
439 Ga0070668_100022087
440 Ga0070669_100005165
441 Ga0070669_100191765
442 Ga0070669_100254581
443 Ga0070675_100003559
444 Ga0070675_100018091
445 Ga0070674_100008272
446 Ga0070674_100016529
447 Ga0070673_100008152
448 Ga0070688_100010773
449 Ga0070659_100013608
450 Ga0070667_100627311
451 Ga0070709_10213086
452 Ga0070714_100532052
453 Ga0070714_100595363
454 Ga0070711_100448159
455 Ga0070705_100036057
456 Ga0070700_100089476
457 Ga0070700_100105922
458 Ga0070694_100158140
459 Ga0070708_100002465
460 Ga0070708_100012697
461 Ga0070708_100073875
462 Ga0070708_100116017
463 Ga0070708_100359413
464 Ga0070708_100386114
465 Ga0070708_100663267
466 Ga0070663_100011097
467 Ga0070663_100424324
468 Ga0070678_100243646
469 Ga0070678_100360012
470 Ga0070662_100000224
471 Ga0070662_100000346
472 Ga0070662_100022078
473 Ga0070662_100055089
474 Ga0070681_10014612
475 Ga0070681_10053405
476 Ga0068867_100017140
477 Ga0070685_10021109
478 Ga0070706_100069276
479 Ga0070706_100089213
480 Ga0070706_100116798
481 Ga0070706_100417113
482 Ga0070706_100801323
483 Ga0070707_100005821
484 Ga0070707_100046518
485 Ga0070707_100327522
486 Ga0070707_100437478
487 Ga0070698_100029612
488 Ga0070698_100137283
489 Ga0070698_100273085
490 Ga0070699_100001714
491 Ga0070699_100205215
492 Ga0070684_100009922
493 Ga0070684_100061419
494 Ga0070697_100145668
495 Ga0070697_100178119
496 Ga0070697_100399953
497 Ga0068853_100116483
498 Ga0068853_100196173
499 Ga0068853_100348486
500 Ga0068853_100398373
501 Ga0068853_100399449
502 Ga0070672_100026947
503 Ga0070672_100310549
504 Ga0070686_100102066
505 Ga0070695_100002324
506 Ga0070695_100056890
507 Ga0070665_100136065
508 Ga0070665_100610037
509 Ga0068855_100003148
510 Ga0068855_100008312
511 Ga0068855_100045772
512 Ga0068855_100218454
513 Ga0070664_100016861
514 Ga0070664_100035630
515 Ga0070664_100164781
516 Ga0068857_100013951
517 Ga0068857_100018586
518 Ga0068857_100057014
519 Ga0068857_100179260
520 Ga0068854_100064793
521 Ga0068859_100036984
522 Ga0068859_100309901
523 Ga0068859_100443737
524 Ga0068864_100024757
525 Ga0068864_100060566
526 Ga0068866_10005065
527 Ga0068861_100031536
528 Ga0068861_100113110
529 Ga0068861_100483512
530 Ga0068851_10050580
531 Ga0068870_10003268
532 Ga0068870_10128849
533 Ga0068863_100014559
534 Ga0068863_100030303
535 Ga0068863_100142506
536 Ga0068863_100216634
537 Ga0068863_100251419
538 Ga0068858_100091338
539 Ga0068858_100146299
540 Ga0068858_100153529
541 Ga0068860_100027399
542 Ga0068862_100000841
543 Ga0068862_100019998
544 Ga0070717_10215415
545 Ga0070712_100273168
546 Ga0097621_100007861
547 Ga0075428_100008215
548 Ga0075428_100017292
549 Ga0075428_100045024
550 Ga0075428_100270137
551 Ga0075430_100000382
552 Ga0075431_100000509
553 Ga0075431_100124406
554 Ga0075433_10081066
555 Ga0075433_10090256
556 Ga0075433_10168720
557 Ga0075433_10364204
558 Ga0075434_100117026
559 Ga0075434_100151201
560 Ga0075434_100210864
561 Ga0075429_100295517
562 Ga0068865_100144618
563 Ga0075436_100535864
564 Ga0097620_100036986
565 Ga0097620_100309891
566 Ga0097620_100443721
567 Ga0075435_100341169
568 Ga0099794_10166912
569 Ga0099794_10242994
570 Ga0105240_10050942
571 Ga0111539_10550631
572 Ga0111539_10861734
573 Ga0105245_10157101
574 Ga0105245_10189644
575 Ga0105245_10752722
576 Ga0105247_10011585
577 Ga0114129_10010795
578 Ga0114129_10040906
579 Ga0114129_10073250
580 Ga0114129_10113949
581 Ga0114129_10122854
582 Ga0114129_10321438
583 Ga0114129_10487480
584 Ga0114129_10561340
585 Ga0105243_10624185
586 Ga0105243_10819303
587 Ga0105241_10013058
588 Ga0105242_10081903
589 Ga0105242_10606391
590 Ga0105248_10003307
591 Ga0105248_10467547
592 Ga0105248_10755441
593 Ga0105237_10102323
594 Ga0105237_10708883
595 Ga0105238_10773442
596 Ga0105249_10003626
597 Ga0105249_10017579
598 Ga0105249_10027948
599 Ga0105249_10034798
600 Ga0105249_10159505
601 Ga0105249_10207764
602 Ga0099796_10004715
603 Ga0099796_10110188
604 Ga0105239_10045354
605 Ga0105239_10055658
606 Ga0105239_10268852
607 Ga0105246_10003806
608 Ga0157373_10111873
609 Ga0157371_10039726
610 Ga0157371_10079562
611 Ga0157369_10040986
612 Ga0157374_10177186
613 Ga0157378_10138767
614 Ga0157378_10610211
615 Ga0163162_10004413
616 Ga0163162_10121029
617 Ga0157372_10005183
618 Ga0157372_10014366
619 Ga0157372_10067598
620 Ga0157372_10316564
621 Ga0157375_10019898
622 Ga0157375_10047698
623 Ga0157375_10561995
624 Ga0163163_10022087
625 Ga0163163_10060712
626 Ga0157380_10023400
627 Ga0157380_10425515
628 Ga0157377_10003727
629 Ga0157379_10287053
630 Ga0157379_10563126
631 Ga0157376_10102089
632 Ga0163161_10004335
633 Ga0163161_10081236
634 Ga0163161_10373457
635 Ga0213875_10078624
636 Ga0207697_10048882
637 Ga0207697_10074263
638 Ga0207656_10002265
639 Ga0207653_10008484
640 Ga0207642_10068201
641 Ga0207710_10126898
642 Ga0207688_10050937
643 Ga0207699_10014089
644 Ga0207699_10273496
645 Ga0207645_10012484
646 Ga0207645_10047087
647 Ga0207643_10006038
648 Ga0207705_10245881
649 Ga0207684_10003596
650 Ga0207684_10107082
651 Ga0207684_10118779
652 Ga0207684_10306849
653 Ga0207684_10673222
654 Ga0207707_10022408
655 Ga0207707_10385754
656 Ga0207695_10066059
657 Ga0207671_10136325
658 Ga0207662_10167092
659 Ga0207657_10007532
660 Ga0207657_10299426
661 Ga0207649_10002275
662 Ga0207649_10492488
663 Ga0207649_10517502
664 Ga0207646_10003721
665 Ga0207646_10032937
666 Ga0207646_10072545
667 Ga0207646_10105889
668 Ga0207681_10002162
669 Ga0207681_10124450
670 Ga0207681_10561146
671 Ga0207650_10008111
672 Ga0207687_10231932
673 Ga0207700_10011240
674 Ga0207700_10876177
675 Ga0207644_10449435
676 Ga0207690_10226046
677 Ga0207706_10000099
678 Ga0207706_10000259
679 Ga0207706_10006391
680 Ga0207706_10024936
681 Ga0207686_10023499
682 Ga0207686_10082815
683 Ga0207670_10110162
684 Ga0207670_10439613
685 Ga0207669_10246788
686 Ga0207704_10084657
687 Ga0207704_10108760
688 Ga0207665_10091609
689 Ga0207691_10015684
690 Ga0207691_10033224
691 Ga0207691_10040807
692 Ga0207711_10007200
693 Ga0207711_10008397
694 Ga0207711_10331063
695 Ga0207689_10013644
696 Ga0207689_10201257
697 Ga0207661_10004501
698 Ga0207679_10007352
699 Ga0207679_10044074
700 Ga0207679_10071421
701 Ga0207679_10401757
702 Ga0207667_10008510
703 Ga0207667_10179207
704 Ga0207651_10009522
705 Ga0207712_10012271
706 Ga0207712_10020194
707 Ga0207712_10039630
708 Ga0207712_10229605
709 Ga0207668_10002391
710 Ga0207668_10278263
711 Ga0207668_10427499
712 Ga0207668_10652733
713 Ga0207640_10420013
714 Ga0207677_10036264
715 Ga0207677_10836153
716 Ga0207703_10074729
717 Ga0207703_10082982
718 Ga0207703_10141901
719 Ga0207639_10087832
720 Ga0207639_10235597
721 Ga0207639_10419785
722 Ga0207639_10498366
723 Ga0207678_10014070
724 Ga0207678_10208964
725 Ga0207708_10087040
726 Ga0207708_10143225
727 Ga0207641_10000203
728 Ga0207641_10079072
729 Ga0207641_10444703
730 Ga0207648_10028567
731 Ga0207676_10001181
732 Ga0207676_10007869
733 Ga0207674_10001648
734 Ga0207674_10021604
735 Ga0207674_10204373
736 Ga0207675_100011784
737 Ga0207675_100015714
738 Ga0207675_100045770
739 Ga0207675_100052754
740 Ga0207683_10282189
741 Ga0207683_10421918
742 Ga0268266_10024068
743 Ga0268265_10010871
744 Ga0268265_10199393
745 Ga0307408_100008078
746 Ga0373961_0017049
747 Ga0373931_0016078
748 Ga0395899_0081207
749 Ga0395898_0056033
750 Ga0395898_0309370
751 Ga0395905_0005431
752 Ga0395905_0299700
753 Ga0436364_1072056
754 Ga0395901_0002280
755 Ga0436365_1650166
756 Ga0436363_1254722
757 Ga0451839_1003149
758 Ga0439460_0096682
759 Ga0453683_0023074
760 Ga0453684_0181852
761 Ga0451576_0511511
762 Ga0496104_0010293
763 Ga0496104_0553292
764 Ga0496104_0721239
765 Ga0496106_0504059
766 Ga0496108_0000508
767 Ga0496108_0001213
768 Ga0496108_0006400
769 Ga0496109_0001374
770 Ga0496109_0001824
771 Ga0496109_0012458
772 Ga0496110_0001232
773 Ga0496110_0014447
774 Ga0496110_0014742
775 Ga0496111_0214973
776 Ga0496111_0453903
777 Ga0496112_0000050
778 Ga0496112_0000930
779 Ga0496112_0148210
780 Ga0496113_0000148
781 Ga0496113_0001707
782 Ga0496115_0012700
783 Ga0501068_0008896
784 Ga0501069_0079850
785 Ga0501072_0000998
786 nmdc:mga05p37_11180_c1
787 nmdc:mga05p37_198751_c1
788 nmdc:mga05p37_23091_c1
789 nmdc:mga05p37_244650_c1
790 nmdc:mga05p37_2568_c1
791 nmdc:mga05p37_386830_c1
792 nmdc:mga05p37_412204_c1
793 nmdc:mga05p37_524444_c1
794 nmdc:mga05p37_56524_c1
795 nmdc:mga05p37_95521_c1
796 nmdc:mga09592_41919_c1
797 nmdc:mga0qj67_561_c1
798 nmdc:mga06r32_124912_c1
799 nmdc:mga06r32_52815_c1
800 nmdc:mga06r32_569_c1
801 nmdc:mga06r32_969638_c1
802 nmdc:mga08y16_294823_c1
803 nmdc:mga08y16_600881_c1
804 nmdc:mga08y16_642337_c1
805 nmdc:mga0n895_1050491_c1
806 nmdc:mga0n895_230989_c1
807 nmdc:mga0n895_32224_c1
808 nmdc:mga0n895_402419_c1
809 nmdc:mga0n895_645157_c1
810 nmdc:mga0n895_91476_c1
811 nmdc:mga0rr50_409266_c1
812 nmdc:mga0a205_15498_c1
813 nmdc:mga0a205_192710_c1
814 nmdc:mga0a205_23791_c2
815 nmdc:mga0a205_86768_c1
816 Ga0495655_0001103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kq7-assembly1.cif.gz_A-2 e315q mutant form of fumarase c from e.coli 0.5343 53 225
7of1-assembly1.cif.gz_b nog1-tap associated immature ribosomal particle population a from s. cerevisiae 0.5083 22 167
8i9z-assembly1.cif.gz_CH cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state spb4 0.5082 22 163
8i9w-assembly1.cif.gz_CH cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - dbp10-3 0.5072 22 167
7ohu-assembly1.cif.gz_b nog1-tap associated immature ribosomal particles from s. cerevisiae after rpl2 expression shut down, population b 0.5055 22 163
ID Description Score Start End Superfamily
4iggB04 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.677 46 156 1.20.120.230
af_D3ZA84_664_788_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6245 57 185 1.20.120.230
4iggB04 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6116 46 156 1.20.120.230
af_G5EGK1_693_820_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6113 57 220 1.20.120.230
af_A0A0R4IIA7_1847_1972_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.609 17 156 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A538ALW9-F1-model_v4 DUF4386 family protein 0.9491 14 222 GO:0016020
AF-A0A2V9WRQ6-F1-model_v4 DUF4386 family protein 0.9389 18 230 GO:0016020
AF-A0A2V8PAQ3-F1-model_v4 DUF4386 family protein 0.9352 2 230 GO:0016020
AF-A0A2V8PAQ3-F1-model_v4 DUF4386 family protein 0.9273 2 230 GO:0016020
AF-A0A2V9WRQ6-F1-model_v4 DUF4386 family protein 0.9263 18 230 GO:0016020

Map