F436748

General Info

Members Datasets Scaffolds Average Seq Length
408 215 816 400

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_10025726|Ga0207676_100257262
Length 425
Sequence MAGESPGAGGCGPSYALTLAMKRILDIALGIVTSVGGFLEIGSIATAAQAGASFGFQLAWAIALGTVCIAFLVEMGGRFAAVSKHTIADAMRERFGVPFFTTLTVVMLGVSLLVLAAEVGGVGAALKMATGLPIPVWAIPVALVAWGLLWYTTFGVIENGVSILGLVTVAFVVGAVKLHPNYGEVARGFIPSLPKEDAAKYWFTAVSILGASISPYLFFFYSSGAIEDKWDETYLWSNRAIATIGMGFGGFLSVAVLVLAAMIFHPHNIDVEHYQQLPELLSPILGRPGFWLVVASLAIACLGATLEIALALAYLVAQGLGWTWGENVKPRQDARFCLLYTVLVFAASIFSLVSVDPLKMTQISMSLTAASLPIGVLPFLVLMNDKSYLHDHTNRIAGNIVVMFISLLASVLAIISIPLQIVGSS

Samples

Sample ID Description Type Environment
1 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
199 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
200 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
201 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
202 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
205 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
206 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
207 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.39
Rhizosphere 93.87
Stem 0
Stem Tuber 0
Unclassified 13.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207676_10025726 3300026095 Bacteria 4369
2 JGI24751J29686_10000136 3300002459 Bacteria 36776
3 rootL2_10100127 3300003322 Bacteria 3153
4 Ga0065714_10064474 3300005288 Bacteria 60308
5 Ga0065704_10001928 3300005289 Bacteria 11405
6 Ga0065712_10067750 3300005290 Bacteria 60312
7 Ga0065712_10070116 3300005290 Bacteria 6314
8 Ga0065712_10083028 3300005290 Bacteria 2849
9 Ga0065712_10098365 3300005290 Bacteria 2122
10 Ga0065715_10007567 3300005293 Unclassified 3686
11 Ga0065715_10090953 3300005293 Bacteria 6280
12 Ga0065715_10109531 3300005293 Bacteria 2664
13 Ga0065715_10150860 3300005293 Bacteria 1731
14 Ga0070683_100000382 3300005329 Bacteria 30781
15 Ga0070683_100032062 3300005329 Bacteria 4782
16 Ga0070683_100085065 3300005329 Bacteria 2964
17 Ga0070683_100108155 3300005329 Bacteria 2622
18 Ga0070690_100000789 3300005330 Bacteria 16066
19 Ga0070670_100000098 3300005331 Bacteria 80608
20 Ga0070670_100053829 3300005331 Bacteria 3455
21 Ga0070670_100115090 3300005331 Bacteria 2319
22 Ga0068869_100020141 3300005334 Bacteria 4569
23 Ga0070666_10047463 3300005335 Bacteria 2883
24 Ga0070666_10068236 3300005335 Bacteria 2416
25 Ga0070680_100006179 3300005336 Bacteria 9081
26 Ga0070680_100017426 3300005336 Bacteria 5665
27 Ga0070680_100095110 3300005336 Bacteria 2469
28 Ga0070680_100116369 3300005336 Unclassified 2228
29 Ga0070682_100006815 3300005337 Bacteria 6413
30 Ga0070682_100132659 3300005337 Unclassified 1688
31 Ga0068868_100085940 3300005338 Bacteria 2528
32 Ga0068868_100087537 3300005338 Bacteria 2505
33 Ga0070660_100032928 3300005339 Bacteria 3904
34 Ga0070691_10031531 3300005341 Bacteria 2486
35 Ga0070661_100166104 3300005344 Bacteria 1674
36 Ga0070692_10034239 3300005345 Bacteria 2564
37 Ga0070668_100039239 3300005347 Bacteria 3622
38 Ga0070675_100004132 3300005354 Bacteria 11027
39 Ga0070671_100115765 3300005355 Bacteria 2254
40 Ga0070673_100004381 3300005364 Bacteria 8918
41 Ga0070673_100092514 3300005364 Bacteria 2474
42 Ga0070673_100178085 3300005364 Bacteria 1818
43 Ga0070688_100018992 3300005365 Bacteria 3977
44 Ga0070659_100006737 3300005366 Bacteria 8304
45 Ga0070667_100047692 3300005367 Bacteria 3604
46 Ga0070709_10010986 3300005434 Bacteria 5030
47 Ga0070714_100055843 3300005435 Bacteria 3376
48 Ga0070714_100164950 3300005435 Archaea 2007
49 Ga0070713_100000053 3300005436 Bacteria 71704
50 Ga0070713_100018086 3300005436 Bacteria 5353
51 Ga0070713_100024873 3300005436 Bacteria 4673
52 Ga0070710_10004303 3300005437 Bacteria 6748
53 Ga0070710_10051997 3300005437 Archaea 2303
54 Ga0070710_10064587 3300005437 Bacteria 2094
55 Ga0070711_100074906 3300005439 Bacteria 2395
56 Ga0070705_100003263 3300005440 Bacteria 7977
57 Ga0070705_100026739 3300005440 Unclassified 3144
58 Ga0070705_100077243 3300005440 Bacteria 2033
59 Ga0070694_100003204 3300005444 Bacteria 9765
60 Ga0070694_100032929 3300005444 Unclassified 3406
61 Ga0070681_10004463 3300005458 Bacteria 13332
62 Ga0070681_10006697 3300005458 Bacteria 11209
63 Ga0070681_10007674 3300005458 Bacteria 10552
64 Ga0070681_10019243 3300005458 Bacteria 6831
65 Ga0070681_10029595 3300005458 Bacteria 5499
66 Ga0070681_10146535 3300005458 Unclassified 2290
67 Ga0068867_100181485 3300005459 Bacteria 1674
68 Ga0070685_10016579 3300005466 Bacteria 3928
69 Ga0070679_100001742 3300005530 Bacteria 19603
70 Ga0070679_100070234 3300005530 Bacteria 3494
71 Ga0070679_100134237 3300005530 Unclassified 2456
72 Ga0070684_100009496 3300005535 Bacteria 7663
73 Ga0070684_100022494 3300005535 Bacteria 5258
74 Ga0070684_100112408 3300005535 Bacteria 2444
75 Ga0070684_100303252 3300005535 Bacteria 1466
76 Ga0068853_100007564 3300005539 Bacteria 8699
77 Ga0068853_100018847 3300005539 Bacteria 5715
78 Ga0070672_100062696 3300005543 Bacteria 2935
79 Ga0070686_100028379 3300005544 Bacteria 3394
80 Ga0070695_100095600 3300005545 Bacteria 1991
81 Ga0070695_100108400 3300005545 Bacteria 1881
82 Ga0070696_100007127 3300005546 Bacteria 7467
83 Ga0070696_100192421 3300005546 Bacteria 1519
84 Ga0070693_100002445 3300005547 Bacteria 8557
85 Ga0070693_100003004 3300005547 Bacteria 7815
86 Ga0070693_100032660 3300005547 Unclassified 2865
87 Ga0070693_100079617 3300005547 Unclassified 1950
88 Ga0070693_100102259 3300005547 Unclassified 1748
89 Ga0070693_100118612 3300005547 Bacteria 1638
90 Ga0070693_100129323 3300005547 Bacteria 1576
91 Ga0070704_100174990 3300005549 Bacteria 1711
92 Ga0068855_100448126 3300005563 Bacteria 1409
93 Ga0070664_100018009 3300005564 Bacteria 5799
94 Ga0070664_100058954 3300005564 Bacteria 3266
95 Ga0070664_100094610 3300005564 Bacteria 2591
96 Ga0070664_100120602 3300005564 Unclassified 2296
97 Ga0070664_100271329 3300005564 Unclassified 1528
98 Ga0068857_100194259 3300005577 Bacteria 1849
99 Ga0068856_100001617 3300005614 Bacteria 23574
100 Ga0068856_100020217 3300005614 Bacteria 6466
101 Ga0068856_100134735 3300005614 Bacteria 2475
102 Ga0068856_100154313 3300005614 Unclassified 2306
103 Ga0068856_100290744 3300005614 Bacteria 1651
104 Ga0070702_100010707 3300005615 Bacteria 4531
105 Ga0068852_100005499 3300005616 Bacteria 9075
106 Ga0068852_100048433 3300005616 Bacteria 3631
107 Ga0068859_100010560 3300005617 Bacteria 9296
108 Ga0068859_100015823 3300005617 Bacteria 7579
109 Ga0068859_100044701 3300005617 Bacteria 4450
110 Ga0068859_100112025 3300005617 Unclassified 2792
111 Ga0068859_100201805 3300005617 Bacteria 2073
112 Ga0068864_100002003 3300005618 Bacteria 16778
113 Ga0068864_100135269 3300005618 Bacteria 2219
114 Ga0068851_10001358 3300005834 Bacteria 10679
115 Ga0068863_100138402 3300005841 Unclassified 2326
116 Ga0068858_100038049 3300005842 Bacteria 4462
117 Ga0068858_100254700 3300005842 Bacteria 1668
118 Ga0068860_100184826 3300005843 Unclassified 2015
119 Ga0068860_100339127 3300005843 Bacteria 1478
120 Ga0068862_100176227 3300005844 Bacteria 1917
121 Ga0081539_10000119 3300005985 Bacteria 184136
122 Ga0081539_10000884 3300005985 Bacteria 57334
123 Ga0081539_10017049 3300005985 Bacteria 5131
124 Ga0070717_10000319 3300006028 Bacteria 31450
125 Ga0070716_100006865 3300006173 Bacteria 5582
126 Ga0070716_100083215 3300006173 Bacteria 1916
127 Ga0070712_100012279 3300006175 Bacteria 5445
128 Ga0070712_100182460 3300006175 Unclassified 1636
129 Ga0097621_100046235 3300006237 Bacteria 3521
130 Ga0097621_100050706 3300006237 Unclassified 3376
131 Ga0068871_100010219 3300006358 Bacteria 6837
132 Ga0068871_100098644 3300006358 Unclassified 2444
133 Ga0075428_100068368 3300006844 Bacteria 3886
134 Ga0075428_100215431 3300006844 Bacteria 2075
135 Ga0075431_100098973 3300006847 Bacteria 3010
136 Ga0075433_10025329 3300006852 Bacteria 5013
137 Ga0075434_100101089 3300006871 Bacteria 2890
138 Ga0075434_100123651 3300006871 Bacteria 2604
139 Ga0075429_100117866 3300006880 Bacteria 2320
140 Ga0075436_100001043 3300006914 Bacteria 18689
141 Ga0075436_100010730 3300006914 Bacteria 6284
142 Ga0097620_100010560 3300006931 Bacteria 9296
143 Ga0097620_100015824 3300006931 Bacteria 7579
144 Ga0097620_100044703 3300006931 Bacteria 4450
145 Ga0097620_100112023 3300006931 Unclassified 2792
146 Ga0097620_100201803 3300006931 Bacteria 2073
147 Ga0075435_100028741 3300007076 Bacteria 4362
148 Ga0105240_10003514 3300009093 Bacteria 24313
149 Ga0105240_10049952 3300009093 Bacteria 5276
150 Ga0105240_10098196 3300009093 Bacteria 3567
151 Ga0105240_10229373 3300009093 Bacteria 2159
152 Ga0111539_10043211 3300009094 Bacteria 5404
153 Ga0111539_10049890 3300009094 Bacteria 4988
154 Ga0105245_10000465 3300009098 Bacteria 37212
155 Ga0105245_10010657 3300009098 Bacteria 7996
156 Ga0105247_10000841 3300009101 Bacteria 23337
157 Ga0105247_10008706 3300009101 Bacteria 6186
158 Ga0114129_10028076 3300009147 Bacteria 7972
159 Ga0114129_10098668 3300009147 Bacteria 4043
160 Ga0114129_10311563 3300009147 Unclassified 2095
161 Ga0105243_10014264 3300009148 Bacteria 6013
162 Ga0105243_10071225 3300009148 Bacteria 2810
163 Ga0105241_10003816 3300009174 Bacteria 11170
164 Ga0105241_10008049 3300009174 Bacteria 7755
165 Ga0105241_10038691 3300009174 Bacteria 3596
166 Ga0105241_10076223 3300009174 Bacteria 2614
167 Ga0105242_10023657 3300009176 Unclassified 4843
168 Ga0105248_10031596 3300009177 Bacteria 5916
169 Ga0105237_10000199 3300009545 Bacteria 85277
170 Ga0105237_10039494 3300009545 Bacteria 4765
171 Ga0105238_10000050 3300009551 Bacteria 143358
172 Ga0105238_10006866 3300009551 Bacteria 11367
173 Ga0105238_10121692 3300009551 Bacteria 2589
174 Ga0105238_10194848 3300009551 Bacteria 2002
175 Ga0105238_10222495 3300009551 Bacteria 1864
176 Ga0105249_10115723 3300009553 Bacteria 2541
177 Ga0105249_10132025 3300009553 Bacteria 2385
178 Ga0105249_10154200 3300009553 Unclassified 2214
179 Ga0105239_10020746 3300010375 Bacteria 7250
180 Ga0105239_10032357 3300010375 Bacteria 5748
181 Ga0105246_10026382 3300011119 Bacteria 3795
182 Ga0157373_10005740 3300013100 Bacteria 9295
183 Ga0157373_10019443 3300013100 Bacteria 4942
184 Ga0157373_10062738 3300013100 Bacteria 2632
185 Ga0157371_10019674 3300013102 Bacteria 4973
186 Ga0157370_10000559 3300013104 Bacteria 46442
187 Ga0157370_10002128 3300013104 Bacteria 24181
188 Ga0157370_10003659 3300013104 Bacteria 17970
189 Ga0157370_10052029 3300013104 Bacteria 3910
190 Ga0157370_10070720 3300013104 Bacteria 3294
191 Ga0157369_10003932 3300013105 Bacteria 17628
192 Ga0157369_10143624 3300013105 Bacteria 2524
193 Ga0157369_10310512 3300013105 Bacteria 1640
194 Ga0157378_10353680 3300013297 Bacteria 1436
195 Ga0163162_10005252 3300013306 Bacteria 12485
196 Ga0163162_10088608 3300013306 Unclassified 3174
197 Ga0163162_10225139 3300013306 Bacteria 2005
198 Ga0163162_10259641 3300013306 Unclassified 1869
199 Ga0157372_10002104 3300013307 Bacteria 21664
200 Ga0157372_10006702 3300013307 Bacteria 12252
201 Ga0157372_10012493 3300013307 Bacteria 9050
202 Ga0157372_10024373 3300013307 Bacteria 6571
203 Ga0157372_10073772 3300013307 Bacteria 3847
204 Ga0157372_10094447 3300013307 Bacteria 3405
205 Ga0157375_10038676 3300013308 Unclassified 4582
206 Ga0157375_10272015 3300013308 Bacteria 1856
207 Ga0157375_10276542 3300013308 Unclassified 1842
208 Ga0163163_10000465 3300014325 Bacteria 36944
209 Ga0163163_10071683 3300014325 Bacteria 3453
210 Ga0163163_10075007 3300014325 Unclassified 3375
211 Ga0157377_10001443 3300014745 Bacteria 10267
212 Ga0157379_10029754 3300014968 Bacteria 4856
213 Ga0157376_10162386 3300014969 Bacteria 2027
214 Ga0157376_10305965 3300014969 Bacteria 1506
215 Ga0206356_10528908 3300020070 Bacteria 2364
216 Ga0207656_10025370 3300025321 Bacteria 2406
217 Ga0207692_10063947 3300025898 Archaea 1914
218 Ga0207710_10000563 3300025900 Bacteria 22203
219 Ga0207710_10098564 3300025900 Unclassified 1376
220 Ga0207680_10074379 3300025903 Bacteria 2115
221 Ga0207699_10019081 3300025906 Bacteria 3648
222 Ga0207654_10053903 3300025911 Bacteria 2323
223 Ga0207654_10068637 3300025911 Bacteria 2098
224 Ga0207707_10005841 3300025912 Bacteria 10754
225 Ga0207707_10036876 3300025912 Unclassified 4272
226 Ga0207707_10077475 3300025912 Unclassified 2902
227 Ga0207707_10233290 3300025912 Bacteria 1601
228 Ga0207695_10005156 3300025913 Bacteria 17498
229 Ga0207695_10021655 3300025913 Bacteria 7328
230 Ga0207695_10040276 3300025913 Bacteria 5013
231 Ga0207695_10096398 3300025913 Bacteria 2960
232 Ga0207695_10100888 3300025913 Bacteria 2881
233 Ga0207671_10001814 3300025914 Bacteria 23845
234 Ga0207693_10015329 3300025915 Bacteria 6152
235 Ga0207693_10018804 3300025915 Bacteria 5498
236 Ga0207660_10021683 3300025917 Bacteria 4322
237 Ga0207660_10108198 3300025917 Unclassified 2087
238 Ga0207660_10125912 3300025917 Bacteria 1945
239 Ga0207657_10018600 3300025919 Bacteria 6623
240 Ga0207649_10056495 3300025920 Bacteria 2451
241 Ga0207652_10003948 3300025921 Bacteria 12128
242 Ga0207652_10009495 3300025921 Bacteria 7821
243 Ga0207652_10030615 3300025921 Bacteria 4508
244 Ga0207652_10081219 3300025921 Bacteria 2835
245 Ga0207652_10153822 3300025921 Bacteria 2060
246 Ga0207681_10046215 3300025923 Bacteria 2928
247 Ga0207694_10000060 3300025924 Bacteria 143366
248 Ga0207694_10006203 3300025924 Bacteria 9126
249 Ga0207694_10074946 3300025924 Bacteria 2648
250 Ga0207694_10143978 3300025924 Bacteria 1918
251 Ga0207694_10164106 3300025924 Bacteria 1796
252 Ga0207650_10000156 3300025925 Bacteria 81983
253 Ga0207650_10034365 3300025925 Bacteria 3676
254 Ga0207659_10105581 3300025926 Bacteria 2132
255 Ga0207687_10000290 3300025927 Bacteria 34584
256 Ga0207687_10085628 3300025927 Bacteria 2287
257 Ga0207700_10001308 3300025928 Bacteria 14124
258 Ga0207700_10024277 3300025928 Bacteria 4194
259 Ga0207664_10133223 3300025929 Archaea 2094
260 Ga0207664_10207696 3300025929 Bacteria 1693
261 Ga0207644_10068634 3300025931 Bacteria 2587
262 Ga0207690_10058494 3300025932 Bacteria 2607
263 Ga0207706_10042933 3300025933 Bacteria 4007
264 Ga0207709_10115956 3300025935 Bacteria 1800
265 Ga0207670_10010299 3300025936 Bacteria 5378
266 Ga0207665_10034016 3300025939 Bacteria 3382
267 Ga0207665_10039103 3300025939 Unclassified 3161
268 Ga0207711_10033707 3300025941 Bacteria 4335
269 Ga0207689_10022435 3300025942 Bacteria 5309
270 Ga0207661_10004521 3300025944 Bacteria 9752
271 Ga0207661_10064401 3300025944 Bacteria 2972
272 Ga0207661_10095063 3300025944 Bacteria 2490
273 Ga0207661_10103723 3300025944 Bacteria 2393
274 Ga0207679_10013346 3300025945 Bacteria 5382
275 Ga0207679_10239197 3300025945 Bacteria 1537
276 Ga0207667_10148893 3300025949 Unclassified 2409
277 Ga0207712_10073584 3300025961 Bacteria 2465
278 Ga0207640_10083948 3300025981 Bacteria 2185
279 Ga0207677_10074066 3300026023 Unclassified 2414
280 Ga0207677_10084672 3300026023 Bacteria 2286
281 Ga0207703_10040173 3300026035 Bacteria 3743
282 Ga0207703_10045389 3300026035 Bacteria 3535
283 Ga0207703_10184091 3300026035 Bacteria 1845
284 Ga0207702_10014622 3300026078 Bacteria 6514
285 Ga0207702_10102210 3300026078 Bacteria 2533
286 Ga0207702_10232625 3300026078 Unclassified 1723
287 Ga0207702_10306767 3300026078 Bacteria 1508
288 Ga0207648_10213492 3300026089 Unclassified 1713
289 Ga0207676_10046550 3300026095 Bacteria 3357
290 Ga0207676_10172126 3300026095 Bacteria 1888
291 Ga0207674_10002287 3300026116 Bacteria 24296
292 Ga0207674_10024472 3300026116 Bacteria 6453
293 Ga0207698_10086285 3300026142 Bacteria 2552
294 Ga0268265_10156790 3300028380 Bacteria 1928
295 Ga0268264_10063846 3300028381 Bacteria 3097
296 Ga0268264_10075759 3300028381 Unclassified 2861
297 Ga0268264_10222229 3300028381 Bacteria 1739
298 Ga0307408_100021683 3300031548 Bacteria 4351
299 Ga0307408_100066790 3300031548 Bacteria 2643
300 Ga0307405_10038778 3300031731 Bacteria 2875
301 Ga0307413_10025306 3300031824 Unclassified 3252
302 Ga0307413_10113512 3300031824 Bacteria 1819
303 Ga0307410_10005279 3300031852 Bacteria 6814
304 Ga0307406_10002927 3300031901 Bacteria 9294
305 Ga0307406_10082336 3300031901 Unclassified 2143
306 Ga0307407_10001597 3300031903 Bacteria 8364
307 Ga0307407_10057267 3300031903 Bacteria 2260
308 Ga0307409_100000372 3300031995 Bacteria 18902
309 Ga0307409_100101910 3300031995 Bacteria 2384
310 Ga0307416_100009648 3300032002 Bacteria 6333
311 Ga0307416_100036245 3300032002 Unclassified 3780
312 Ga0307416_100136295 3300032002 Bacteria 2221
313 Ga0307416_100269582 3300032002 Bacteria 1670
314 Ga0307416_100297400 3300032002 Archaea 1602
315 Ga0307414_10001159 3300032004 Bacteria 13522
316 Ga0307414_10035799 3300032004 Unclassified 3307
317 Ga0307411_10003551 3300032005 Bacteria 7260
318 Ga0307411_10029299 3300032005 Unclassified 3359
319 Ga0307411_10057988 3300032005 Bacteria 2561
320 Ga0307411_10091723 3300032005 Bacteria 2123
321 Ga0307415_100002912 3300032126 Bacteria 8581
322 Ga0307415_100040643 3300032126 Bacteria 3082
323 Ga0307415_100046721 3300032126 Bacteria 2910
324 Ga0373959_0000692 3300034820 Bacteria 5774
325 Ga0373926_0002237 3300035083 Bacteria 6113
326 Ga0373941_0004897 3300035115 Bacteria 3119
327 Ga0373941_0035499 3300035115 Unclassified 1511
328 Ga0373943_0003597 3300035170 Bacteria 7052
329 Ga0373946_0015428 3300035171 Bacteria 2897
330 Ga0373935_0003159 3300035692 Bacteria 9500
331 Ga0373927_0002989 3300035695 Bacteria 12264
332 Ga0373947_0010281 3300035725 Bacteria 5370
333 Ga0373925_0020953 3300037068 Bacteria 4764
334 Ga0395899_0150672 3300037312 Unclassified 1648
335 Ga0395900_0007991 3300037418 Bacteria 10886
336 Ga0395898_0033120 3300037466 Bacteria 5158
337 Ga0395898_0263169 3300037466 Unclassified 1645
338 Ga0395905_0021233 3300037471 Bacteria 6144
339 Ga0395901_0013172 3300038443 Bacteria 8397
340 Ga0395901_0044432 3300038443 Unclassified 4608
341 Ga0436365_0064377 3300039437 Bacteria 1625
342 Ga0436365_0888939 3300039437 Unclassified 3191
343 Ga0439458_0007486 3300042157 Bacteria 2432
344 Ga0451577_0121290 3300042876 Bacteria 2342
345 Ga0466961_0001222 3300044693 Bacteria 15810
346 Ga0466959_0072518 3300045049 Bacteria 2492
347 Ga0466967_0159307 3300045976 Unclassified 2117
348 Ga0495603_0018388 3300046455 Bacteria 4229
349 Ga0495580_0004344 3300046472 Bacteria 11901
350 Ga0495639_0000705 3300046475 Bacteria 15293
351 Ga0495594_0022893 3300046499 Bacteria 3345
352 Ga0495630_0001962 3300046517 Bacteria 14314
353 Ga0495630_0002227 3300046517 Bacteria 13504
354 Ga0495665_0000567 3300046531 Bacteria 18803
355 Ga0495588_0000502 3300046674 Bacteria 19122
356 Ga0495658_0000243 3300046683 Bacteria 31224
357 Ga0495581_0002171 3300047315 Bacteria 11079
358 Ga0495581_0012237 3300047315 Bacteria 4969
359 Ga0495674_0060057 3300047319 Bacteria 3318
360 Ga0495593_0001324 3300047673 Bacteria 14509
361 Ga0495614_0000677 3300048089 Bacteria 14328
362 Ga0496101_0222773 3300048904 Bacteria 1464
363 Ga0496102_0066774 3300048905 Bacteria 3297
364 Ga0496104_0024818 3300048907 Bacteria 5519
365 Ga0496105_0085818 3300048908 Bacteria 2601
366 Ga0496106_0078565 3300048909 Bacteria 2532
367 Ga0496108_0002950 3300048911 Bacteria 13680
368 Ga0496108_0047461 3300048911 Bacteria 3589
369 Ga0496108_0351197 3300048911 Unclassified 1287
370 Ga0496109_0004294 3300048912 Bacteria 11902
371 Ga0496109_0028658 3300048912 Bacteria 4983
372 Ga0496110_0019851 3300048913 Bacteria 5664
373 Ga0496110_0030792 3300048913 Bacteria 4627
374 Ga0496110_0042030 3300048913 Bacteria 3990
375 Ga0496110_0181746 3300048913 Unclassified 1910
376 Ga0496111_0010998 3300048914 Bacteria 6090
377 Ga0496111_0011166 3300048914 Bacteria 6046
378 Ga0496111_0188827 3300048914 Bacteria 1532
379 Ga0496112_0002401 3300048915 Bacteria 15069
380 Ga0496112_0022241 3300048915 Bacteria 6041
381 Ga0496112_0061775 3300048915 Bacteria 3694
382 Ga0496113_0011147 3300048916 Bacteria 5981
383 Ga0496113_0012396 3300048916 Bacteria 5728
384 Ga0501067_0005288 3300049583 Bacteria 7170
385 Ga0501067_0020575 3300049583 Bacteria 3652
386 Ga0501069_0010112 3300049585 Bacteria 4991
387 Ga0501207_001010 3300049654 Bacteria 3419
388 Ga0501216_003138 3300049660 Bacteria 2394
389 Ga0501217_005830 3300049661 Unclassified 2590
390 Ga0501227_001899 3300049665 Bacteria 4631
391 Ga0501233_000236 3300049668 Bacteria 8343
392 Ga0501225_0000779 3300049705 Bacteria 9947
393 Ga0501229_005016 3300049706 Unclassified 1617
394 Ga0501234_001206 3300049707 Bacteria 4076
395 Ga0501241_006644 3300049758 Unclassified 2125
396 Ga0501226_000853 3300049853 Bacteria 4084
397 nmdc:mga05p37_17480_c1 3300050507 Bacteria 8656
398 nmdc:mga09592_243937_c1 3300050508 Bacteria 1557
399 nmdc:mga06r32_91175_c1 3300050510 Bacteria 2978
400 nmdc:mga08y16_4844_c1 3300050511 Bacteria 14046
401 nmdc:mga0n895_446784_c1 3300050512 Bacteria 1305
402 nmdc:mga0n895_94376_c1 3300050512 Bacteria 2995
403 nmdc:mga0rr50_23235_c1 3300050513 Bacteria 4271
404 nmdc:mga08x19_4039_c1 3300050514 Bacteria 8722
405 nmdc:mga08x19_7933_c1 3300050514 Bacteria 6309
406 nmdc:mga0a205_168931_c1 3300050515 Unclassified 2083
407 nmdc:mga0a205_42796_c1 3300050515 Bacteria 4365
408 nmdc:mga0a205_84368_c1 3300050515 Bacteria 3068
409 Ga0207676_10025726
410 JGI24751J29686_10000136
411 rootL2_10100127
412 Ga0065714_10064474
413 Ga0065704_10001928
414 Ga0065712_10067750
415 Ga0065712_10070116
416 Ga0065712_10083028
417 Ga0065712_10098365
418 Ga0065715_10007567
419 Ga0065715_10090953
420 Ga0065715_10109531
421 Ga0065715_10150860
422 Ga0070683_100000382
423 Ga0070683_100032062
424 Ga0070683_100085065
425 Ga0070683_100108155
426 Ga0070690_100000789
427 Ga0070670_100000098
428 Ga0070670_100053829
429 Ga0070670_100115090
430 Ga0068869_100020141
431 Ga0070666_10047463
432 Ga0070666_10068236
433 Ga0070680_100006179
434 Ga0070680_100017426
435 Ga0070680_100095110
436 Ga0070680_100116369
437 Ga0070682_100006815
438 Ga0070682_100132659
439 Ga0068868_100085940
440 Ga0068868_100087537
441 Ga0070660_100032928
442 Ga0070691_10031531
443 Ga0070661_100166104
444 Ga0070692_10034239
445 Ga0070668_100039239
446 Ga0070675_100004132
447 Ga0070671_100115765
448 Ga0070673_100004381
449 Ga0070673_100092514
450 Ga0070673_100178085
451 Ga0070688_100018992
452 Ga0070659_100006737
453 Ga0070667_100047692
454 Ga0070709_10010986
455 Ga0070714_100055843
456 Ga0070714_100164950
457 Ga0070713_100000053
458 Ga0070713_100018086
459 Ga0070713_100024873
460 Ga0070710_10004303
461 Ga0070710_10051997
462 Ga0070710_10064587
463 Ga0070711_100074906
464 Ga0070705_100003263
465 Ga0070705_100026739
466 Ga0070705_100077243
467 Ga0070694_100003204
468 Ga0070694_100032929
469 Ga0070681_10004463
470 Ga0070681_10006697
471 Ga0070681_10007674
472 Ga0070681_10019243
473 Ga0070681_10029595
474 Ga0070681_10146535
475 Ga0068867_100181485
476 Ga0070685_10016579
477 Ga0070679_100001742
478 Ga0070679_100070234
479 Ga0070679_100134237
480 Ga0070684_100009496
481 Ga0070684_100022494
482 Ga0070684_100112408
483 Ga0070684_100303252
484 Ga0068853_100007564
485 Ga0068853_100018847
486 Ga0070672_100062696
487 Ga0070686_100028379
488 Ga0070695_100095600
489 Ga0070695_100108400
490 Ga0070696_100007127
491 Ga0070696_100192421
492 Ga0070693_100002445
493 Ga0070693_100003004
494 Ga0070693_100032660
495 Ga0070693_100079617
496 Ga0070693_100102259
497 Ga0070693_100118612
498 Ga0070693_100129323
499 Ga0070704_100174990
500 Ga0068855_100448126
501 Ga0070664_100018009
502 Ga0070664_100058954
503 Ga0070664_100094610
504 Ga0070664_100120602
505 Ga0070664_100271329
506 Ga0068857_100194259
507 Ga0068856_100001617
508 Ga0068856_100020217
509 Ga0068856_100134735
510 Ga0068856_100154313
511 Ga0068856_100290744
512 Ga0070702_100010707
513 Ga0068852_100005499
514 Ga0068852_100048433
515 Ga0068859_100010560
516 Ga0068859_100015823
517 Ga0068859_100044701
518 Ga0068859_100112025
519 Ga0068859_100201805
520 Ga0068864_100002003
521 Ga0068864_100135269
522 Ga0068851_10001358
523 Ga0068863_100138402
524 Ga0068858_100038049
525 Ga0068858_100254700
526 Ga0068860_100184826
527 Ga0068860_100339127
528 Ga0068862_100176227
529 Ga0081539_10000119
530 Ga0081539_10000884
531 Ga0081539_10017049
532 Ga0070717_10000319
533 Ga0070716_100006865
534 Ga0070716_100083215
535 Ga0070712_100012279
536 Ga0070712_100182460
537 Ga0097621_100046235
538 Ga0097621_100050706
539 Ga0068871_100010219
540 Ga0068871_100098644
541 Ga0075428_100068368
542 Ga0075428_100215431
543 Ga0075431_100098973
544 Ga0075433_10025329
545 Ga0075434_100101089
546 Ga0075434_100123651
547 Ga0075429_100117866
548 Ga0075436_100001043
549 Ga0075436_100010730
550 Ga0097620_100010560
551 Ga0097620_100015824
552 Ga0097620_100044703
553 Ga0097620_100112023
554 Ga0097620_100201803
555 Ga0075435_100028741
556 Ga0105240_10003514
557 Ga0105240_10049952
558 Ga0105240_10098196
559 Ga0105240_10229373
560 Ga0111539_10043211
561 Ga0111539_10049890
562 Ga0105245_10000465
563 Ga0105245_10010657
564 Ga0105247_10000841
565 Ga0105247_10008706
566 Ga0114129_10028076
567 Ga0114129_10098668
568 Ga0114129_10311563
569 Ga0105243_10014264
570 Ga0105243_10071225
571 Ga0105241_10003816
572 Ga0105241_10008049
573 Ga0105241_10038691
574 Ga0105241_10076223
575 Ga0105242_10023657
576 Ga0105248_10031596
577 Ga0105237_10000199
578 Ga0105237_10039494
579 Ga0105238_10000050
580 Ga0105238_10006866
581 Ga0105238_10121692
582 Ga0105238_10194848
583 Ga0105238_10222495
584 Ga0105249_10115723
585 Ga0105249_10132025
586 Ga0105249_10154200
587 Ga0105239_10020746
588 Ga0105239_10032357
589 Ga0105246_10026382
590 Ga0157373_10005740
591 Ga0157373_10019443
592 Ga0157373_10062738
593 Ga0157371_10019674
594 Ga0157370_10000559
595 Ga0157370_10002128
596 Ga0157370_10003659
597 Ga0157370_10052029
598 Ga0157370_10070720
599 Ga0157369_10003932
600 Ga0157369_10143624
601 Ga0157369_10310512
602 Ga0157378_10353680
603 Ga0163162_10005252
604 Ga0163162_10088608
605 Ga0163162_10225139
606 Ga0163162_10259641
607 Ga0157372_10002104
608 Ga0157372_10006702
609 Ga0157372_10012493
610 Ga0157372_10024373
611 Ga0157372_10073772
612 Ga0157372_10094447
613 Ga0157375_10038676
614 Ga0157375_10272015
615 Ga0157375_10276542
616 Ga0163163_10000465
617 Ga0163163_10071683
618 Ga0163163_10075007
619 Ga0157377_10001443
620 Ga0157379_10029754
621 Ga0157376_10162386
622 Ga0157376_10305965
623 Ga0206356_10528908
624 Ga0207656_10025370
625 Ga0207692_10063947
626 Ga0207710_10000563
627 Ga0207710_10098564
628 Ga0207680_10074379
629 Ga0207699_10019081
630 Ga0207654_10053903
631 Ga0207654_10068637
632 Ga0207707_10005841
633 Ga0207707_10036876
634 Ga0207707_10077475
635 Ga0207707_10233290
636 Ga0207695_10005156
637 Ga0207695_10021655
638 Ga0207695_10040276
639 Ga0207695_10096398
640 Ga0207695_10100888
641 Ga0207671_10001814
642 Ga0207693_10015329
643 Ga0207693_10018804
644 Ga0207660_10021683
645 Ga0207660_10108198
646 Ga0207660_10125912
647 Ga0207657_10018600
648 Ga0207649_10056495
649 Ga0207652_10003948
650 Ga0207652_10009495
651 Ga0207652_10030615
652 Ga0207652_10081219
653 Ga0207652_10153822
654 Ga0207681_10046215
655 Ga0207694_10000060
656 Ga0207694_10006203
657 Ga0207694_10074946
658 Ga0207694_10143978
659 Ga0207694_10164106
660 Ga0207650_10000156
661 Ga0207650_10034365
662 Ga0207659_10105581
663 Ga0207687_10000290
664 Ga0207687_10085628
665 Ga0207700_10001308
666 Ga0207700_10024277
667 Ga0207664_10133223
668 Ga0207664_10207696
669 Ga0207644_10068634
670 Ga0207690_10058494
671 Ga0207706_10042933
672 Ga0207709_10115956
673 Ga0207670_10010299
674 Ga0207665_10034016
675 Ga0207665_10039103
676 Ga0207711_10033707
677 Ga0207689_10022435
678 Ga0207661_10004521
679 Ga0207661_10064401
680 Ga0207661_10095063
681 Ga0207661_10103723
682 Ga0207679_10013346
683 Ga0207679_10239197
684 Ga0207667_10148893
685 Ga0207712_10073584
686 Ga0207640_10083948
687 Ga0207677_10074066
688 Ga0207677_10084672
689 Ga0207703_10040173
690 Ga0207703_10045389
691 Ga0207703_10184091
692 Ga0207702_10014622
693 Ga0207702_10102210
694 Ga0207702_10232625
695 Ga0207702_10306767
696 Ga0207648_10213492
697 Ga0207676_10046550
698 Ga0207676_10172126
699 Ga0207674_10002287
700 Ga0207674_10024472
701 Ga0207698_10086285
702 Ga0268265_10156790
703 Ga0268264_10063846
704 Ga0268264_10075759
705 Ga0268264_10222229
706 Ga0307408_100021683
707 Ga0307408_100066790
708 Ga0307405_10038778
709 Ga0307413_10025306
710 Ga0307413_10113512
711 Ga0307410_10005279
712 Ga0307406_10002927
713 Ga0307406_10082336
714 Ga0307407_10001597
715 Ga0307407_10057267
716 Ga0307409_100000372
717 Ga0307409_100101910
718 Ga0307416_100009648
719 Ga0307416_100036245
720 Ga0307416_100136295
721 Ga0307416_100269582
722 Ga0307416_100297400
723 Ga0307414_10001159
724 Ga0307414_10035799
725 Ga0307411_10003551
726 Ga0307411_10029299
727 Ga0307411_10057988
728 Ga0307411_10091723
729 Ga0307415_100002912
730 Ga0307415_100040643
731 Ga0307415_100046721
732 Ga0373959_0000692
733 Ga0373926_0002237
734 Ga0373941_0004897
735 Ga0373941_0035499
736 Ga0373943_0003597
737 Ga0373946_0015428
738 Ga0373935_0003159
739 Ga0373927_0002989
740 Ga0373947_0010281
741 Ga0373925_0020953
742 Ga0395899_0150672
743 Ga0395900_0007991
744 Ga0395898_0033120
745 Ga0395898_0263169
746 Ga0395905_0021233
747 Ga0395901_0013172
748 Ga0395901_0044432
749 Ga0436365_0064377
750 Ga0436365_0888939
751 Ga0439458_0007486
752 Ga0451577_0121290
753 Ga0466961_0001222
754 Ga0466959_0072518
755 Ga0466967_0159307
756 Ga0495603_0018388
757 Ga0495580_0004344
758 Ga0495639_0000705
759 Ga0495594_0022893
760 Ga0495630_0001962
761 Ga0495630_0002227
762 Ga0495665_0000567
763 Ga0495588_0000502
764 Ga0495658_0000243
765 Ga0495581_0002171
766 Ga0495581_0012237
767 Ga0495674_0060057
768 Ga0495593_0001324
769 Ga0495614_0000677
770 Ga0496101_0222773
771 Ga0496102_0066774
772 Ga0496104_0024818
773 Ga0496105_0085818
774 Ga0496106_0078565
775 Ga0496108_0002950
776 Ga0496108_0047461
777 Ga0496108_0351197
778 Ga0496109_0004294
779 Ga0496109_0028658
780 Ga0496110_0019851
781 Ga0496110_0030792
782 Ga0496110_0042030
783 Ga0496110_0181746
784 Ga0496111_0010998
785 Ga0496111_0011166
786 Ga0496111_0188827
787 Ga0496112_0002401
788 Ga0496112_0022241
789 Ga0496112_0061775
790 Ga0496113_0011147
791 Ga0496113_0012396
792 Ga0501067_0005288
793 Ga0501067_0020575
794 Ga0501069_0010112
795 Ga0501207_001010
796 Ga0501216_003138
797 Ga0501217_005830
798 Ga0501227_001899
799 Ga0501233_000236
800 Ga0501225_0000779
801 Ga0501229_005016
802 Ga0501234_001206
803 Ga0501241_006644
804 Ga0501226_000853
805 nmdc:mga05p37_17480_c1
806 nmdc:mga09592_243937_c1
807 nmdc:mga06r32_91175_c1
808 nmdc:mga08y16_4844_c1
809 nmdc:mga0n895_446784_c1
810 nmdc:mga0n895_94376_c1
811 nmdc:mga0rr50_23235_c1
812 nmdc:mga08x19_4039_c1
813 nmdc:mga08x19_7933_c1
814 nmdc:mga0a205_168931_c1
815 nmdc:mga0a205_42796_c1
816 nmdc:mga0a205_84368_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01566

Nramp

Natural resistance-associated macrophage protein-like

44

396

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qia-assembly1.cif.gz_A structure of apo-elenrmt in complex with two nanobodies at 3.5a 0.9144 10 403
8e6l-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter d296a mutant in an inward-open, manganese-bound state 0.894 9 403
6c3i-assembly1.cif.gz_A crystal structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g45r mutant in an inward occluded state 0.8937 9 404
7qia-assembly1.cif.gz_A structure of apo-elenrmt in complex with two nanobodies at 3.5a 0.8928 10 403
8e6m-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wt in an inward-open, cadmium-bound state 0.8927 7 403
ID Description Score Start End Superfamily
af_P9WIZ5_52_401_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8875 25 375 1.20.1740.10
af_P9WIZ5_52_401_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8803 25 375 1.20.1740.10
af_Q553K4_170_526_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8669 25 375 1.20.1740.10
af_Q8I3M7_238_670_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8552 10 394 1.20.1740.10
af_Q553K4_170_526_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8509 25 375 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A527HR38-F1-model_v4 Divalent metal cation transporter 0.9817 1 226 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755
AF-A0A7W5T167-F1-model_v4 Mn2+/Fe2+ NRAMP family transporter 0.9815 6 405 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755
AF-A0A3D1TWD4-F1-model_v4 Divalent metal cation transporter 0.9767 1 401 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A2V8A7G4-F1-model_v4 Divalent metal cation transporter 0.976 61 405 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A527HR38-F1-model_v4 Divalent metal cation transporter 0.9732 1 226 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755

Map