F436742

General Info

Members Datasets Scaffolds Average Seq Length
408 212 816 125

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_11150615|Ga0207640_111506152
Length 149
Sequence MPGPGRGGRGPPESVVVTGTGTDLLDIEVIGNALPPGRVEEAVAYAAASGGVEEGHVAIEFVSAERIAELNETWRGKIGPTDVLSFPVDEDEVDPLGERELGDVFICPEYTSDLVEAVVHGVLHLTGMDHEADEGEMLAVQAEIMGWLR

Samples

Sample ID Description Type Environment
1 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
125 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
131 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
132 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
133 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
134 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
135 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
136 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
137 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 6.13
Rhizosphere 89.71
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207640_11150615 3300025981 Unclassified 688
2 JGI25406J46586_10024422 3300003203 Bacteria 2369
3 JGI25407J50210_10053945 3300003373 Bacteria 1016
4 Ga0070658_11123019 3300005327 Bacteria 684
5 Ga0070676_10643767 3300005328 Bacteria 769
6 Ga0070683_100120092 3300005329 Bacteria 2482
7 Ga0070683_100622258 3300005329 Bacteria 1033
8 Ga0070683_101764680 3300005329 Bacteria 595
9 Ga0070670_100364791 3300005331 Bacteria 1270
10 Ga0070682_100784434 3300005337 Bacteria 772
11 Ga0068868_100799403 3300005338 Bacteria 851
12 Ga0068868_101785868 3300005338 Bacteria 581
13 Ga0070689_101539526 3300005340 Bacteria 603
14 Ga0070692_10727243 3300005345 Bacteria 671
15 Ga0070674_100195150 3300005356 Bacteria 1559
16 Ga0070674_100966540 3300005356 Bacteria 745
17 Ga0070659_100170835 3300005366 Bacteria 1781
18 Ga0070659_100183354 3300005366 Bacteria 1718
19 Ga0070705_100228886 3300005440 Bacteria 1292
20 Ga0070700_100117597 3300005441 Bacteria 1776
21 Ga0070663_100653129 3300005455 Bacteria 890
22 Ga0070678_100648520 3300005456 Bacteria 947
23 Ga0070678_101761079 3300005456 Bacteria 584
24 Ga0070681_10956096 3300005458 Bacteria 776
25 Ga0068867_101059171 3300005459 Bacteria 738
26 Ga0070679_100795681 3300005530 Bacteria 889
27 Ga0070679_101426551 3300005530 Bacteria 639
28 Ga0070684_100182975 3300005535 Bacteria 1906
29 Ga0070672_100088197 3300005543 Bacteria 2497
30 Ga0070672_100507504 3300005543 Bacteria 1044
31 Ga0070665_101621905 3300005548 Bacteria 655
32 Ga0070664_100267329 3300005564 Bacteria 1540
33 Ga0068857_100211497 3300005577 Bacteria 1770
34 Ga0068857_100795772 3300005577 Bacteria 903
35 Ga0068854_101346745 3300005578 Bacteria 644
36 Ga0070702_100782931 3300005615 Bacteria 736
37 Ga0068864_102643659 3300005618 Bacteria 508
38 Ga0068866_10270305 3300005718 Bacteria 1049
39 Ga0068866_10540255 3300005718 Bacteria 778
40 Ga0068866_10612023 3300005718 Bacteria 737
41 Ga0068861_100130060 3300005719 Bacteria 2043
42 Ga0068870_10169535 3300005840 Bacteria 1301
43 Ga0068870_10251504 3300005840 Bacteria 1096
44 Ga0068862_102638333 3300005844 Bacteria 514
45 Ga0081455_10298139 3300005937 Bacteria 1158
46 Ga0081455_10328285 3300005937 Bacteria 1087
47 Ga0081455_10729983 3300005937 Bacteria 628
48 Ga0081538_10000010 3300005981 Bacteria 164857
49 Ga0081538_10002657 3300005981 Bacteria 17255
50 Ga0081538_10085419 3300005981 Bacteria 1658
51 Ga0081538_10202192 3300005981 Bacteria 814
52 Ga0081540_1018704 3300005983 Bacteria 4240
53 Ga0081540_1069029 3300005983 Bacteria 1644
54 Ga0081539_10004464 3300005985 Bacteria 15425
55 Ga0070712_101189793 3300006175 Unclassified 663
56 Ga0097621_101277488 3300006237 Bacteria 693
57 Ga0075428_102078760 3300006844 Bacteria 588
58 Ga0075428_102374965 3300006844 Bacteria 545
59 Ga0075430_100585631 3300006846 Bacteria 920
60 Ga0075431_100660095 3300006847 Bacteria 1026
61 Ga0075431_100918374 3300006847 Bacteria 844
62 Ga0075433_10009335 3300006852 Bacteria 7842
63 Ga0075429_101050705 3300006880 Bacteria 712
64 Ga0075429_101804513 3300006880 Bacteria 530
65 Ga0068865_100516132 3300006881 Bacteria 998
66 Ga0068865_100749412 3300006881 Bacteria 839
67 Ga0068865_101015716 3300006881 Bacteria 727
68 Ga0111539_10005921 3300009094 Bacteria 15792
69 Ga0111539_10447671 3300009094 Bacteria 1504
70 Ga0111539_10915768 3300009094 Bacteria 1019
71 Ga0111539_12716287 3300009094 Bacteria 574
72 Ga0105245_11380771 3300009098 Bacteria 754
73 Ga0105245_11645789 3300009098 Bacteria 694
74 Ga0114129_10476927 3300009147 Bacteria 1633
75 Ga0114129_12370317 3300009147 Bacteria 636
76 Ga0105243_10367481 3300009148 Bacteria 1326
77 Ga0105243_10651959 3300009148 Bacteria 1020
78 Ga0105243_10950736 3300009148 Bacteria 858
79 Ga0105243_10983917 3300009148 Bacteria 845
80 Ga0105243_11884371 3300009148 Bacteria 630
81 Ga0105243_13081601 3300009148 Bacteria 505
82 Ga0105242_10697385 3300009176 Bacteria 993
83 Ga0105248_10808543 3300009177 Bacteria 1058
84 Ga0105237_10000495 3300009545 Bacteria 55778
85 Ga0105237_10516977 3300009545 Bacteria 1200
86 Ga0105238_11368222 3300009551 Bacteria 735
87 Ga0105249_10997179 3300009553 Bacteria 906
88 Ga0105249_11018699 3300009553 Bacteria 897
89 Ga0105249_11489255 3300009553 Bacteria 749
90 Ga0105239_10666986 3300010375 Bacteria 1188
91 Ga0105239_12275793 3300010375 Bacteria 631
92 Ga0157373_11220432 3300013100 Bacteria 567
93 Ga0157374_12800715 3300013296 Bacteria 515
94 Ga0163162_11280801 3300013306 Bacteria 833
95 Ga0163162_11523431 3300013306 Bacteria 762
96 Ga0163162_11918761 3300013306 Bacteria 678
97 Ga0157372_10631322 3300013307 Bacteria 1248
98 Ga0157372_11574364 3300013307 Bacteria 757
99 Ga0157375_12942242 3300013308 Bacteria 569
100 Ga0163163_10981825 3300014325 Bacteria 908
101 Ga0163163_11180212 3300014325 Bacteria 828
102 Ga0157380_10922772 3300014326 Bacteria 901
103 Ga0157380_11578266 3300014326 Bacteria 711
104 Ga0157377_10597448 3300014745 Bacteria 787
105 Ga0157377_11016906 3300014745 Bacteria 629
106 Ga0157376_13111502 3300014969 Bacteria 502
107 Ga0206356_11759084 3300020070 Bacteria 648
108 Ga0213874_10108210 3300021377 Bacteria 932
109 Ga0213876_10054799 3300021384 Bacteria 2105
110 Ga0213875_10030455 3300021388 Bacteria 2554
111 Ga0207426_1012226 3300025302 Bacteria 3233
112 Ga0207426_1047923 3300025302 Bacteria 1286
113 Ga0207642_10281852 3300025899 Bacteria 956
114 Ga0207642_10410873 3300025899 Bacteria 812
115 Ga0207642_10470271 3300025899 Bacteria 765
116 Ga0207645_10054397 3300025907 Bacteria 2556
117 Ga0207643_10070921 3300025908 Bacteria 2004
118 Ga0207643_10120654 3300025908 Bacteria 1553
119 Ga0207705_10734239 3300025909 Bacteria 767
120 Ga0207705_11021618 3300025909 Bacteria 638
121 Ga0207707_10155113 3300025912 Bacteria 2003
122 Ga0207707_10265109 3300025912 Bacteria 1490
123 Ga0207695_10509655 3300025913 Bacteria 1085
124 Ga0207671_10004070 3300025914 Bacteria 14163
125 Ga0207662_10219591 3300025918 Bacteria 1237
126 Ga0207662_10765000 3300025918 Bacteria 679
127 Ga0207657_10349474 3300025919 Bacteria 1166
128 Ga0207652_10421249 3300025921 Bacteria 1204
129 Ga0207694_10659883 3300025924 Bacteria 881
130 Ga0207650_10373474 3300025925 Bacteria 1177
131 Ga0207687_10953459 3300025927 Bacteria 735
132 Ga0207700_10762461 3300025928 Bacteria 865
133 Ga0207690_10614550 3300025932 Bacteria 888
134 Ga0207690_11384641 3300025932 Bacteria 588
135 Ga0207706_10349829 3300025933 Bacteria 1285
136 Ga0207686_10405512 3300025934 Bacteria 1039
137 Ga0207709_10186772 3300025935 Bacteria 1468
138 Ga0207709_10325537 3300025935 Bacteria 1152
139 Ga0207709_11236851 3300025935 Bacteria 616
140 Ga0207709_11300673 3300025935 Bacteria 601
141 Ga0207669_11049780 3300025937 Bacteria 686
142 Ga0207704_10065542 3300025938 Bacteria 2275
143 Ga0207704_10094778 3300025938 Bacteria 1972
144 Ga0207704_10469628 3300025938 Bacteria 1008
145 Ga0207691_10071626 3300025940 Bacteria 3127
146 Ga0207711_10610128 3300025941 Bacteria 1018
147 Ga0207689_10172565 3300025942 Bacteria 1783
148 Ga0207661_10029373 3300025944 Bacteria 4222
149 Ga0207661_10310549 3300025944 Bacteria 1415
150 Ga0207661_11360745 3300025944 Bacteria 652
151 Ga0207679_11461531 3300025945 Bacteria 627
152 Ga0207712_11537017 3300025961 Bacteria 596
153 Ga0207668_11149781 3300025972 Bacteria 697
154 Ga0207640_10649440 3300025981 Bacteria 899
155 Ga0207640_11177020 3300025981 Bacteria 681
156 Ga0207677_10968399 3300026023 Bacteria 770
157 Ga0207677_11072448 3300026023 Bacteria 733
158 Ga0207703_10908518 3300026035 Bacteria 843
159 Ga0207678_10841532 3300026067 Bacteria 810
160 Ga0207708_10014253 3300026075 Bacteria 5945
161 Ga0207708_10288418 3300026075 Bacteria 1332
162 Ga0207708_10442120 3300026075 Bacteria 1081
163 Ga0207708_11222307 3300026075 Bacteria 657
164 Ga0207641_11608453 3300026088 Bacteria 652
165 Ga0207648_10498713 3300026089 Bacteria 1114
166 Ga0207648_10610192 3300026089 Bacteria 1006
167 Ga0207676_11779272 3300026095 Bacteria 615
168 Ga0207674_10312011 3300026116 Bacteria 1522
169 Ga0207674_10639023 3300026116 Bacteria 1028
170 Ga0207675_100194617 3300026118 Bacteria 1946
171 Ga0207675_100319980 3300026118 Bacteria 1514
172 Ga0207675_100755409 3300026118 Bacteria 984
173 Ga0207675_101303531 3300026118 Bacteria 747
174 Ga0207683_10693289 3300026121 Bacteria 944
175 Ga0207683_11644125 3300026121 Bacteria 592
176 Ga0268266_10441748 3300028379 Bacteria 1236
177 Ga0268266_10962598 3300028379 Bacteria 826
178 Ga0307408_100139603 3300031548 Bacteria 1901
179 Ga0307405_10324805 3300031731 Bacteria 1177
180 Ga0307405_10636002 3300031731 Bacteria 875
181 Ga0307405_11833511 3300031731 Bacteria 540
182 Ga0307413_10025084 3300031824 Bacteria 3262
183 Ga0307413_10328185 3300031824 Bacteria 1172
184 Ga0307413_10345400 3300031824 Bacteria 1146
185 Ga0307413_10616933 3300031824 Bacteria 890
186 Ga0307413_10684908 3300031824 Bacteria 850
187 Ga0307413_10751294 3300031824 Bacteria 815
188 Ga0307413_10835714 3300031824 Bacteria 777
189 Ga0307410_10270151 3300031852 Bacteria 1330
190 Ga0307410_10324818 3300031852 Bacteria 1222
191 Ga0307410_10460992 3300031852 Bacteria 1039
192 Ga0307410_10824569 3300031852 Bacteria 790
193 Ga0307406_10053497 3300031901 Bacteria 2572
194 Ga0307406_10192546 3300031901 Bacteria 1494
195 Ga0307406_10221473 3300031901 Bacteria 1406
196 Ga0307406_10584844 3300031901 Bacteria 918
197 Ga0307406_10710346 3300031901 Bacteria 840
198 Ga0307406_11013798 3300031901 Bacteria 713
199 Ga0307407_10052365 3300031903 Bacteria 2344
200 Ga0307407_10308337 3300031903 Bacteria 1106
201 Ga0307407_10584743 3300031903 Bacteria 829
202 Ga0307407_10664065 3300031903 Bacteria 782
203 Ga0307409_100045221 3300031995 Bacteria 3322
204 Ga0307409_100093316 3300031995 Bacteria 2473
205 Ga0307409_100118589 3300031995 Bacteria 2235
206 Ga0307409_100355493 3300031995 Bacteria 1384
207 Ga0307409_100389999 3300031995 Bacteria 1327
208 Ga0307409_100625981 3300031995 Bacteria 1067
209 Ga0307409_100769668 3300031995 Bacteria 968
210 Ga0307409_100839161 3300031995 Bacteria 929
211 Ga0307409_101325156 3300031995 Bacteria 745
212 Ga0307409_101503796 3300031995 Bacteria 701
213 Ga0307409_101514805 3300031995 Bacteria 698
214 Ga0307409_102160450 3300031995 Bacteria 586
215 Ga0307416_100017428 3300032002 Bacteria 5027
216 Ga0307416_100581761 3300032002 Bacteria 1197
217 Ga0307416_100664839 3300032002 Bacteria 1128
218 Ga0307416_102348322 3300032002 Bacteria 633
219 Ga0307414_11216019 3300032004 Bacteria 698
220 Ga0307415_100030856 3300032126 Bacteria 3446
221 Ga0307415_100062906 3300032126 Bacteria 2576
222 Ga0307415_100769734 3300032126 Bacteria 876
223 Ga0307415_100923427 3300032126 Bacteria 806
224 Ga0307415_101762200 3300032126 Bacteria 598
225 Ga0395900_0263548 3300037418 Bacteria 1720
226 Ga0395898_0347619 3300037466 Bacteria 1414
227 Ga0395898_0607644 3300037466 Bacteria 1036
228 Ga0436364_0163811 3300037853 Bacteria 2627
229 Ga0436364_0358577 3300037853 Bacteria 27430
230 Ga0395901_0231949 3300038443 Bacteria 1927
231 Ga0395901_0418905 3300038443 Bacteria 1374
232 Ga0395901_1354203 3300038443 Bacteria 672
233 Ga0436365_1791734 3300039437 Bacteria 2464
234 Ga0436360_0246896 3300039438 Bacteria 1049
235 Ga0436363_0733487 3300039450 Bacteria 1985
236 Ga0436363_0919353 3300039450 Bacteria 695
237 Ga0436363_1259254 3300039450 Bacteria 2539
238 Ga0439453_0121618 3300041408 Bacteria 599
239 Ga0451797_1516141 3300041453 Bacteria 1486
240 Ga0451843_0483934 3300041509 Bacteria 777
241 Ga0451855_1587609 3300041511 Bacteria 531
242 Ga0451855_2046738 3300041511 Bacteria 591
243 Ga0451853_3786747 3300041512 Bacteria 892
244 Ga0439448_0260432 3300042005 Bacteria 613
245 Ga0439451_086179 3300042009 Bacteria 632
246 Ga0439463_124857 3300042016 Bacteria 665
247 Ga0450914_012527 3300042118 Bacteria 851
248 Ga0450902_011612 3300042137 Bacteria 1402
249 Ga0439458_0040455 3300042157 Bacteria 1130
250 Ga0439459_0095988 3300042438 Bacteria 719
251 Ga0450916_076945 3300042530 Bacteria 564
252 Ga0439440_0040602 3300042993 Bacteria 1133
253 Ga0466969_0427608 3300044656 Bacteria 602
254 Ga0466972_0206918 3300044658 Bacteria 919
255 Ga0466965_0325584 3300044683 Bacteria 838
256 Ga0466966_0275954 3300044684 Bacteria 1011
257 Ga0466961_0655765 3300044693 Bacteria 630
258 Ga0466963_0054168 3300044694 Bacteria 2665
259 Ga0466963_0087190 3300044694 Bacteria 2122
260 Ga0466963_0211928 3300044694 Bacteria 1356
261 Ga0466963_0364856 3300044694 Bacteria 1017
262 Ga0466963_0524841 3300044694 Bacteria 836
263 Ga0466963_0525055 3300044694 Bacteria 836
264 Ga0466963_0606535 3300044694 Bacteria 773
265 Ga0466963_0675551 3300044694 Bacteria 729
266 Ga0466963_1104626 3300044694 Bacteria 558
267 Ga0466963_1184756 3300044694 Bacteria 537
268 Ga0466964_0116137 3300044706 Bacteria 1200
269 Ga0466964_0297818 3300044706 Bacteria 812
270 Ga0466964_0396370 3300044706 Bacteria 720
271 Ga0466971_0013094 3300044719 Bacteria 3638
272 Ga0466971_0043830 3300044719 Bacteria 2010
273 Ga0466971_0234685 3300044719 Bacteria 871
274 Ga0466971_0400225 3300044719 Bacteria 669
275 Ga0466968_0087142 3300044735 Bacteria 1379
276 Ga0466968_0109669 3300044735 Bacteria 1240
277 Ga0466970_0434064 3300044765 Bacteria 752
278 Ga0466957_0931356 3300044842 Bacteria 622
279 Ga0466960_0160205 3300044901 Bacteria 1208
280 Ga0466960_0272974 3300044901 Bacteria 945
281 Ga0466960_0739726 3300044901 Bacteria 592
282 Ga0466959_1166847 3300045049 Bacteria 512
283 Ga0466958_0095319 3300045836 Bacteria 1845
284 Ga0466958_0247392 3300045836 Bacteria 1140
285 Ga0466958_0492948 3300045836 Bacteria 795
286 Ga0466967_0032934 3300045976 Bacteria 4382
287 Ga0466967_0148278 3300045976 Bacteria 2190
288 Ga0466967_0187672 3300045976 Bacteria 1952
289 Ga0466967_0208118 3300045976 Bacteria 1855
290 Ga0466967_0296587 3300045976 Bacteria 1554
291 Ga0466967_0462152 3300045976 Bacteria 1242
292 Ga0466967_0484279 3300045976 Bacteria 1212
293 Ga0466967_0543143 3300045976 Bacteria 1143
294 Ga0466967_0623195 3300045976 Bacteria 1065
295 Ga0466967_0760555 3300045976 Bacteria 961
296 Ga0466967_0796795 3300045976 Bacteria 938
297 Ga0466967_0852514 3300045976 Bacteria 905
298 Ga0466967_1033928 3300045976 Bacteria 818
299 Ga0466967_1161541 3300045976 Bacteria 769
300 Ga0466967_2151992 3300045976 Bacteria 554
301 Ga0495603_0651183 3300046455 Bacteria 603
302 Ga0495584_0166130 3300046491 Bacteria 1122
303 Ga0495609_0446995 3300046538 Bacteria 514
304 Ga0495597_0312027 3300046542 Bacteria 609
305 Ga0495667_0210176 3300046559 Bacteria 1243
306 Ga0495649_0273033 3300046694 Bacteria 865
307 Ga0495615_0175391 3300048090 Bacteria 651
308 Ga0496100_0004067 3300048903 Bacteria 7710
309 Ga0496100_0129978 3300048903 Bacteria 1773
310 Ga0496101_0079691 3300048904 Bacteria 2418
311 Ga0496101_0370097 3300048904 Bacteria 1127
312 Ga0496102_0032747 3300048905 Bacteria 4671
313 Ga0496104_0003622 3300048907 Bacteria 13344
314 Ga0496105_0090919 3300048908 Bacteria 2521
315 Ga0496105_0291047 3300048908 Bacteria 1315
316 Ga0496106_0171369 3300048909 Bacteria 1720
317 Ga0496108_0000407 3300048911 Bacteria 35282
318 Ga0496108_0518494 3300048911 Bacteria 1041
319 Ga0496108_1626711 3300048911 Bacteria 534
320 Ga0496109_0004580 3300048912 Bacteria 11540
321 Ga0496109_0463508 3300048912 Bacteria 1197
322 Ga0496110_0000936 3300048913 Bacteria 20525
323 Ga0496111_0013465 3300048914 Bacteria 5567
324 Ga0496111_0786463 3300048914 Bacteria 689
325 Ga0496111_0859997 3300048914 Bacteria 654
326 Ga0496111_1193618 3300048914 Bacteria 539
327 Ga0496112_0021940 3300048915 Bacteria 6077
328 Ga0496112_0623965 3300048915 Bacteria 1009
329 Ga0496113_0028284 3300048916 Bacteria 4030
330 Ga0496114_0487978 3300048917 Bacteria 1090
331 Ga0496114_1007343 3300048917 Bacteria 716
332 Ga0496126_0440257 3300048929 Bacteria 1051
333 Ga0501033_0080616 3300049570 Bacteria 2388
334 Ga0501033_0551068 3300049570 Bacteria 794
335 Ga0501034_0772691 3300049571 Bacteria 855
336 Ga0501036_0128759 3300049572 Bacteria 2137
337 Ga0501036_0519874 3300049572 Bacteria 990
338 Ga0501037_0151215 3300049573 Bacteria 1659
339 Ga0501037_0305951 3300049573 Bacteria 1103
340 Ga0501038_0640972 3300049574 Bacteria 801
341 Ga0501039_0116291 3300049575 Bacteria 2093
342 Ga0501039_0238038 3300049575 Bacteria 1431
343 Ga0501039_0262848 3300049575 Bacteria 1356
344 Ga0501040_0085573 3300049576 Bacteria 2188
345 Ga0501040_0395188 3300049576 Bacteria 993
346 Ga0501040_0620188 3300049576 Bacteria 781
347 Ga0501041_0093272 3300049577 Bacteria 1859
348 Ga0501041_0224289 3300049577 Bacteria 1179
349 Ga0501041_0672373 3300049577 Bacteria 662
350 Ga0501041_0773375 3300049577 Bacteria 615
351 Ga0501042_0223385 3300049578 Bacteria 1358
352 Ga0501042_0267837 3300049578 Bacteria 1233
353 Ga0501043_0508252 3300049579 Bacteria 899
354 Ga0501046_0884671 3300049580 Bacteria 623
355 Ga0501046_1063352 3300049580 Bacteria 560
356 Ga0501047_0258459 3300049581 Bacteria 1589
357 Ga0501048_0046803 3300049582 Bacteria 3088
358 Ga0501048_0068572 3300049582 Bacteria 2505
359 Ga0501068_0932306 3300049584 Bacteria 572
360 Ga0501071_0062368 3300049587 Bacteria 2701
361 Ga0501071_0264864 3300049587 Bacteria 1298
362 Ga0501071_0561943 3300049587 Bacteria 876
363 Ga0501072_0045431 3300049588 Bacteria 3454
364 Ga0501072_0163955 3300049588 Bacteria 1773
365 Ga0501074_0115357 3300049590 Bacteria 1922
366 Ga0501074_0175255 3300049590 Bacteria 1530
367 Ga0501074_0251300 3300049590 Bacteria 1257
368 Ga0501074_0521585 3300049590 Bacteria 841
369 Ga0501075_0030952 3300049591 Bacteria 3969
370 Ga0501075_0115341 3300049591 Bacteria 2042
371 Ga0501076_0066013 3300049592 Bacteria 2887
372 Ga0501076_0275425 3300049592 Bacteria 1378
373 Ga0501076_0862949 3300049592 Bacteria 746
374 Ga0501077_0192366 3300049593 Bacteria 1296
375 Ga0501249_113879 3300049679 Bacteria 656
376 Ga0501079_0035076 3300049741 Bacteria 3860
377 Ga0501079_0263563 3300049741 Bacteria 1347
378 Ga0501079_0986487 3300049741 Bacteria 663
379 Ga0501079_1331220 3300049741 Bacteria 565
380 Ga0501080_0360962 3300049742 Bacteria 1311
381 Ga0501081_0233383 3300049743 Bacteria 1340
382 Ga0501081_0548638 3300049743 Bacteria 863
383 Ga0501081_0762287 3300049743 Bacteria 727
384 Ga0501083_0057735 3300049744 Bacteria 2598
385 Ga0501083_0532806 3300049744 Bacteria 764
386 Ga0501035_0533162 3300049822 Bacteria 963
387 Ga0501035_0644608 3300049822 Bacteria 859
388 Ga0501045_0113423 3300049824 Bacteria 2010
389 Ga0501045_0539367 3300049824 Bacteria 865
390 nmdc:mga05p37_849810_c1 3300050507 Bacteria 991
391 nmdc:mga09592_322817_c1 3300050508 Bacteria 1337
392 nmdc:mga0qj67_83919_c1 3300050509 Bacteria 2554
393 nmdc:mga06r32_843180_c1 3300050510 Bacteria 875
394 nmdc:mga08y16_1806765_c1 3300050511 Bacteria 564
395 nmdc:mga08y16_4147_c1 3300050511 Bacteria 15131
396 Ga0495619_0000010 3300053085 Bacteria 302390
397 Ga0500588_0083564 3300053146 Bacteria 1073
398 Ga0501084_0674149 3300054114 Bacteria 872
399 Ga0501084_0933821 3300054114 Bacteria 729
400 Ga0590075_044090 3300059424 Bacteria 1142
401 Ga0501082_0020145 3300060353 Bacteria 5748
402 Ga0501082_0423769 3300060353 Bacteria 1162
403 Ga0466962_0061773 3300061719 Bacteria 1788
404 Ga0466962_0103278 3300061719 Bacteria 1369
405 Ga0466962_0121143 3300061719 Bacteria 1262
406 Ga0466962_0170606 3300061719 Bacteria 1059
407 Ga0530510_0079768 3300061734 Bacteria 2381
408 Ga0530510_0171236 3300061734 Bacteria 1608
409 Ga0207640_11150615
410 JGI25406J46586_10024422
411 JGI25407J50210_10053945
412 Ga0070658_11123019
413 Ga0070676_10643767
414 Ga0070683_100120092
415 Ga0070683_100622258
416 Ga0070683_101764680
417 Ga0070670_100364791
418 Ga0070682_100784434
419 Ga0068868_100799403
420 Ga0068868_101785868
421 Ga0070689_101539526
422 Ga0070692_10727243
423 Ga0070674_100195150
424 Ga0070674_100966540
425 Ga0070659_100170835
426 Ga0070659_100183354
427 Ga0070705_100228886
428 Ga0070700_100117597
429 Ga0070663_100653129
430 Ga0070678_100648520
431 Ga0070678_101761079
432 Ga0070681_10956096
433 Ga0068867_101059171
434 Ga0070679_100795681
435 Ga0070679_101426551
436 Ga0070684_100182975
437 Ga0070672_100088197
438 Ga0070672_100507504
439 Ga0070665_101621905
440 Ga0070664_100267329
441 Ga0068857_100211497
442 Ga0068857_100795772
443 Ga0068854_101346745
444 Ga0070702_100782931
445 Ga0068864_102643659
446 Ga0068866_10270305
447 Ga0068866_10540255
448 Ga0068866_10612023
449 Ga0068861_100130060
450 Ga0068870_10169535
451 Ga0068870_10251504
452 Ga0068862_102638333
453 Ga0081455_10298139
454 Ga0081455_10328285
455 Ga0081455_10729983
456 Ga0081538_10000010
457 Ga0081538_10002657
458 Ga0081538_10085419
459 Ga0081538_10202192
460 Ga0081540_1018704
461 Ga0081540_1069029
462 Ga0081539_10004464
463 Ga0070712_101189793
464 Ga0097621_101277488
465 Ga0075428_102078760
466 Ga0075428_102374965
467 Ga0075430_100585631
468 Ga0075431_100660095
469 Ga0075431_100918374
470 Ga0075433_10009335
471 Ga0075429_101050705
472 Ga0075429_101804513
473 Ga0068865_100516132
474 Ga0068865_100749412
475 Ga0068865_101015716
476 Ga0111539_10005921
477 Ga0111539_10447671
478 Ga0111539_10915768
479 Ga0111539_12716287
480 Ga0105245_11380771
481 Ga0105245_11645789
482 Ga0114129_10476927
483 Ga0114129_12370317
484 Ga0105243_10367481
485 Ga0105243_10651959
486 Ga0105243_10950736
487 Ga0105243_10983917
488 Ga0105243_11884371
489 Ga0105243_13081601
490 Ga0105242_10697385
491 Ga0105248_10808543
492 Ga0105237_10000495
493 Ga0105237_10516977
494 Ga0105238_11368222
495 Ga0105249_10997179
496 Ga0105249_11018699
497 Ga0105249_11489255
498 Ga0105239_10666986
499 Ga0105239_12275793
500 Ga0157373_11220432
501 Ga0157374_12800715
502 Ga0163162_11280801
503 Ga0163162_11523431
504 Ga0163162_11918761
505 Ga0157372_10631322
506 Ga0157372_11574364
507 Ga0157375_12942242
508 Ga0163163_10981825
509 Ga0163163_11180212
510 Ga0157380_10922772
511 Ga0157380_11578266
512 Ga0157377_10597448
513 Ga0157377_11016906
514 Ga0157376_13111502
515 Ga0206356_11759084
516 Ga0213874_10108210
517 Ga0213876_10054799
518 Ga0213875_10030455
519 Ga0207426_1012226
520 Ga0207426_1047923
521 Ga0207642_10281852
522 Ga0207642_10410873
523 Ga0207642_10470271
524 Ga0207645_10054397
525 Ga0207643_10070921
526 Ga0207643_10120654
527 Ga0207705_10734239
528 Ga0207705_11021618
529 Ga0207707_10155113
530 Ga0207707_10265109
531 Ga0207695_10509655
532 Ga0207671_10004070
533 Ga0207662_10219591
534 Ga0207662_10765000
535 Ga0207657_10349474
536 Ga0207652_10421249
537 Ga0207694_10659883
538 Ga0207650_10373474
539 Ga0207687_10953459
540 Ga0207700_10762461
541 Ga0207690_10614550
542 Ga0207690_11384641
543 Ga0207706_10349829
544 Ga0207686_10405512
545 Ga0207709_10186772
546 Ga0207709_10325537
547 Ga0207709_11236851
548 Ga0207709_11300673
549 Ga0207669_11049780
550 Ga0207704_10065542
551 Ga0207704_10094778
552 Ga0207704_10469628
553 Ga0207691_10071626
554 Ga0207711_10610128
555 Ga0207689_10172565
556 Ga0207661_10029373
557 Ga0207661_10310549
558 Ga0207661_11360745
559 Ga0207679_11461531
560 Ga0207712_11537017
561 Ga0207668_11149781
562 Ga0207640_10649440
563 Ga0207640_11177020
564 Ga0207677_10968399
565 Ga0207677_11072448
566 Ga0207703_10908518
567 Ga0207678_10841532
568 Ga0207708_10014253
569 Ga0207708_10288418
570 Ga0207708_10442120
571 Ga0207708_11222307
572 Ga0207641_11608453
573 Ga0207648_10498713
574 Ga0207648_10610192
575 Ga0207676_11779272
576 Ga0207674_10312011
577 Ga0207674_10639023
578 Ga0207675_100194617
579 Ga0207675_100319980
580 Ga0207675_100755409
581 Ga0207675_101303531
582 Ga0207683_10693289
583 Ga0207683_11644125
584 Ga0268266_10441748
585 Ga0268266_10962598
586 Ga0307408_100139603
587 Ga0307405_10324805
588 Ga0307405_10636002
589 Ga0307405_11833511
590 Ga0307413_10025084
591 Ga0307413_10328185
592 Ga0307413_10345400
593 Ga0307413_10616933
594 Ga0307413_10684908
595 Ga0307413_10751294
596 Ga0307413_10835714
597 Ga0307410_10270151
598 Ga0307410_10324818
599 Ga0307410_10460992
600 Ga0307410_10824569
601 Ga0307406_10053497
602 Ga0307406_10192546
603 Ga0307406_10221473
604 Ga0307406_10584844
605 Ga0307406_10710346
606 Ga0307406_11013798
607 Ga0307407_10052365
608 Ga0307407_10308337
609 Ga0307407_10584743
610 Ga0307407_10664065
611 Ga0307409_100045221
612 Ga0307409_100093316
613 Ga0307409_100118589
614 Ga0307409_100355493
615 Ga0307409_100389999
616 Ga0307409_100625981
617 Ga0307409_100769668
618 Ga0307409_100839161
619 Ga0307409_101325156
620 Ga0307409_101503796
621 Ga0307409_101514805
622 Ga0307409_102160450
623 Ga0307416_100017428
624 Ga0307416_100581761
625 Ga0307416_100664839
626 Ga0307416_102348322
627 Ga0307414_11216019
628 Ga0307415_100030856
629 Ga0307415_100062906
630 Ga0307415_100769734
631 Ga0307415_100923427
632 Ga0307415_101762200
633 Ga0395900_0263548
634 Ga0395898_0347619
635 Ga0395898_0607644
636 Ga0436364_0163811
637 Ga0436364_0358577
638 Ga0395901_0231949
639 Ga0395901_0418905
640 Ga0395901_1354203
641 Ga0436365_1791734
642 Ga0436360_0246896
643 Ga0436363_0733487
644 Ga0436363_0919353
645 Ga0436363_1259254
646 Ga0439453_0121618
647 Ga0451797_1516141
648 Ga0451843_0483934
649 Ga0451855_1587609
650 Ga0451855_2046738
651 Ga0451853_3786747
652 Ga0439448_0260432
653 Ga0439451_086179
654 Ga0439463_124857
655 Ga0450914_012527
656 Ga0450902_011612
657 Ga0439458_0040455
658 Ga0439459_0095988
659 Ga0450916_076945
660 Ga0439440_0040602
661 Ga0466969_0427608
662 Ga0466972_0206918
663 Ga0466965_0325584
664 Ga0466966_0275954
665 Ga0466961_0655765
666 Ga0466963_0054168
667 Ga0466963_0087190
668 Ga0466963_0211928
669 Ga0466963_0364856
670 Ga0466963_0524841
671 Ga0466963_0525055
672 Ga0466963_0606535
673 Ga0466963_0675551
674 Ga0466963_1104626
675 Ga0466963_1184756
676 Ga0466964_0116137
677 Ga0466964_0297818
678 Ga0466964_0396370
679 Ga0466971_0013094
680 Ga0466971_0043830
681 Ga0466971_0234685
682 Ga0466971_0400225
683 Ga0466968_0087142
684 Ga0466968_0109669
685 Ga0466970_0434064
686 Ga0466957_0931356
687 Ga0466960_0160205
688 Ga0466960_0272974
689 Ga0466960_0739726
690 Ga0466959_1166847
691 Ga0466958_0095319
692 Ga0466958_0247392
693 Ga0466958_0492948
694 Ga0466967_0032934
695 Ga0466967_0148278
696 Ga0466967_0187672
697 Ga0466967_0208118
698 Ga0466967_0296587
699 Ga0466967_0462152
700 Ga0466967_0484279
701 Ga0466967_0543143
702 Ga0466967_0623195
703 Ga0466967_0760555
704 Ga0466967_0796795
705 Ga0466967_0852514
706 Ga0466967_1033928
707 Ga0466967_1161541
708 Ga0466967_2151992
709 Ga0495603_0651183
710 Ga0495584_0166130
711 Ga0495609_0446995
712 Ga0495597_0312027
713 Ga0495667_0210176
714 Ga0495649_0273033
715 Ga0495615_0175391
716 Ga0496100_0004067
717 Ga0496100_0129978
718 Ga0496101_0079691
719 Ga0496101_0370097
720 Ga0496102_0032747
721 Ga0496104_0003622
722 Ga0496105_0090919
723 Ga0496105_0291047
724 Ga0496106_0171369
725 Ga0496108_0000407
726 Ga0496108_0518494
727 Ga0496108_1626711
728 Ga0496109_0004580
729 Ga0496109_0463508
730 Ga0496110_0000936
731 Ga0496111_0013465
732 Ga0496111_0786463
733 Ga0496111_0859997
734 Ga0496111_1193618
735 Ga0496112_0021940
736 Ga0496112_0623965
737 Ga0496113_0028284
738 Ga0496114_0487978
739 Ga0496114_1007343
740 Ga0496126_0440257
741 Ga0501033_0080616
742 Ga0501033_0551068
743 Ga0501034_0772691
744 Ga0501036_0128759
745 Ga0501036_0519874
746 Ga0501037_0151215
747 Ga0501037_0305951
748 Ga0501038_0640972
749 Ga0501039_0116291
750 Ga0501039_0238038
751 Ga0501039_0262848
752 Ga0501040_0085573
753 Ga0501040_0395188
754 Ga0501040_0620188
755 Ga0501041_0093272
756 Ga0501041_0224289
757 Ga0501041_0672373
758 Ga0501041_0773375
759 Ga0501042_0223385
760 Ga0501042_0267837
761 Ga0501043_0508252
762 Ga0501046_0884671
763 Ga0501046_1063352
764 Ga0501047_0258459
765 Ga0501048_0046803
766 Ga0501048_0068572
767 Ga0501068_0932306
768 Ga0501071_0062368
769 Ga0501071_0264864
770 Ga0501071_0561943
771 Ga0501072_0045431
772 Ga0501072_0163955
773 Ga0501074_0115357
774 Ga0501074_0175255
775 Ga0501074_0251300
776 Ga0501074_0521585
777 Ga0501075_0030952
778 Ga0501075_0115341
779 Ga0501076_0066013
780 Ga0501076_0275425
781 Ga0501076_0862949
782 Ga0501077_0192366
783 Ga0501249_113879
784 Ga0501079_0035076
785 Ga0501079_0263563
786 Ga0501079_0986487
787 Ga0501079_1331220
788 Ga0501080_0360962
789 Ga0501081_0233383
790 Ga0501081_0548638
791 Ga0501081_0762287
792 Ga0501083_0057735
793 Ga0501083_0532806
794 Ga0501035_0533162
795 Ga0501035_0644608
796 Ga0501045_0113423
797 Ga0501045_0539367
798 nmdc:mga05p37_849810_c1
799 nmdc:mga09592_322817_c1
800 nmdc:mga0qj67_83919_c1
801 nmdc:mga06r32_843180_c1
802 nmdc:mga08y16_1806765_c1
803 nmdc:mga08y16_4147_c1
804 Ga0495619_0000010
805 Ga0500588_0083564
806 Ga0501084_0674149
807 Ga0501084_0933821
808 Ga0590075_044090
809 Ga0501082_0020145
810 Ga0501082_0423769
811 Ga0466962_0061773
812 Ga0466962_0103278
813 Ga0466962_0121143
814 Ga0466962_0170606
815 Ga0530510_0079768
816 Ga0530510_0171236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02130

YbeY

Endoribonuclease YbeY

37

148

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.8209 2 122
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.7913 2 122
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.7713 1 122
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.7685 1 121
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.7491 1 122
ID Description Score Start End Superfamily
af_A0A0R0GDI7_137_270_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8969 34 124 3.40.390.30
1oz9A00 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8209 2 122 3.40.390.30
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8021 1 124 3.40.390.30
af_Q2FY02_5_155_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.793 3 124 3.40.390.30
1oz9A00 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.7913 2 122 3.40.390.30
ID Description Score Start End GO Terms
AF-A0A7V9Q2D2-F1-model_v4 rRNA maturation RNAse YbeY 0.9872 2 104 GO:0004222
GO:0004519
GO:0006364
GO:0046872
AF-A0A7W0LQ38-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9828 2 125 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A7V9KCV7-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9805 1 123 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A7V9KCV7-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9727 1 123 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A838FGA7-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9698 11 125 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270

Map