F436717

General Info

Members Datasets Scaffolds Average Seq Length
408 235 382 216

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10034138|Ga0157369_100341382
Length 242
Sequence VEKALPVLVAAFAGVKAQRRGMSAPLVSPSILSADFARLGEEVRAIDEAGADWIHVDVMDGHYVPNLTIGPAVVKALRAYSKKPFDVHLMVSPVDPWLESFADAGADIITVHPEAGPHIHRTLQAIKALGRKAGVSLNPGTPAKMLDYLIEEVDLVLVMSVNPGFGGQSFISSQVKKIAAVRKMIDASGRDIRLEVDGGITAETARQCVEAGADVLVAGSATFKGGPASYAANIAALKGASA

Samples

Sample ID Description Type Environment
1 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
2 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
3 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
4 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
5 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
6 2643221732 Bacillus sp. Root239 Isolate Unclassified
7 2842882022 Bacillus sp. R-71893 Isolate Unclassified
8 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
9 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
10 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
11 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
12 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
13 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
14 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
15 2919720352 Priestia megaterium 4340 Isolate Unclassified
16 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
17 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
18 2929004312 Priestia megaterium 1104 Isolate Unclassified
19 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
20 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
21 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
22 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
23 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
158 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
220 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
221 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
222 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
223 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
224 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
225 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
228 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
233 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
234 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
235 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.14
Metatranscriptomes 0.49
Isolates 6.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.44
Nodule 0.25
Rhizoplane 0.25
Rhizosphere 76.23
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10028971 3300002075 Bacteria 1132
2 JGI25153J46596_10001130 3300003215 Bacteria 16141
3 Ga0006562J51391_1139201 3300003578 Bacteria 7150
4 Ga0006562J51391_1139202 3300003578 Bacteria 6990
5 Ga0055536_1002707 3300003781 Bacteria 9833
6 Ga0055531_10004848 3300003794 Bacteria 8026
7 Ga0055531_10027662 3300003794 Bacteria 1982
8 Ga0065165_1000517 3300005262 Bacteria 59268
9 Ga0070658_10006138 3300005327 Bacteria 9744
10 Ga0070658_10019207 3300005327 Bacteria 5475
11 Ga0070658_10071618 3300005327 Bacteria 2839
12 Ga0070683_100007921 3300005329 Bacteria 9008
13 Ga0070683_100339159 3300005329 Bacteria 1431
14 Ga0070670_100094606 3300005331 Bacteria 2570
15 Ga0068869_100002326 3300005334 Bacteria 11434
16 Ga0068869_100784379 3300005334 Bacteria 818
17 Ga0070680_100033547 3300005336 Bacteria 4139
18 Ga0070680_100051345 3300005336 Bacteria 3364
19 Ga0068868_100000032 3300005338 Bacteria 75803
20 Ga0070660_100000200 3300005339 Bacteria 39931
21 Ga0070660_100008709 3300005339 Bacteria 7102
22 Ga0070660_100025029 3300005339 Bacteria 4434
23 Ga0070660_100042651 3300005339 Bacteria 3464
24 Ga0070660_100732071 3300005339 Bacteria 830
25 Ga0070691_10002825 3300005341 Bacteria 7759
26 Ga0070661_100016364 3300005344 Bacteria 5242
27 Ga0070692_10032693 3300005345 Bacteria 2617
28 Ga0070668_100000003 3300005347 Bacteria 195738
29 Ga0070671_100000061 3300005355 Bacteria 73646
30 Ga0070674_100113742 3300005356 Bacteria 1992
31 Ga0070673_100437889 3300005364 Bacteria 1174
32 Ga0070673_100485292 3300005364 Bacteria 1116
33 Ga0070659_100000005 3300005366 Bacteria 259902
34 Ga0070659_100074438 3300005366 Bacteria 2705
35 Ga0070659_100161778 3300005366 Bacteria 1831
36 Ga0070667_100000035 3300005367 Bacteria 173461
37 Ga0070667_100000253 3300005367 Bacteria 60746
38 Ga0070667_100000354 3300005367 Bacteria 50569
39 Ga0070700_100083399 3300005441 Bacteria 2069
40 Ga0070708_100045218 3300005445 Bacteria 3878
41 Ga0070663_100074779 3300005455 Bacteria 2475
42 Ga0070678_100001120 3300005456 Bacteria 14073
43 Ga0070662_100000320 3300005457 Bacteria 28637
44 Ga0070662_100001434 3300005457 Bacteria 14701
45 Ga0070681_10005576 3300005458 Bacteria 12153
46 Ga0070681_10055832 3300005458 Bacteria 3931
47 Ga0068867_100377621 3300005459 Bacteria 1190
48 Ga0070706_100176184 3300005467 Bacteria 1997
49 Ga0070706_100300743 3300005467 Bacteria 1497
50 Ga0070707_100068440 3300005468 Bacteria 3417
51 Ga0070679_100000777 3300005530 Bacteria 27751
52 Ga0070679_100001202 3300005530 Bacteria 22781
53 Ga0070679_100006516 3300005530 Bacteria 10879
54 Ga0070679_100068659 3300005530 Bacteria 3535
55 Ga0070679_100089806 3300005530 Bacteria 3059
56 Ga0068853_100075613 3300005539 Bacteria 2939
57 Ga0070672_100256415 3300005543 Bacteria 1474
58 Ga0070665_100336934 3300005548 Bacteria 1513
59 Ga0070665_100497649 3300005548 Bacteria 1230
60 Ga0068855_100004377 3300005563 Bacteria 17260
61 Ga0068855_100014871 3300005563 Bacteria 9373
62 Ga0068855_100050219 3300005563 Bacteria 4917
63 Ga0070664_100006106 3300005564 Bacteria 9742
64 Ga0070664_100014003 3300005564 Bacteria 6540
65 Ga0068857_100005055 3300005577 Bacteria 11206
66 Ga0068857_100425871 3300005577 Bacteria 1238
67 Ga0068854_100007922 3300005578 Bacteria 6799
68 Ga0068856_100038520 3300005614 Bacteria 4693
69 Ga0068863_100001950 3300005841 Bacteria 20502
70 Ga0068863_100116264 3300005841 Bacteria 2549
71 Ga0068863_100128499 3300005841 Bacteria 2418
72 Ga0068858_100000274 3300005842 Bacteria 55319
73 Ga0068858_100000465 3300005842 Bacteria 42293
74 Ga0068860_100000106 3300005843 Bacteria 133556
75 Ga0068860_100000466 3300005843 Bacteria 50569
76 Ga0068860_100033060 3300005843 Bacteria 4966
77 Ga0068862_100002361 3300005844 Bacteria 16806
78 Ga0075363_100000103 3300006048 Bacteria 19103
79 Ga0075364_10052556 3300006051 Bacteria 2663
80 Ga0075364_10114831 3300006051 Bacteria 1799
81 Ga0075362_10000026 3300006177 Bacteria 58544
82 Ga0075369_10000639 3300006186 Bacteria 11123
83 Ga0075369_10108116 3300006186 Bacteria 1252
84 Ga0075366_10005316 3300006195 Bacteria 6976
85 Ga0075366_10055774 3300006195 Bacteria 2347
86 Ga0097621_100369554 3300006237 Bacteria 1279
87 Ga0075370_10000033 3300006353 Bacteria 44344
88 Ga0068871_100222757 3300006358 Bacteria 1635
89 Ga0068871_100272393 3300006358 Bacteria 1479
90 Ga0075435_100266945 3300007076 Bacteria 1459
91 Ga0105250_10037351 3300009092 Bacteria 1949
92 Ga0105240_10004645 3300009093 Bacteria 20792
93 Ga0105245_10001668 3300009098 Bacteria 20218
94 Ga0105245_10315045 3300009098 Bacteria 1540
95 Ga0105243_10000490 3300009148 Bacteria 40402
96 Ga0105243_10045277 3300009148 Bacteria 3457
97 Ga0105241_10037406 3300009174 Bacteria 3656
98 Ga0105242_10169662 3300009176 Bacteria 1917
99 Ga0105238_10029528 3300009551 Bacteria 5585
100 Ga0105238_10315306 3300009551 Bacteria 1549
101 Ga0105246_10000017 3300011119 Bacteria 65095
102 Ga0105246_10099747 3300011119 Bacteria 2111
103 Ga0157326_1001194 3300012513 Bacteria 2891
104 Ga0157373_10020046 3300013100 Bacteria 4865
105 Ga0157373_10045680 3300013100 Bacteria 3126
106 Ga0157371_10017754 3300013102 Bacteria 5279
107 Ga0157370_10102190 3300013104 Bacteria 2684
108 Ga0157370_10112011 3300013104 Bacteria 2551
109 Ga0157370_10150991 3300013104 Bacteria 2162
110 Ga0157369_10012382 3300013105 Bacteria 9684
111 Ga0157369_10034138 3300013105 Bacteria 5585
112 Ga0157369_10288903 3300013105 Bacteria 1707
113 Ga0157378_10940596 3300013297 Bacteria 896
114 Ga0157372_10045038 3300013307 Bacteria 4892
115 Ga0157375_10099829 3300013308 Bacteria 2982
116 Ga0157380_10213013 3300014326 Bacteria 1723
117 Ga0157377_10141068 3300014745 Bacteria 1481
118 Ga0209233_1022450 3300025261 Bacteria 1615
119 Ga0209676_1000140 3300025292 Bacteria 176735
120 Ga0209676_1001860 3300025292 Bacteria 17366
121 Ga0209564_1002745 3300025295 Bacteria 13240
122 Ga0209758_1000007 3300025297 Bacteria 1270410
123 Ga0209758_1000238 3300025297 Bacteria 115807
124 Ga0209050_1008455 3300025298 Bacteria 5500
125 Ga0209257_1000036 3300025304 Bacteria 616006
126 Ga0209257_1000292 3300025304 Bacteria 110440
127 Ga0207705_10000454 3300025909 Bacteria 35140
128 Ga0207705_10031964 3300025909 Bacteria 3759
129 Ga0207705_10039261 3300025909 Bacteria 3392
130 Ga0207705_10628954 3300025909 Bacteria 835
131 Ga0207654_10052575 3300025911 Bacteria 2348
132 Ga0207707_10001594 3300025912 Bacteria 20893
133 Ga0207707_10150061 3300025912 Bacteria 2038
134 Ga0207695_10115167 3300025913 Bacteria 2663
135 Ga0207660_10022850 3300025917 Bacteria 4217
136 Ga0207660_10056711 3300025917 Bacteria 2804
137 Ga0207657_10001108 3300025919 Bacteria 28597
138 Ga0207657_10001508 3300025919 Bacteria 24902
139 Ga0207657_10019501 3300025919 Bacteria 6438
140 Ga0207657_10045951 3300025919 Bacteria 3828
141 Ga0207657_10062089 3300025919 Bacteria 3200
142 Ga0207649_10012488 3300025920 Bacteria 4715
143 Ga0207649_10074490 3300025920 Bacteria 2179
144 Ga0207649_10146373 3300025920 Bacteria 1622
145 Ga0207646_10123050 3300025922 Bacteria 2332
146 Ga0207681_10125181 3300025923 Bacteria 1891
147 Ga0207694_10117331 3300025924 Bacteria 2122
148 Ga0207694_10246249 3300025924 Bacteria 1462
149 Ga0207650_10005308 3300025925 Bacteria 8793
150 Ga0207650_10082654 3300025925 Bacteria 2438
151 Ga0207659_10260483 3300025926 Bacteria 1411
152 Ga0207687_10005343 3300025927 Bacteria 8502
153 Ga0207687_10205960 3300025927 Bacteria 1540
154 Ga0207644_10000069 3300025931 Bacteria 75201
155 Ga0207644_10547758 3300025931 Bacteria 957
156 Ga0207690_10000020 3300025932 Bacteria 218439
157 Ga0207690_10001102 3300025932 Bacteria 17215
158 Ga0207690_10517569 3300025932 Bacteria 967
159 Ga0207706_10002504 3300025933 Bacteria 17908
160 Ga0207706_10007530 3300025933 Bacteria 10075
161 Ga0207706_10296428 3300025933 Bacteria 1409
162 Ga0207709_10000005 3300025935 Bacteria 806813
163 Ga0207709_10032686 3300025935 Bacteria 3049
164 Ga0207669_10000111 3300025937 Bacteria 40727
165 Ga0207669_10032779 3300025937 Bacteria 2922
166 Ga0207689_10006651 3300025942 Bacteria 10194
167 Ga0207689_10082767 3300025942 Bacteria 2639
168 Ga0207661_10016504 3300025944 Bacteria 5449
169 Ga0207661_10181712 3300025944 Bacteria 1838
170 Ga0207679_10010720 3300025945 Bacteria 5911
171 Ga0207679_10017384 3300025945 Bacteria 4797
172 Ga0207667_10004526 3300025949 Bacteria 17030
173 Ga0207667_10011624 3300025949 Bacteria 10220
174 Ga0207667_10021893 3300025949 Bacteria 7074
175 Ga0207667_10181473 3300025949 Bacteria 2161
176 Ga0207668_10000006 3300025972 Bacteria 191468
177 Ga0207640_10000775 3300025981 Bacteria 18166
178 Ga0207658_10000026 3300025986 Bacteria 178292
179 Ga0207658_10000160 3300025986 Bacteria 71266
180 Ga0207658_10000862 3300025986 Bacteria 25358
181 Ga0207658_10001346 3300025986 Bacteria 19230
182 Ga0207677_10000100 3300026023 Bacteria 70908
183 Ga0207677_10711168 3300026023 Bacteria 892
184 Ga0207703_10000234 3300026035 Bacteria 63325
185 Ga0207703_10001033 3300026035 Bacteria 26717
186 Ga0207639_10011207 3300026041 Bacteria 6220
187 Ga0207639_10255445 3300026041 Bacteria 1530
188 Ga0207678_10063990 3300026067 Bacteria 3160
189 Ga0207702_10018246 3300026078 Bacteria 5804
190 Ga0207641_10000617 3300026088 Bacteria 38890
191 Ga0207641_10001438 3300026088 Bacteria 23396
192 Ga0207641_10007717 3300026088 Bacteria 8942
193 Ga0207641_10100331 3300026088 Bacteria 2549
194 Ga0207648_10152754 3300026089 Bacteria 2037
195 Ga0207674_10009728 3300026116 Bacteria 10956
196 Ga0207675_101117202 3300026118 Bacteria 808
197 Ga0207683_10001512 3300026121 Bacteria 20946
198 Ga0209281_1009395 3300027111 Bacteria 2300
199 Ga0209983_1010851 3300027665 Bacteria 1861
200 Ga0209974_10009167 3300027876 Bacteria 3361
201 Ga0268265_10001877 3300028380 Bacteria 16711
202 Ga0268264_10000076 3300028381 Bacteria 255518
203 Ga0268264_10000229 3300028381 Bacteria 108305
204 Ga0265337_1071991 3300028556 Bacteria 949
205 Ga0307517_10073512 3300028786 Bacteria 3029
206 Ga0265338_10046426 3300028800 Unclassified 3980
207 Ga0307408_100124908 3300031548 Bacteria 1999
208 Ga0307408_100695434 3300031548 Bacteria 913
209 Ga0307508_10000011 3300031616 Bacteria 248001
210 Ga0307405_10059553 3300031731 Bacteria 2407
211 Ga0307413_10007167 3300031824 Bacteria 5155
212 Ga0307413_10015291 3300031824 Bacteria 3929
213 Ga0307413_10033717 3300031824 Bacteria 2919
214 Ga0307413_10446930 3300031824 Bacteria 1025
215 Ga0307410_10011809 3300031852 Bacteria 5015
216 Ga0307410_10512110 3300031852 Bacteria 989
217 Ga0307406_10001784 3300031901 Bacteria 11764
218 Ga0307406_10003497 3300031901 Bacteria 8553
219 Ga0307406_10326128 3300031901 Bacteria 1190
220 Ga0307407_10006941 3300031903 Bacteria 5088
221 Ga0307407_10262310 3300031903 Bacteria 1189
222 Ga0307412_10012428 3300031911 Bacteria 4965
223 Ga0307412_10034323 3300031911 Bacteria 3233
224 Ga0307412_10040053 3300031911 Bacteria 3030
225 Ga0307412_10050178 3300031911 Bacteria 2753
226 Ga0307412_10158510 3300031911 Bacteria 1678
227 Ga0307412_10491170 3300031911 Bacteria 1020
228 Ga0307409_100050765 3300031995 Bacteria 3170
229 Ga0307409_100073899 3300031995 Bacteria 2722
230 Ga0307409_100146879 3300031995 Bacteria 2040
231 Ga0307409_100274339 3300031995 Bacteria 1555
232 Ga0307416_100004068 3300032002 Bacteria 8742
233 Ga0307416_100008285 3300032002 Bacteria 6692
234 Ga0307416_100275414 3300032002 Bacteria 1655
235 Ga0307416_100828482 3300032002 Bacteria 1022
236 Ga0307414_10007190 3300032004 Bacteria 6248
237 Ga0307414_10008992 3300032004 Bacteria 5709
238 Ga0307414_10031231 3300032004 Bacteria 3491
239 Ga0307414_10032799 3300032004 Bacteria 3424
240 Ga0307414_10059844 3300032004 Bacteria 2691
241 Ga0307414_10088165 3300032004 Bacteria 2295
242 Ga0307414_10109125 3300032004 Bacteria 2101
243 Ga0307414_10116384 3300032004 Bacteria 2046
244 Ga0307414_10209703 3300032004 Bacteria 1591
245 Ga0307414_10394790 3300032004 Bacteria 1200
246 Ga0307414_11012341 3300032004 Bacteria 765
247 Ga0307411_10032046 3300032005 Bacteria 3243
248 Ga0307411_10037349 3300032005 Bacteria 3053
249 Ga0307411_10439505 3300032005 Bacteria 1088
250 Ga0307411_10503056 3300032005 Bacteria 1025
251 Ga0307411_10564147 3300032005 Bacteria 973
252 Ga0307415_100042593 3300032126 Bacteria 3022
253 Ga0307415_100508574 3300032126 Bacteria 1055
254 Ga0373939_0032696 3300035114 Bacteria 1514
255 Ga0316582_0005414 3300036647 Bacteria 6571
256 Ga0316582_0308961 3300036647 Bacteria 1087
257 Ga0316584_0024361 3300036712 Bacteria 4429
258 Ga0316584_0101804 3300036712 Bacteria 2151
259 Ga0436363_1485834 3300039450 Bacteria 2529
260 Ga0451855_0115022 3300041511 Bacteria 708
261 Ga0451853_2130736 3300041512 Bacteria 1126
262 Ga0450912_001322 3300042116 Bacteria 1487
263 Ga0451577_0002751 3300042876 Bacteria 20379
264 Ga0451577_0250129 3300042876 Bacteria 1604
265 Ga0453684_0000011 3300044712 Bacteria 1108399
266 Ga0495638_0396731 3300046460 Bacteria 717
267 Ga0495650_0000046 3300046471 Bacteria 342987
268 Ga0495584_0022791 3300046491 Bacteria 3177
269 Ga0495585_0004652 3300046492 Bacteria 8855
270 Ga0495585_0069072 3300046492 Bacteria 1929
271 Ga0495583_0001362 3300046506 Bacteria 25203
272 Ga0495583_0007181 3300046506 Bacteria 7077
273 Ga0495583_0068334 3300046506 Bacteria 1567
274 Ga0495606_0002185 3300046507 Bacteria 23483
275 Ga0495606_0004507 3300046507 Bacteria 13870
276 Ga0495606_0137333 3300046507 Bacteria 1446
277 Ga0495610_0006053 3300046512 Bacteria 8444
278 Ga0495610_0008028 3300046512 Bacteria 6908
279 Ga0495610_0039100 3300046512 Bacteria 2402
280 Ga0495610_0046990 3300046512 Bacteria 2126
281 Ga0495616_0047438 3300046513 Bacteria 2163
282 Ga0495616_0080042 3300046513 Bacteria 1565
283 Ga0495620_0036313 3300046515 Bacteria 2206
284 Ga0495632_0026857 3300046519 Bacteria 3023
285 Ga0495637_0003649 3300046520 Bacteria 8152
286 Ga0495637_0007824 3300046520 Bacteria 5276
287 Ga0495643_0007490 3300046522 Bacteria 7026
288 Ga0495643_0013120 3300046522 Bacteria 4975
289 Ga0495643_0028115 3300046522 Bacteria 3155
290 Ga0495643_0057205 3300046522 Bacteria 2079
291 Ga0495643_0250601 3300046522 Bacteria 826
292 Ga0495643_0258354 3300046522 Bacteria 810
293 Ga0495648_0000323 3300046524 Bacteria 53106
294 Ga0495642_0015916 3300046528 Bacteria 2928
295 Ga0495654_0000039 3300046530 Bacteria 185363
296 Ga0495598_0007476 3300046537 Bacteria 2509
297 Ga0495621_0042158 3300046539 Bacteria 1606
298 Ga0495622_0007283 3300046557 Bacteria 5137
299 Ga0495633_0000346 3300046558 Bacteria 51470
300 Ga0495633_0141329 3300046558 Bacteria 1113
301 Ga0495633_0160668 3300046558 Bacteria 1037
302 Ga0495668_0027097 3300046616 Bacteria 3247
303 Ga0495611_0052957 3300046648 Bacteria 1831
304 Ga0495611_0162648 3300046648 Bacteria 1043
305 Ga0495625_0000069 3300046660 Bacteria 168800
306 Ga0495625_0000094 3300046660 Bacteria 144517
307 Ga0495625_0000559 3300046660 Bacteria 54547
308 Ga0495625_0001580 3300046660 Bacteria 27097
309 Ga0495625_0008602 3300046660 Bacteria 8687
310 Ga0495625_0024399 3300046660 Bacteria 4603
311 Ga0495625_0029097 3300046660 Bacteria 4135
312 Ga0495625_0034324 3300046660 Bacteria 3745
313 Ga0495625_0044777 3300046660 Bacteria 3202
314 Ga0495625_0158851 3300046660 Bacteria 1515
315 Ga0495625_0375428 3300046660 Bacteria 893
316 Ga0495669_0000628 3300046684 Bacteria 15338
317 Ga0495670_0251730 3300046691 Bacteria 942
318 Ga0495671_0005268 3300046692 Bacteria 7594
319 Ga0495649_0000171 3300046694 Bacteria 56672
320 Ga0495649_0345681 3300046694 Bacteria 752
321 Ga0495589_0000891 3300046794 Bacteria 18525
322 Ga0495600_0001757 3300046809 Bacteria 12125
323 Ga0495672_0004217 3300047320 Bacteria 11890
324 Ga0495683_0001997 3300047323 Bacteria 12691
325 Ga0495677_0004082 3300047445 Bacteria 5637
326 Ga0495673_0000255 3300047469 Bacteria 74313
327 Ga0495673_0127826 3300047469 Bacteria 1001
328 Ga0495686_0022778 3300047472 Bacteria 4139
329 Ga0495686_0053685 3300047472 Bacteria 2525
330 Ga0495626_0022877 3300048091 Unclassified 3084
331 Ga0496110_0644385 3300048913 Bacteria 959
332 Ga0496122_0008001 3300048925 Bacteria 11552
333 Ga0496122_0194990 3300048925 Bacteria 1191
334 Ga0496123_0007095 3300048926 Bacteria 10646
335 Ga0496123_0007685 3300048926 Bacteria 10076
336 Ga0496123_0126823 3300048926 Bacteria 1422
337 Ga0496125_0001248 3300048928 Bacteria 37996
338 Ga0501033_0048299 3300049570 Bacteria 3162
339 Ga0501034_0173032 3300049571 Bacteria 2126
340 Ga0501036_0077648 3300049572 Bacteria 2810
341 Ga0501035_0691999 3300049822 Bacteria 823
342 nmdc:mga03683_54_c1 3300050489 Bacteria 47475
343 nmdc:mga03n38_374_c1 3300050490 Bacteria 11001
344 nmdc:mga00v17_16506_c1 3300050491 Bacteria 4160
345 nmdc:mga00v17_522418_c1 3300050491 Bacteria 769
346 nmdc:mga0k408_100265_c1 3300050493 Bacteria 1707
347 nmdc:mga0k408_133272_c1 3300050493 Bacteria 1475
348 nmdc:mga0k408_30_c1 3300050493 Bacteria 89511
349 nmdc:mga0k408_57598_c1 3300050493 Bacteria 2256
350 nmdc:mga07m45_14_c1 3300050496 Bacteria 154035
351 nmdc:mga07m45_4333_c2 3300050496 Bacteria 6245
352 nmdc:mga07m45_68703_c1 3300050496 Bacteria 2014
353 nmdc:mga0rr50_281055_c1 3300050513 Bacteria 1389
354 nmdc:mga0sz30_285_c1 3300050516 Bacteria 19408
355 Ga0500643_000005 3300053087 Bacteria 539775
356 Ga0500643_001280 3300053087 Bacteria 14856
357 Ga0500643_032770 3300053087 Bacteria 1575
358 Ga0500644_0005526 3300053088 Bacteria 3196
359 Ga0500651_0134570 3300053093 Bacteria 1493
360 Ga0500651_0199410 3300053093 Bacteria 1181
361 Ga0500566_0322913 3300053094 Bacteria 718
362 Ga0500556_0000618 3300053104 Bacteria 22559
363 Ga0500594_0003577 3300053118 Bacteria 3422
364 Ga0500595_004334 3300053119 Bacteria 6387
365 Ga0500597_062145 3300053120 Bacteria 1605
366 Ga0500642_0000689 3300053130 Bacteria 9976
367 Ga0500658_0132379 3300053134 Bacteria 1113
368 Ga0500559_0000090 3300053136 Bacteria 72588
369 Ga0500559_0001343 3300053136 Bacteria 14122
370 Ga0500559_0013053 3300053136 Bacteria 3523
371 Ga0500559_0028982 3300053136 Bacteria 2368
372 Ga0500588_0039151 3300053146 Bacteria 1418
373 Ga0500616_0000934 3300053153 Bacteria 31967
374 Ga0500616_0044620 3300053153 Bacteria 2365
375 Ga0500622_0011278 3300053156 Bacteria 4876
376 Ga0500624_000003 3300053157 Bacteria 253364
377 Ga0500636_0032131 3300053177 Bacteria 3106
378 Ga0500637_0002120 3300053178 Bacteria 8706
379 Ga0500645_000019 3300053730 Bacteria 135445
380 Ga0500645_000627 3300053730 Bacteria 22541
381 Ga0500645_001922 3300053730 Bacteria 9876
382 Ga0500601_011915 3300053737 Bacteria 979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053120 Ga0500597_062145 Ga0500597_062145_993_1574 150
2 3300014745 Ga0157377_10141068 Ga0157377_101410682 156
3 3300041511 Ga0451855_0115022 Ga0451855_0115022_11_613 180
4 3300053157 Ga0500624_000003 Ga0500624_000003_54195_54890 187
5 3300053178 Ga0500637_0002120 Ga0500637_0002120_6933_7628 187
6 3300032005 Ga0307411_10439505 Ga0307411_104395052 188
7 3300005334 Ga0068869_100002326 Ga0068869_1000023264 189
8 3300025942 Ga0207689_10006651 Ga0207689_100066514 189
9 3300053093 Ga0500651_0134570 Ga0500651_0134570_71_730 189
10 3300005367 Ga0070667_100000253 Ga0070667_10000025363 190
11 3300025986 Ga0207658_10001346 Ga0207658_100013466 190
12 3300042876 Ga0451577_0002751 Ga0451577_0002751_9551_10177 190
13 3300044712 Ga0453684_0000011 Ga0453684_0000011_434319_434945 190
14 3300046616 Ga0495668_0027097 Ga0495668_0027097_1605_2234 191
15 3300046660 Ga0495625_0008602 Ga0495625_0008602_7644_8273 191
16 3300046660 Ga0495625_0375428 Ga0495625_0375428_10_639 191
17 3300050496 nmdc:mga07m45_68703_c1 nmdc:mga07m45_68703_c1_394_1023 191
18 3300053087 Ga0500643_032770 Ga0500643_032770_82_711 191
19 3300053730 Ga0500645_000627 Ga0500645_000627_2881_3510 191
20 3300049571 Ga0501034_0173032 Ga0501034_0173032_1006_1638 192
21 3300005445 Ga0070708_100045218 Ga0070708_1000452182 193
22 3300005467 Ga0070706_100176184 Ga0070706_1001761842 193
23 3300005468 Ga0070707_100068440 Ga0070707_1000684402 193
24 3300025922 Ga0207646_10123050 Ga0207646_101230501 193
25 3300032004 Ga0307414_10008992 Ga0307414_100089925 193
26 3300032004 Ga0307414_10032799 Ga0307414_100327992 193
27 3300032004 Ga0307414_10116384 Ga0307414_101163842 193
28 3300032004 Ga0307414_10394790 Ga0307414_103947902 194
29 3300046522 Ga0495643_0057205 Ga0495643_0057205_1348_1998 194
30 3300048091 Ga0495626_0022877 Ga0495626_0022877_964_1614 194
31 3300031901 Ga0307406_10001784 Ga0307406_100017843 195
32 3300048925 Ga0496122_0194990 Ga0496122_0194990_104_763 195
33 3300048926 Ga0496123_0126823 Ga0496123_0126823_113_796 195
34 iso_pu_bacteria 2964375228 2964378799 195
35 3300005467 Ga0070706_100300743 Ga0070706_1003007432 196
36 3300005548 Ga0070665_100336934 Ga0070665_1003369342 196
37 3300005842 Ga0068858_100000274 Ga0068858_10000027424 196
38 3300009098 Ga0105245_10001668 Ga0105245_1000166823 196
39 3300009148 Ga0105243_10045277 Ga0105243_100452773 196
40 3300025927 Ga0207687_10005343 Ga0207687_100053433 196
41 3300025935 Ga0207709_10032686 Ga0207709_100326862 196
42 3300026035 Ga0207703_10001033 Ga0207703_1000103324 196
43 3300031548 Ga0307408_100695434 Ga0307408_1006954342 196
44 iso_pu_bacteria 2929199973 2929201024 196
45 iso_pu_bacteria 8055909800 8055911642 196
46 3300005329 Ga0070683_100339159 Ga0070683_1003391591 197
47 3300005334 Ga0068869_100784379 Ga0068869_1007843791 197
48 3300005339 Ga0070660_100042651 Ga0070660_1000426513 197
49 3300005530 Ga0070679_100068659 Ga0070679_1000686592 197
50 3300005564 Ga0070664_100006106 Ga0070664_1000061066 197
51 3300005578 Ga0068854_100007922 Ga0068854_1000079225 197
52 3300006358 Ga0068871_100222757 Ga0068871_1002227572 197
53 3300009551 Ga0105238_10029528 Ga0105238_100295282 197
54 3300025919 Ga0207657_10045951 Ga0207657_100459512 197
55 3300025920 Ga0207649_10074490 Ga0207649_100744902 197
56 3300025924 Ga0207694_10117331 Ga0207694_101173312 197
57 3300025942 Ga0207689_10082767 Ga0207689_100827672 197
58 3300025944 Ga0207661_10181712 Ga0207661_101817122 197
59 3300025945 Ga0207679_10010720 Ga0207679_100107203 197
60 3300025981 Ga0207640_10000775 Ga0207640_100007753 197
61 3300032005 Ga0307411_10503056 Ga0307411_105030562 197
62 3300046507 Ga0495606_0002185 Ga0495606_0002185_16570_17232 197
63 3300046522 Ga0495643_0028115 Ga0495643_0028115_356_1018 197
64 3300046684 Ga0495669_0000628 Ga0495669_0000628_12674_13336 197
65 3300046694 Ga0495649_0000171 Ga0495649_0000171_35195_35866 197
66 3300046694 Ga0495649_0345681 Ga0495649_0345681_46_708 197
67 3300047469 Ga0495673_0127826 Ga0495673_0127826_107_769 197
68 3300050491 nmdc:mga00v17_522418_c1 nmdc:mga00v17_522418_c1_15_641 197
69 3300053146 Ga0500588_0039151 Ga0500588_0039151_723_1385 197
70 3300053730 Ga0500645_000019 Ga0500645_000019_4249_4911 197
71 iso_pu_bacteria 2643221574 2643884557 197
72 iso_pu_bacteria 2643221605 2644040517 197
73 iso_pu_bacteria 2643221699 2644549059 197
74 iso_pu_bacteria 2643221699 2644553211 197
75 iso_pu_bacteria 2643221732 2644724048 197
76 iso_pu_bacteria 2842882022 2842884191 197
77 iso_pu_bacteria 2895880812 2895881129 197
78 iso_pu_bacteria 2904524088 2904524780 197
79 iso_pu_bacteria 2919143609 2919146624 197
80 iso_pu_bacteria 2919517244 2919518547 197
81 iso_pu_bacteria 2919720352 2919722914 197
82 iso_pu_bacteria 2928093941 2928096558 197
83 iso_pu_bacteria 2929004312 2929006066 197
84 iso_pu_bacteria 2960375949 2960380610 197
85 iso_pu_bacteria 8022893055 8022897864 197
86 iso_pu_bacteria 8022914991 8022917045 197
87 3300009176 Ga0105242_10169662 Ga0105242_101696622 198
88 3300026041 Ga0207639_10255445 Ga0207639_102554452 198
89 3300046537 Ga0495598_0007476 Ga0495598_0007476_751_1410 198
90 3300046539 Ga0495621_0042158 Ga0495621_0042158_363_1022 198
91 3300053119 Ga0500595_004334 Ga0500595_004334_4351_5013 198
92 3300053136 Ga0500559_0013053 Ga0500559_0013053_1469_2131 198
93 3300053737 Ga0500601_011915 Ga0500601_011915_167_829 198
94 iso_pu_bacteria 2643221588 2643951211 198
95 3300005441 Ga0070700_100083399 Ga0070700_1000833993 199
96 3300025933 Ga0207706_10296428 Ga0207706_102964282 199
97 3300028556 Ga0265337_1071991 Ga0265337_10719912 199
98 3300028800 Ga0265338_10046426 Ga0265338_100464263 199
99 3300031824 Ga0307413_10033717 Ga0307413_100337172 199
100 3300031901 Ga0307406_10003497 Ga0307406_100034972 199
101 3300031903 Ga0307407_10262310 Ga0307407_102623101 199
102 3300031911 Ga0307412_10050178 Ga0307412_100501782 199
103 3300031911 Ga0307412_10491170 Ga0307412_104911702 199
104 3300031995 Ga0307409_100073899 Ga0307409_1000738992 199
105 3300032002 Ga0307416_100008285 Ga0307416_1000082859 199
106 3300032004 Ga0307414_10031231 Ga0307414_100312315 199
107 3300032005 Ga0307411_10032046 Ga0307411_100320463 199
108 3300032005 Ga0307411_10564147 Ga0307411_105641472 199
109 3300032126 Ga0307415_100508574 Ga0307415_1005085742 199
110 iso_pu_bacteria 2643221663 2644351392 199
111 iso_pu_bacteria 2894772417 2894774095 199
112 iso_pu_bacteria 2896184354 2896186264 199
113 3300005327 Ga0070658_10006138 Ga0070658_1000613811 200
114 3300005336 Ga0070680_100033547 Ga0070680_1000335473 200
115 3300005338 Ga0068868_100000032 Ga0068868_10000003239 200
116 3300005339 Ga0070660_100000200 Ga0070660_10000020018 200
117 3300005339 Ga0070660_100025029 Ga0070660_1000250295 200
118 3300005339 Ga0070660_100732071 Ga0070660_1007320711 200
119 3300005341 Ga0070691_10002825 Ga0070691_100028255 200
120 3300005366 Ga0070659_100000005 Ga0070659_100000005232 200
121 3300005458 Ga0070681_10005576 Ga0070681_1000557612 200
122 3300005530 Ga0070679_100001202 Ga0070679_1000012022 200
123 3300005563 Ga0068855_100014871 Ga0068855_10001487110 200
124 3300009093 Ga0105240_10004645 Ga0105240_1000464518 200
125 3300009098 Ga0105245_10315045 Ga0105245_103150452 200
126 3300009551 Ga0105238_10315306 Ga0105238_103153061 200
127 3300013104 Ga0157370_10102190 Ga0157370_101021902 200
128 3300025909 Ga0207705_10031964 Ga0207705_100319644 200
129 3300025912 Ga0207707_10001594 Ga0207707_1000159420 200
130 3300025913 Ga0207695_10115167 Ga0207695_101151672 200
131 3300025917 Ga0207660_10056711 Ga0207660_100567113 200
132 3300025919 Ga0207657_10001108 Ga0207657_1000110814 200
133 3300025919 Ga0207657_10062089 Ga0207657_100620893 200
134 3300025924 Ga0207694_10246249 Ga0207694_102462491 200
135 3300025927 Ga0207687_10205960 Ga0207687_102059602 200
136 3300025932 Ga0207690_10000020 Ga0207690_1000002048 200
137 3300025949 Ga0207667_10181473 Ga0207667_101814733 200
138 3300026023 Ga0207677_10000100 Ga0207677_1000010075 200
139 3300031824 Ga0307413_10446930 Ga0307413_104469302 200
140 3300031995 Ga0307409_100274339 Ga0307409_1002743392 200
141 3300032002 Ga0307416_100828482 Ga0307416_1008284821 200
142 3300042876 Ga0451577_0250129 Ga0451577_0250129_909_1568 200
143 3300048913 Ga0496110_0644385 Ga0496110_0644385_263_943 200
144 3300049822 Ga0501035_0691999 Ga0501035_0691999_17_673 200
145 iso_pu_bacteria 2848297114 2848298082 200
146 iso_pu_bacteria 2928972540 2928974495 200
147 iso_pu_bacteria 2977240413 2977243419 200
148 3300003215 JGI25153J46596_10001130 JGI25153J46596_100011305 201
149 3300003781 Ga0055536_1002707 Ga0055536_10027078 201
150 3300003794 Ga0055531_10004848 Ga0055531_100048484 201
151 3300003794 Ga0055531_10027662 Ga0055531_100276622 201
152 3300005262 Ga0065165_1000517 Ga0065165_10005175 201
153 3300005331 Ga0070670_100094606 Ga0070670_1000946062 201
154 3300005356 Ga0070674_100113742 Ga0070674_1001137422 201
155 3300005364 Ga0070673_100437889 Ga0070673_1004378892 201
156 3300005364 Ga0070673_100485292 Ga0070673_1004852922 201
157 3300005367 Ga0070667_100000354 Ga0070667_10000035450 201
158 3300005456 Ga0070678_100001120 Ga0070678_10000112010 201
159 3300005459 Ga0068867_100377621 Ga0068867_1003776212 201
160 3300005548 Ga0070665_100497649 Ga0070665_1004976492 201
161 3300005841 Ga0068863_100128499 Ga0068863_1001284992 201
162 3300005843 Ga0068860_100000466 Ga0068860_10000046652 201
163 3300006186 Ga0075369_10108116 Ga0075369_101081162 201
164 3300006358 Ga0068871_100272393 Ga0068871_1002723932 201
165 3300009148 Ga0105243_10000490 Ga0105243_1000049034 201
166 3300011119 Ga0105246_10099747 Ga0105246_100997472 201
167 3300012513 Ga0157326_1001194 Ga0157326_10011942 201
168 3300013297 Ga0157378_10940596 Ga0157378_109405962 201
169 3300014326 Ga0157380_10213013 Ga0157380_102130132 201
170 3300025261 Ga0209233_1022450 Ga0209233_10224502 201
171 3300025292 Ga0209676_1000140 Ga0209676_100014036 201
172 3300025292 Ga0209676_1001860 Ga0209676_100186017 201
173 3300025295 Ga0209564_1002745 Ga0209564_10027455 201
174 3300025297 Ga0209758_1000007 Ga0209758_1000007706 201
175 3300025297 Ga0209758_1000238 Ga0209758_100023833 201
176 3300025298 Ga0209050_1008455 Ga0209050_10084552 201
177 3300025304 Ga0209257_1000036 Ga0209257_10000364 201
178 3300025304 Ga0209257_1000292 Ga0209257_100029254 201
179 3300025925 Ga0207650_10082654 Ga0207650_100826542 201
180 3300025926 Ga0207659_10260483 Ga0207659_102604832 201
181 3300025931 Ga0207644_10547758 Ga0207644_105477581 201
182 3300025935 Ga0207709_10000005 Ga0207709_10000005594 201
183 3300025937 Ga0207669_10000111 Ga0207669_1000011110 201
184 3300025937 Ga0207669_10032779 Ga0207669_100327793 201
185 3300025986 Ga0207658_10000160 Ga0207658_1000016050 201
186 3300026023 Ga0207677_10711168 Ga0207677_107111682 201
187 3300026088 Ga0207641_10007717 Ga0207641_100077172 201
188 3300026089 Ga0207648_10152754 Ga0207648_101527542 201
189 3300026121 Ga0207683_10001512 Ga0207683_1000151214 201
190 3300028381 Ga0268264_10000229 Ga0268264_1000022955 201
191 3300028786 Ga0307517_10073512 Ga0307517_100735122 201
192 3300031616 Ga0307508_10000011 Ga0307508_1000001154 201
193 3300031911 Ga0307412_10012428 Ga0307412_100124283 201
194 3300031911 Ga0307412_10040053 Ga0307412_100400532 201
195 3300032004 Ga0307414_10059844 Ga0307414_100598442 201
196 3300032004 Ga0307414_11012341 Ga0307414_110123411 201
197 3300039450 Ga0436363_1485834 Ga0436363_1485834_331_993 201
198 3300046471 Ga0495650_0000046 Ga0495650_0000046_49471_50136 201
199 3300046491 Ga0495584_0022791 Ga0495584_0022791_2443_3105 201
200 3300046492 Ga0495585_0004652 Ga0495585_0004652_4350_5012 201
201 3300046492 Ga0495585_0069072 Ga0495585_0069072_882_1544 201
202 3300046506 Ga0495583_0001362 Ga0495583_0001362_11677_12339 201
203 3300046506 Ga0495583_0007181 Ga0495583_0007181_6299_6961 201
204 3300046506 Ga0495583_0068334 Ga0495583_0068334_398_1060 201
205 3300046507 Ga0495606_0004507 Ga0495606_0004507_7299_7964 201
206 3300046507 Ga0495606_0137333 Ga0495606_0137333_267_929 201
207 3300046512 Ga0495610_0006053 Ga0495610_0006053_5508_6173 201
208 3300046512 Ga0495610_0008028 Ga0495610_0008028_3875_4540 201
209 3300046512 Ga0495610_0046990 Ga0495610_0046990_215_877 201
210 3300046513 Ga0495616_0047438 Ga0495616_0047438_715_1380 201
211 3300046513 Ga0495616_0080042 Ga0495616_0080042_492_1154 201
212 3300046515 Ga0495620_0036313 Ga0495620_0036313_1407_2072 201
213 3300046519 Ga0495632_0026857 Ga0495632_0026857_1111_1776 201
214 3300046520 Ga0495637_0003649 Ga0495637_0003649_469_1134 201
215 3300046520 Ga0495637_0007824 Ga0495637_0007824_4260_4925 201
216 3300046522 Ga0495643_0007490 Ga0495643_0007490_6294_6956 201
217 3300046522 Ga0495643_0250601 Ga0495643_0250601_64_726 201
218 3300046522 Ga0495643_0258354 Ga0495643_0258354_112_777 201
219 3300046524 Ga0495648_0000323 Ga0495648_0000323_15367_16029 201
220 3300046528 Ga0495642_0015916 Ga0495642_0015916_407_1069 201
221 3300046530 Ga0495654_0000039 Ga0495654_0000039_62045_62710 201
222 3300046557 Ga0495622_0007283 Ga0495622_0007283_3842_4504 201
223 3300046558 Ga0495633_0141329 Ga0495633_0141329_357_1019 201
224 3300046558 Ga0495633_0160668 Ga0495633_0160668_16_681 201
225 3300046648 Ga0495611_0052957 Ga0495611_0052957_593_1255 201
226 3300046648 Ga0495611_0162648 Ga0495611_0162648_41_703 201
227 3300046660 Ga0495625_0000069 Ga0495625_0000069_43697_44362 201
228 3300046660 Ga0495625_0000094 Ga0495625_0000094_40132_40794 201
229 3300046660 Ga0495625_0000559 Ga0495625_0000559_31772_32434 201
230 3300046660 Ga0495625_0001580 Ga0495625_0001580_15852_16517 201
231 3300046660 Ga0495625_0024399 Ga0495625_0024399_565_1227 201
232 3300046660 Ga0495625_0029097 Ga0495625_0029097_2668_3333 201
233 3300046660 Ga0495625_0034324 Ga0495625_0034324_2379_3041 201
234 3300046660 Ga0495625_0044777 Ga0495625_0044777_2339_3001 201
235 3300046660 Ga0495625_0158851 Ga0495625_0158851_803_1468 201
236 3300046692 Ga0495671_0005268 Ga0495671_0005268_1606_2268 201
237 3300046794 Ga0495589_0000891 Ga0495589_0000891_17498_18163 201
238 3300046809 Ga0495600_0001757 Ga0495600_0001757_5499_6161 201
239 3300047320 Ga0495672_0004217 Ga0495672_0004217_5182_5847 201
240 3300047323 Ga0495683_0001997 Ga0495683_0001997_7385_8047 201
241 3300047445 Ga0495677_0004082 Ga0495677_0004082_4893_5555 201
242 3300047469 Ga0495673_0000255 Ga0495673_0000255_33418_34083 201
243 3300047472 Ga0495686_0022778 Ga0495686_0022778_1084_1749 201
244 3300047472 Ga0495686_0053685 Ga0495686_0053685_13_678 201
245 3300048926 Ga0496123_0007685 Ga0496123_0007685_8098_8760 201
246 3300048928 Ga0496125_0001248 Ga0496125_0001248_23963_24625 201
247 3300050493 nmdc:mga0k408_133272_c1 nmdc:mga0k408_133272_c1_208_873 201
248 3300053087 Ga0500643_001280 Ga0500643_001280_5849_6511 201
249 3300053088 Ga0500644_0005526 Ga0500644_0005526_1038_1697 201
250 3300053093 Ga0500651_0199410 Ga0500651_0199410_427_1086 201
251 3300053094 Ga0500566_0322913 Ga0500566_0322913_17_676 201
252 3300053104 Ga0500556_0000618 Ga0500556_0000618_18720_19385 201
253 3300053118 Ga0500594_0003577 Ga0500594_0003577_1480_2142 201
254 3300053130 Ga0500642_0000689 Ga0500642_0000689_1125_1787 201
255 3300053134 Ga0500658_0132379 Ga0500658_0132379_272_937 201
256 3300053136 Ga0500559_0000090 Ga0500559_0000090_34937_35602 201
257 3300053136 Ga0500559_0001343 Ga0500559_0001343_10073_10738 201
258 3300053153 Ga0500616_0044620 Ga0500616_0044620_1359_2024 201
259 3300053177 Ga0500636_0032131 Ga0500636_0032131_71_733 201
260 3300053730 Ga0500645_001922 Ga0500645_001922_117_782 201
261 3300005347 Ga0070668_100000003 Ga0070668_10000000377 202
262 3300005355 Ga0070671_100000061 Ga0070671_10000006137 202
263 3300005367 Ga0070667_100000035 Ga0070667_10000003595 202
264 3300005543 Ga0070672_100256415 Ga0070672_1002564152 202
265 3300005577 Ga0068857_100425871 Ga0068857_1004258711 202
266 3300005841 Ga0068863_100001950 Ga0068863_10000195015 202
267 3300005842 Ga0068858_100000465 Ga0068858_1000004653 202
268 3300005843 Ga0068860_100000106 Ga0068860_10000010642 202
269 3300005844 Ga0068862_100002361 Ga0068862_1000023612 202
270 3300006048 Ga0075363_100000103 Ga0075363_1000001033 202
271 3300006051 Ga0075364_10052556 Ga0075364_100525563 202
272 3300006051 Ga0075364_10114831 Ga0075364_101148312 202
273 3300006177 Ga0075362_10000026 Ga0075362_1000002656 202
274 3300006186 Ga0075369_10000639 Ga0075369_1000063910 202
275 3300006195 Ga0075366_10005316 Ga0075366_100053167 202
276 3300006195 Ga0075366_10055774 Ga0075366_100557742 202
277 3300006353 Ga0075370_10000033 Ga0075370_100000336 202
278 3300007076 Ga0075435_100266945 Ga0075435_1002669452 202
279 3300009092 Ga0105250_10037351 Ga0105250_100373512 202
280 3300025909 Ga0207705_10628954 Ga0207705_106289541 202
281 3300025923 Ga0207681_10125181 Ga0207681_101251812 202
282 3300025925 Ga0207650_10005308 Ga0207650_100053086 202
283 3300025931 Ga0207644_10000069 Ga0207644_1000006941 202
284 3300025972 Ga0207668_10000006 Ga0207668_1000000672 202
285 3300025986 Ga0207658_10000026 Ga0207658_1000002619 202
286 3300026035 Ga0207703_10000234 Ga0207703_100002343 202
287 3300026088 Ga0207641_10000617 Ga0207641_1000061733 202
288 3300026088 Ga0207641_10001438 Ga0207641_1000143810 202
289 3300026118 Ga0207675_101117202 Ga0207675_1011172022 202
290 3300027665 Ga0209983_1010851 Ga0209983_10108512 202
291 3300028380 Ga0268265_10001877 Ga0268265_100018772 202
292 3300028381 Ga0268264_10000076 Ga0268264_10000076168 202
293 3300031548 Ga0307408_100124908 Ga0307408_1001249082 202
294 3300031731 Ga0307405_10059553 Ga0307405_100595533 202
295 3300031824 Ga0307413_10007167 Ga0307413_100071673 202
296 3300031824 Ga0307413_10015291 Ga0307413_100152913 202
297 3300031852 Ga0307410_10011809 Ga0307410_100118094 202
298 3300031852 Ga0307410_10512110 Ga0307410_105121102 202
299 3300031903 Ga0307407_10006941 Ga0307407_100069412 202
300 3300031911 Ga0307412_10034323 Ga0307412_100343232 202
301 3300031911 Ga0307412_10158510 Ga0307412_101585102 202
302 3300031995 Ga0307409_100050765 Ga0307409_1000507653 202
303 3300031995 Ga0307409_100146879 Ga0307409_1001468792 202
304 3300032002 Ga0307416_100004068 Ga0307416_1000040687 202
305 3300032002 Ga0307416_100275414 Ga0307416_1002754142 202
306 3300032004 Ga0307414_10088165 Ga0307414_100881652 202
307 3300032005 Ga0307411_10037349 Ga0307411_100373494 202
308 3300032126 Ga0307415_100042593 Ga0307415_1000425932 202
309 3300035114 Ga0373939_0032696 Ga0373939_0032696_662_1324 202
310 3300036647 Ga0316582_0005414 Ga0316582_0005414_2154_2816 202
311 3300036712 Ga0316584_0024361 Ga0316584_0024361_964_1626 202
312 3300041512 Ga0451853_2130736 Ga0451853_2130736_82_744 202
313 3300042116 Ga0450912_001322 Ga0450912_001322_518_1180 202
314 3300046460 Ga0495638_0396731 Ga0495638_0396731_41_703 202
315 3300046512 Ga0495610_0039100 Ga0495610_0039100_113_778 202
316 3300046522 Ga0495643_0013120 Ga0495643_0013120_1242_1904 202
317 3300046691 Ga0495670_0251730 Ga0495670_0251730_38_700 202
318 3300050489 nmdc:mga03683_54_c1 nmdc:mga03683_54_c1_5221_5883 202
319 3300050490 nmdc:mga03n38_374_c1 nmdc:mga03n38_374_c1_6924_7586 202
320 3300050491 nmdc:mga00v17_16506_c1 nmdc:mga00v17_16506_c1_3274_3936 202
321 3300050493 nmdc:mga0k408_100265_c1 nmdc:mga0k408_100265_c1_20_682 202
322 3300050493 nmdc:mga0k408_30_c1 nmdc:mga0k408_30_c1_83661_84323 202
323 3300050493 nmdc:mga0k408_57598_c1 nmdc:mga0k408_57598_c1_1309_1971 202
324 3300050496 nmdc:mga07m45_14_c1 nmdc:mga07m45_14_c1_148164_148826 202
325 3300050496 nmdc:mga07m45_4333_c2 nmdc:mga07m45_4333_c2_4343_5005 202
326 3300050513 nmdc:mga0rr50_281055_c1 nmdc:mga0rr50_281055_c1_254_916 202
327 3300050516 nmdc:mga0sz30_285_c1 nmdc:mga0sz30_285_c1_13519_14181 202
328 3300053087 Ga0500643_000005 Ga0500643_000005_264849_265511 202
329 3300053136 Ga0500559_0028982 Ga0500559_0028982_1331_1993 202
330 3300053153 Ga0500616_0000934 Ga0500616_0000934_23488_24150 202
331 3300053156 Ga0500622_0011278 Ga0500622_0011278_1175_1837 202
332 3300002075 JGI24738J21930_10028971 JGI24738J21930_100289712 203
333 3300003578 Ga0006562J51391_1139201 Ga0006562J51391_11392014 203
334 3300003578 Ga0006562J51391_1139202 Ga0006562J51391_11392023 203
335 3300005327 Ga0070658_10019207 Ga0070658_100192073 203
336 3300005327 Ga0070658_10071618 Ga0070658_100716181 203
337 3300005329 Ga0070683_100007921 Ga0070683_1000079219 203
338 3300005336 Ga0070680_100051345 Ga0070680_1000513453 203
339 3300005339 Ga0070660_100008709 Ga0070660_1000087093 203
340 3300005344 Ga0070661_100016364 Ga0070661_1000163643 203
341 3300005345 Ga0070692_10032693 Ga0070692_100326932 203
342 3300005366 Ga0070659_100074438 Ga0070659_1000744382 203
343 3300005366 Ga0070659_100161778 Ga0070659_1001617782 203
344 3300005455 Ga0070663_100074779 Ga0070663_1000747793 203
345 3300005457 Ga0070662_100000320 Ga0070662_1000003208 203
346 3300005457 Ga0070662_100001434 Ga0070662_1000014346 203
347 3300005458 Ga0070681_10055832 Ga0070681_100558323 203
348 3300005530 Ga0070679_100000777 Ga0070679_1000007777 203
349 3300005530 Ga0070679_100006516 Ga0070679_1000065166 203
350 3300005530 Ga0070679_100089806 Ga0070679_1000898063 203
351 3300005539 Ga0068853_100075613 Ga0068853_1000756132 203
352 3300005563 Ga0068855_100004377 Ga0068855_1000043777 203
353 3300005563 Ga0068855_100050219 Ga0068855_1000502192 203
354 3300005564 Ga0070664_100014003 Ga0070664_1000140035 203
355 3300005577 Ga0068857_100005055 Ga0068857_1000050556 203
356 3300005614 Ga0068856_100038520 Ga0068856_1000385202 203
357 3300005841 Ga0068863_100116264 Ga0068863_1001162642 203
358 3300005843 Ga0068860_100033060 Ga0068860_1000330604 203
359 3300006237 Ga0097621_100369554 Ga0097621_1003695542 203
360 3300009174 Ga0105241_10037406 Ga0105241_100374063 203
361 3300011119 Ga0105246_10000017 Ga0105246_1000001751 203
362 3300013100 Ga0157373_10020046 Ga0157373_100200463 203
363 3300013100 Ga0157373_10045680 Ga0157373_100456802 203
364 3300013102 Ga0157371_10017754 Ga0157371_100177543 203
365 3300013104 Ga0157370_10112011 Ga0157370_101120112 203
366 3300013104 Ga0157370_10150991 Ga0157370_101509912 203
367 3300013105 Ga0157369_10012382 Ga0157369_100123823 203
368 3300013105 Ga0157369_10034138 Ga0157369_100341382 203
369 3300013105 Ga0157369_10288903 Ga0157369_102889032 203
370 3300013307 Ga0157372_10045038 Ga0157372_100450383 203
371 3300013308 Ga0157375_10099829 Ga0157375_100998292 203
372 3300025909 Ga0207705_10000454 Ga0207705_1000045418 203
373 3300025909 Ga0207705_10039261 Ga0207705_100392612 203
374 3300025911 Ga0207654_10052575 Ga0207654_100525752 203
375 3300025912 Ga0207707_10150061 Ga0207707_101500612 203
376 3300025917 Ga0207660_10022850 Ga0207660_100228502 203
377 3300025919 Ga0207657_10001508 Ga0207657_1000150823 203
378 3300025919 Ga0207657_10019501 Ga0207657_100195015 203
379 3300025920 Ga0207649_10012488 Ga0207649_100124883 203
380 3300025920 Ga0207649_10146373 Ga0207649_101463732 203
381 3300025932 Ga0207690_10001102 Ga0207690_1000110214 203
382 3300025932 Ga0207690_10517569 Ga0207690_105175691 203
383 3300025933 Ga0207706_10002504 Ga0207706_100025044 203
384 3300025933 Ga0207706_10007530 Ga0207706_100075309 203
385 3300025944 Ga0207661_10016504 Ga0207661_100165046 203
386 3300025945 Ga0207679_10017384 Ga0207679_100173842 203
387 3300025949 Ga0207667_10004526 Ga0207667_1000452613 203
388 3300025949 Ga0207667_10011624 Ga0207667_1001162410 203
389 3300025949 Ga0207667_10021893 Ga0207667_100218934 203
390 3300025986 Ga0207658_10000862 Ga0207658_100008628 203
391 3300026041 Ga0207639_10011207 Ga0207639_100112076 203
392 3300026067 Ga0207678_10063990 Ga0207678_100639903 203
393 3300026078 Ga0207702_10018246 Ga0207702_100182464 203
394 3300026088 Ga0207641_10100331 Ga0207641_101003313 203
395 3300026116 Ga0207674_10009728 Ga0207674_100097282 203
396 3300027111 Ga0209281_1009395 Ga0209281_10093953 203
397 3300027876 Ga0209974_10009167 Ga0209974_100091672 203
398 3300031901 Ga0307406_10326128 Ga0307406_103261282 203
399 3300032004 Ga0307414_10007190 Ga0307414_100071901 203
400 3300032004 Ga0307414_10109125 Ga0307414_101091252 203
401 3300032004 Ga0307414_10209703 Ga0307414_102097031 203
402 3300036647 Ga0316582_0308961 Ga0316582_0308961_191_856 203
403 3300036712 Ga0316584_0101804 Ga0316584_0101804_284_949 203
404 3300046558 Ga0495633_0000346 Ga0495633_0000346_21406_22083 203
405 3300048925 Ga0496122_0008001 Ga0496122_0008001_430_1104 203
406 3300048926 Ga0496123_0007095 Ga0496123_0007095_9346_10020 203
407 3300049570 Ga0501033_0048299 Ga0501033_0048299_778_1443 203
408 3300049572 Ga0501036_0077648 Ga0501036_0077648_586_1251 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

26

223

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9686 3 197
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9683 5 197
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9664 3 197
3inp-assembly1.cif.gz_A 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. 0.9562 3 197
7b1w-assembly2.cif.gz_K-3 crystal structure of plastidial ribulose epimerase rpe1 from the model alga chlamydomonas reinhardtii 0.9527 2 197
ID Description Score Start End Superfamily
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9676 2 197 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9645 1 197 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9552 3 197 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.949 2 197 3.20.20.70
af_A0A1D6PJ99_41_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.947 2 195 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1D7NHS1-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9892 23 197 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A3D0RU88-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9842 36 197 GO:0004750
GO:0005975
GO:0006098
GO:0046872
AF-A0A7W6EV29-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.984 4 197 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A844ZET1-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9812 1 197 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A2C7ADH0-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9798 4 197 GO:0004750
GO:0006098
GO:0019323
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.91 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map