F436579

General Info

Members Datasets Scaffolds Average Seq Length
407 243 814 99

Family's Representative Sequence

Representative Sequence 3300053122|Ga0500608_199271|Ga0500608_199271_106_456
Length 116
Sequence MARAYVISDVTLRDGEALVAYRELAARSIAAFGGRYLVRGGEIGVLEGDWRPSAVVIAEFADAATARAWYGSPLYAEALAFRQAALTRNLILVEGVDDAAALPPRAAALDEGLSNL

Samples

Sample ID Description Type Environment
1 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
177 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
217 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
232 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
233 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
234 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
235 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
236 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
237 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
238 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
239 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
240 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
241 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
242 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
243 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.81
Metatranscriptomes 0
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.19
Nodule 2.46
Rhizoplane 6.88
Rhizosphere 86
Stem 0
Stem Tuber 0
Unclassified 20.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500608_199271 3300053122 Bacteria 829
2 JGI25153J46596_10000625 3300003215 Bacteria 21643
3 Ga0065712_10278922 3300005290 Bacteria 900
4 Ga0065715_10115985 3300005293 Bacteria 2396
5 Ga0070676_10007826 3300005328 Bacteria 5745
6 Ga0070676_10130622 3300005328 Bacteria 1588
7 Ga0070683_100863676 3300005329 Bacteria 868
8 Ga0070690_100007544 3300005330 Bacteria 6229
9 Ga0070690_100083587 3300005330 Bacteria 2092
10 Ga0070690_100305249 3300005330 Unclassified 1142
11 Ga0070690_100526523 3300005330 Unclassified 888
12 Ga0070670_100073750 3300005331 Bacteria 2931
13 Ga0070670_101287352 3300005331 Unclassified 669
14 Ga0070677_10734297 3300005333 Bacteria 559
15 Ga0068869_100170043 3300005334 Bacteria 1702
16 Ga0068869_100701496 3300005334 Bacteria 863
17 Ga0070666_10000930 3300005335 Bacteria 17786
18 Ga0070666_10028615 3300005335 Bacteria 3658
19 Ga0070666_10102734 3300005335 Bacteria 1971
20 Ga0070680_100715708 3300005336 Unclassified 862
21 Ga0068868_100001477 3300005338 Bacteria 16207
22 Ga0068868_100125154 3300005338 Bacteria 2099
23 Ga0070660_100954609 3300005339 Unclassified 724
24 Ga0070689_100042888 3300005340 Bacteria 3475
25 Ga0070689_100049724 3300005340 Unclassified 3238
26 Ga0070689_100082051 3300005340 Bacteria 2531
27 Ga0070691_10838688 3300005341 Unclassified 563
28 Ga0070687_100045527 3300005343 Bacteria 2241
29 Ga0070687_100291103 3300005343 Bacteria 1032
30 Ga0070661_100944876 3300005344 Bacteria 713
31 Ga0070692_10959102 3300005345 Unclassified 595
32 Ga0070668_102272272 3300005347 Unclassified 501
33 Ga0070675_100002416 3300005354 Bacteria 13927
34 Ga0070675_100125747 3300005354 Bacteria 2181
35 Ga0070675_101232817 3300005354 Bacteria 689
36 Ga0070671_100012130 3300005355 Bacteria 6935
37 Ga0070671_100030696 3300005355 Bacteria 4436
38 Ga0070671_100042896 3300005355 Bacteria 3761
39 Ga0070671_101296880 3300005355 Bacteria 642
40 Ga0070674_100199938 3300005356 Bacteria 1543
41 Ga0070674_100323220 3300005356 Bacteria 1238
42 Ga0070673_100002692 3300005364 Bacteria 10883
43 Ga0070673_100121484 3300005364 Bacteria 2180
44 Ga0070673_100292806 3300005364 Unclassified 1431
45 Ga0070673_100952237 3300005364 Bacteria 798
46 Ga0070688_100343499 3300005365 Bacteria 1091
47 Ga0070659_100528562 3300005366 Unclassified 1008
48 Ga0070667_100002444 3300005367 Bacteria 16235
49 Ga0070667_100123581 3300005367 Bacteria 2253
50 Ga0070667_100188122 3300005367 Unclassified 1828
51 Ga0070705_100011732 3300005440 Bacteria 4432
52 Ga0070700_100826139 3300005441 Unclassified 748
53 Ga0070694_100029333 3300005444 Bacteria 3589
54 Ga0070663_100973556 3300005455 Bacteria 736
55 Ga0070663_101120506 3300005455 Unclassified 689
56 Ga0070678_100000637 3300005456 Bacteria 17165
57 Ga0070678_100908477 3300005456 Bacteria 805
58 Ga0070678_101504683 3300005456 Bacteria 630
59 Ga0070662_100076177 3300005457 Bacteria 2486
60 Ga0070662_100413803 3300005457 Unclassified 1114
61 Ga0070662_101258098 3300005457 Bacteria 637
62 Ga0068867_100059855 3300005459 Bacteria 2824
63 Ga0068867_100120440 3300005459 Bacteria 2028
64 Ga0068867_101283681 3300005459 Unclassified 675
65 Ga0070685_10071084 3300005466 Bacteria 2062
66 Ga0070685_10885760 3300005466 Bacteria 663
67 Ga0070706_100945680 3300005467 Unclassified 795
68 Ga0070707_100015204 3300005468 Bacteria 7222
69 Ga0070699_100000162 3300005518 Bacteria 63688
70 Ga0070699_100321743 3300005518 Bacteria 1390
71 Ga0070679_100289962 3300005530 Unclassified 1588
72 Ga0070684_100018725 3300005535 Bacteria 5711
73 Ga0070684_101408149 3300005535 Unclassified 656
74 Ga0068853_101899428 3300005539 Bacteria 577
75 Ga0070672_100016959 3300005543 Bacteria 5228
76 Ga0070672_100272980 3300005543 Unclassified 1428
77 Ga0070672_101363482 3300005543 Unclassified 634
78 Ga0070672_101770450 3300005543 Unclassified 555
79 Ga0070686_100045192 3300005544 Bacteria 2773
80 Ga0070686_100320715 3300005544 Bacteria 1155
81 Ga0070686_100532535 3300005544 Bacteria 916
82 Ga0070686_100633514 3300005544 Bacteria 846
83 Ga0070695_100517389 3300005545 Bacteria 925
84 Ga0070696_100132017 3300005546 Bacteria 1818
85 Ga0070693_101631281 3300005547 Bacteria 507
86 Ga0070665_100503445 3300005548 Unclassified 1222
87 Ga0070704_100000222 3300005549 Bacteria 23894
88 Ga0068855_100233718 3300005563 Bacteria 2057
89 Ga0070664_100031611 3300005564 Bacteria 4424
90 Ga0070664_100237852 3300005564 Unclassified 1634
91 Ga0070664_101410105 3300005564 Unclassified 659
92 Ga0070664_101521611 3300005564 Unclassified 633
93 Ga0068854_100037665 3300005578 Bacteria 3396
94 Ga0068856_100083031 3300005614 Unclassified 3181
95 Ga0068856_100208387 3300005614 Bacteria 1970
96 Ga0070702_100024602 3300005615 Bacteria 3215
97 Ga0070702_100331846 3300005615 Bacteria 1064
98 Ga0068859_100001613 3300005617 Bacteria 23052
99 Ga0068859_100011418 3300005617 Bacteria 8929
100 Ga0068859_100442022 3300005617 Unclassified 1397
101 Ga0068864_100001828 3300005618 Bacteria 17480
102 Ga0068864_100038433 3300005618 Bacteria 4087
103 Ga0068864_100052004 3300005618 Bacteria 3530
104 Ga0068866_10065268 3300005718 Bacteria 1903
105 Ga0068866_10762374 3300005718 Bacteria 669
106 Ga0068861_100200639 3300005719 Unclassified 1674
107 Ga0068861_100356573 3300005719 Bacteria 1285
108 Ga0068861_101616621 3300005719 Unclassified 639
109 Ga0068861_102490991 3300005719 Bacteria 521
110 Ga0068851_10017583 3300005834 Bacteria 3436
111 Ga0068851_10324047 3300005834 Bacteria 891
112 Ga0068870_10666919 3300005840 Bacteria 714
113 Ga0068863_100083293 3300005841 Bacteria 3031
114 Ga0068863_100203783 3300005841 Bacteria 1904
115 Ga0068863_100233278 3300005841 Bacteria 1775
116 Ga0068863_102322756 3300005841 Bacteria 546
117 Ga0068858_100001347 3300005842 Bacteria 25330
118 Ga0068858_100012208 3300005842 Bacteria 8099
119 Ga0068860_100098816 3300005843 Bacteria 2783
120 Ga0068860_100120892 3300005843 Bacteria 2508
121 Ga0068862_100084065 3300005844 Bacteria 2765
122 Ga0068862_101635432 3300005844 Unclassified 651
123 Ga0081455_10170251 3300005937 Bacteria 1660
124 Ga0081539_10017228 3300005985 Bacteria 5086
125 Ga0075366_10239729 3300006195 Bacteria 1105
126 Ga0097621_100007918 3300006237 Bacteria 7623
127 Ga0097621_100217710 3300006237 Bacteria 1663
128 Ga0097621_100605330 3300006237 Bacteria 1002
129 Ga0068871_100009531 3300006358 Bacteria 7044
130 Ga0068871_100170491 3300006358 Bacteria 1865
131 Ga0068871_100524841 3300006358 Bacteria 1070
132 Ga0068871_102402265 3300006358 Bacteria 503
133 Ga0075428_100740157 3300006844 Bacteria 1046
134 Ga0075431_101561108 3300006847 Bacteria 618
135 Ga0075429_100000045 3300006880 Bacteria 56854
136 Ga0097620_100001613 3300006931 Bacteria 23052
137 Ga0097620_100011418 3300006931 Bacteria 8929
138 Ga0097620_100442013 3300006931 Unclassified 1397
139 Ga0075435_100284753 3300007076 Bacteria 1411
140 Ga0105250_10493941 3300009092 Bacteria 554
141 Ga0105240_10085144 3300009093 Unclassified 3874
142 Ga0111539_10379398 3300009094 Unclassified 1646
143 Ga0105245_10031382 3300009098 Bacteria 4701
144 Ga0105245_11249893 3300009098 Unclassified 791
145 Ga0105247_10421585 3300009101 Bacteria 956
146 Ga0114129_10015805 3300009147 Bacteria 10731
147 Ga0105243_10124277 3300009148 Bacteria 2180
148 Ga0105241_10439506 3300009174 Bacteria 1152
149 Ga0105242_10771856 3300009176 Bacteria 948
150 Ga0105248_10005486 3300009177 Bacteria 13930
151 Ga0105248_10072588 3300009177 Bacteria 3868
152 Ga0105248_10157160 3300009177 Bacteria 2565
153 Ga0105248_10415252 3300009177 Bacteria 1515
154 Ga0105248_11309875 3300009177 Bacteria 819
155 Ga0105248_12223036 3300009177 Unclassified 624
156 Ga0105238_10230584 3300009551 Bacteria 1828
157 Ga0105249_10038743 3300009553 Bacteria 4325
158 Ga0105249_11219502 3300009553 Unclassified 823
159 Ga0105249_11362003 3300009553 Bacteria 781
160 Ga0105249_12211734 3300009553 Unclassified 623
161 Ga0105239_10177700 3300010375 Bacteria 2381
162 Ga0105246_10543974 3300011119 Bacteria 994
163 Ga0157373_11500240 3300013100 Unclassified 515
164 Ga0157374_10033778 3300013296 Bacteria 4669
165 Ga0157374_10096804 3300013296 Unclassified 2823
166 Ga0157374_10350987 3300013296 Bacteria 1466
167 Ga0157378_10361786 3300013297 Bacteria 1420
168 Ga0163162_10016337 3300013306 Bacteria 7255
169 Ga0163162_10151174 3300013306 Bacteria 2439
170 Ga0163162_10275251 3300013306 Bacteria 1815
171 Ga0163162_10351230 3300013306 Bacteria 1607
172 Ga0157375_10004033 3300013308 Bacteria 12738
173 Ga0157375_10114320 3300013308 Bacteria 2801
174 Ga0157375_10216735 3300013308 Bacteria 2072
175 Ga0157375_10966303 3300013308 Bacteria 993
176 Ga0163163_10003621 3300014325 Bacteria 13134
177 Ga0163163_10005263 3300014325 Bacteria 11160
178 Ga0163163_10272888 3300014325 Bacteria 1742
179 Ga0157380_10016401 3300014326 Bacteria 5463
180 Ga0157377_10060688 3300014745 Bacteria 2159
181 Ga0157377_10107083 3300014745 Bacteria 1675
182 Ga0157377_10569379 3300014745 Bacteria 803
183 Ga0157379_10006033 3300014968 Bacteria 10437
184 Ga0157379_10131491 3300014968 Bacteria 2253
185 Ga0157376_10029878 3300014969 Bacteria 4344
186 Ga0157376_10043659 3300014969 Bacteria 3680
187 Ga0157376_10082094 3300014969 Bacteria 2769
188 Ga0157376_10145616 3300014969 Bacteria 2130
189 Ga0157376_10998257 3300014969 Unclassified 859
190 Ga0163161_10162103 3300017792 Bacteria 1705
191 Ga0209758_1010781 3300025297 Bacteria 5411
192 Ga0209758_1146026 3300025297 Bacteria 607
193 Ga0207656_10011434 3300025321 Bacteria 3353
194 Ga0207656_10299791 3300025321 Bacteria 795
195 Ga0207682_10020100 3300025893 Bacteria 2620
196 Ga0207642_10020909 3300025899 Bacteria 2565
197 Ga0207680_10001996 3300025903 Bacteria 9560
198 Ga0207680_10019083 3300025903 Bacteria 3662
199 Ga0207645_10014239 3300025907 Bacteria 5327
200 Ga0207645_10093620 3300025907 Bacteria 1933
201 Ga0207643_10258601 3300025908 Unclassified 1074
202 Ga0207684_10550520 3300025910 Bacteria 987
203 Ga0207695_10586582 3300025913 Bacteria 996
204 Ga0207660_10726453 3300025917 Unclassified 810
205 Ga0207662_10145605 3300025918 Unclassified 1503
206 Ga0207649_10190244 3300025920 Bacteria 1443
207 Ga0207652_10465949 3300025921 Unclassified 1138
208 Ga0207646_10055389 3300025922 Bacteria 3545
209 Ga0207694_10210306 3300025924 Unclassified 1584
210 Ga0207650_10143130 3300025925 Bacteria 1881
211 Ga0207650_10978149 3300025925 Unclassified 719
212 Ga0207659_10001313 3300025926 Bacteria 14851
213 Ga0207659_10125844 3300025926 Bacteria 1971
214 Ga0207687_10027404 3300025927 Bacteria 3823
215 Ga0207664_11824797 3300025929 Unclassified 531
216 Ga0207644_10003952 3300025931 Bacteria 9617
217 Ga0207644_10016186 3300025931 Bacteria 5017
218 Ga0207644_11219251 3300025931 Bacteria 632
219 Ga0207690_11373650 3300025932 Bacteria 591
220 Ga0207690_11543631 3300025932 Unclassified 555
221 Ga0207706_10117527 3300025933 Bacteria 2339
222 Ga0207706_10180376 3300025933 Unclassified 1854
223 Ga0207706_10192415 3300025933 Bacteria 1790
224 Ga0207706_10302997 3300025933 Unclassified 1392
225 Ga0207670_10018483 3300025936 Bacteria 4238
226 Ga0207670_10178632 3300025936 Bacteria 1597
227 Ga0207670_10477904 3300025936 Bacteria 1009
228 Ga0207670_10598113 3300025936 Bacteria 905
229 Ga0207669_11276680 3300025937 Bacteria 623
230 Ga0207669_11314290 3300025937 Bacteria 614
231 Ga0207669_11541625 3300025937 Bacteria 567
232 Ga0207691_10595766 3300025940 Bacteria 936
233 Ga0207711_10008571 3300025941 Bacteria 8552
234 Ga0207711_10019340 3300025941 Bacteria 5671
235 Ga0207711_10811476 3300025941 Bacteria 871
236 Ga0207711_10815017 3300025941 Unclassified 869
237 Ga0207711_10863526 3300025941 Bacteria 842
238 Ga0207689_10101217 3300025942 Bacteria 2367
239 Ga0207689_10736601 3300025942 Bacteria 832
240 Ga0207661_10688391 3300025944 Bacteria 940
241 Ga0207679_10245176 3300025945 Bacteria 1520
242 Ga0207679_10718554 3300025945 Unclassified 907
243 Ga0207651_10002814 3300025960 Bacteria 8370
244 Ga0207651_10207608 3300025960 Bacteria 1574
245 Ga0207651_11218539 3300025960 Bacteria 676
246 Ga0207712_10890842 3300025961 Unclassified 786
247 Ga0207640_10123040 3300025981 Bacteria 1863
248 Ga0207640_10218414 3300025981 Bacteria 1457
249 Ga0207658_10023239 3300025986 Bacteria 4325
250 Ga0207658_10317112 3300025986 Unclassified 1348
251 Ga0207677_10000836 3300026023 Bacteria 17591
252 Ga0207677_10126514 3300026023 Bacteria 1932
253 Ga0207703_10000361 3300026035 Bacteria 48627
254 Ga0207703_10012746 3300026035 Bacteria 6556
255 Ga0207703_12028846 3300026035 Unclassified 551
256 Ga0207639_10893947 3300026041 Bacteria 830
257 Ga0207639_12256754 3300026041 Unclassified 506
258 Ga0207678_10448531 3300026067 Unclassified 1121
259 Ga0207708_10074373 3300026075 Bacteria 2604
260 Ga0207702_10799838 3300026078 Unclassified 932
261 Ga0207702_12010925 3300026078 Bacteria 568
262 Ga0207641_10013662 3300026088 Bacteria 6661
263 Ga0207641_10072615 3300026088 Bacteria 2963
264 Ga0207641_10136505 3300026088 Unclassified 2208
265 Ga0207641_10143735 3300026088 Bacteria 2155
266 Ga0207648_10149064 3300026089 Bacteria 2064
267 Ga0207648_10204347 3300026089 Bacteria 1753
268 Ga0207676_10001719 3300026095 Bacteria 16125
269 Ga0207676_10005984 3300026095 Bacteria 8578
270 Ga0207676_10114381 3300026095 Bacteria 2263
271 Ga0207676_10175982 3300026095 Bacteria 1869
272 Ga0207675_100269953 3300026118 Bacteria 1651
273 Ga0207675_100343052 3300026118 Unclassified 1462
274 Ga0207675_101826959 3300026118 Bacteria 627
275 Ga0207683_10001709 3300026121 Bacteria 19640
276 Ga0207683_10508720 3300026121 Bacteria 1113
277 Ga0207683_10739446 3300026121 Bacteria 912
278 Ga0207683_10841647 3300026121 Bacteria 852
279 Ga0209974_10299195 3300027876 Unclassified 615
280 Ga0268266_10457890 3300028379 Unclassified 1213
281 Ga0268266_11923079 3300028379 Bacteria 565
282 Ga0268265_10499158 3300028380 Bacteria 1146
283 Ga0268265_11927386 3300028380 Unclassified 598
284 Ga0268264_10029230 3300028381 Bacteria 4513
285 Ga0268264_10287790 3300028381 Bacteria 1542
286 Ga0268264_10364915 3300028381 Bacteria 1379
287 Ga0265318_10160363 3300028577 Bacteria 825
288 Ga0265332_10455508 3300031238 Unclassified 529
289 Ga0265320_10052650 3300031240 Bacteria 1970
290 Ga0307509_10139340 3300031507 Bacteria 2365
291 Ga0307408_100013777 3300031548 Bacteria 5368
292 Ga0307508_10592921 3300031616 Bacteria 709
293 Ga0307405_10016815 3300031731 Bacteria 3998
294 Ga0307413_10191370 3300031824 Bacteria 1469
295 Ga0307410_10198747 3300031852 Unclassified 1529
296 Ga0307406_10182167 3300031901 Unclassified 1530
297 Ga0307407_10068744 3300031903 Unclassified 2099
298 Ga0307407_10611320 3300031903 Bacteria 813
299 Ga0307412_10219236 3300031911 Unclassified 1457
300 Ga0307409_100004535 3300031995 Bacteria 7826
301 Ga0307416_100010922 3300032002 Bacteria 6025
302 Ga0307414_10001945 3300032004 Bacteria 10689
303 Ga0307411_10003890 3300032005 Bacteria 7039
304 Ga0307415_100006673 3300032126 Bacteria 6246
305 Ga0373934_0199508 3300035086 Bacteria 824
306 Ga0373953_0153916 3300035117 Bacteria 987
307 Ga0373954_0161707 3300035118 Bacteria 1096
308 Ga0373956_0451582 3300035119 Bacteria 613
309 Ga0373957_0149003 3300035120 Bacteria 960
310 Ga0373957_0192826 3300035120 Bacteria 847
311 Ga0373955_0007885 3300035172 Bacteria 4915
312 Ga0373942_0117963 3300035207 Bacteria 827
313 Ga0373924_0082373 3300035410 Bacteria 1370
314 Ga0373935_0466133 3300035692 Bacteria 914
315 Ga0373933_0112722 3300035724 Bacteria 1698
316 Ga0373937_0007090 3300036401 Bacteria 9682
317 Ga0373937_0045362 3300036401 Bacteria 4017
318 Ga0373937_1959408 3300036401 Unclassified 532
319 Ga0395901_0030144 3300038443 Bacteria 5588
320 Ga0439435_0019462 3300042436 Bacteria 1740
321 Ga0439444_0001786 3300042437 Bacteria 2846
322 Ga0451576_0206826 3300045051 Bacteria 2049
323 Ga0451576_2717746 3300045051 Bacteria 504
324 Ga0495592_0000211 3300046454 Bacteria 49780
325 Ga0495603_0100450 3300046455 Bacteria 1689
326 Ga0495580_0405827 3300046472 Bacteria 918
327 Ga0495582_0103179 3300046473 Bacteria 1598
328 Ga0495639_0214143 3300046475 Bacteria 946
329 Ga0495630_0697473 3300046517 Bacteria 777
330 Ga0495640_0434905 3300046533 Bacteria 803
331 Ga0495586_0561234 3300046535 Unclassified 659
332 Ga0495668_0163040 3300046616 Unclassified 1221
333 Ga0495635_0508947 3300046663 Unclassified 792
334 Ga0495588_0680746 3300046674 Bacteria 538
335 Ga0495647_0365807 3300046681 Bacteria 658
336 Ga0495658_0482218 3300046683 Unclassified 793
337 Ga0495658_0522170 3300046683 Bacteria 760
338 Ga0495636_0136153 3300047318 Bacteria 1095
339 Ga0496100_0084758 3300048903 Bacteria 2149
340 Ga0496100_0377219 3300048903 Bacteria 1076
341 Ga0496101_0052423 3300048904 Bacteria 2942
342 Ga0496101_0063151 3300048904 Bacteria 2695
343 Ga0496101_0907007 3300048904 Bacteria 694
344 Ga0496102_0488269 3300048905 Unclassified 1153
345 Ga0496104_0067989 3300048907 Bacteria 3385
346 Ga0496104_0206654 3300048907 Unclassified 1875
347 Ga0496104_0816711 3300048907 Bacteria 838
348 Ga0496105_0019171 3300048908 Bacteria 5515
349 Ga0496106_0244330 3300048909 Bacteria 1434
350 Ga0496106_0349471 3300048909 Bacteria 1188
351 Ga0496107_0464006 3300048910 Bacteria 940
352 Ga0496108_0049577 3300048911 Bacteria 3512
353 Ga0496108_0052507 3300048911 Bacteria 3416
354 Ga0496108_0108630 3300048911 Bacteria 2370
355 Ga0496108_0208143 3300048911 Bacteria 1698
356 Ga0496109_0027154 3300048912 Bacteria 5109
357 Ga0496109_0158611 3300048912 Bacteria 2119
358 Ga0496112_0093438 3300048915 Bacteria 2978
359 Ga0496112_0235794 3300048915 Bacteria 1783
360 Ga0496113_0155083 3300048916 Unclassified 1808
361 Ga0496113_0315945 3300048916 Unclassified 1252
362 Ga0496114_0002420 3300048917 Bacteria 14238
363 Ga0496114_0094349 3300048917 Bacteria 2545
364 Ga0496114_0593413 3300048917 Bacteria 977
365 Ga0496115_0001723 3300048918 Bacteria 15689
366 Ga0496115_0391476 3300048918 Bacteria 1129
367 Ga0496126_1024142 3300048929 Bacteria 618
368 Ga0501032_0502968 3300049569 Unclassified 774
369 Ga0501036_1074452 3300049572 Bacteria 658
370 Ga0501039_0887661 3300049575 Bacteria 694
371 Ga0501067_0262822 3300049583 Bacteria 961
372 Ga0501074_0889681 3300049590 Bacteria 627
373 Ga0501076_0134798 3300049592 Bacteria 2004
374 Ga0501255_021533 3300049684 Unclassified 838
375 Ga0501079_0256142 3300049741 Bacteria 1368
376 Ga0501045_0079978 3300049824 Bacteria 2410
377 Ga0501212_063297 3300049851 Unclassified 644
378 nmdc:mga03683_103358_c1 3300050489 Bacteria 1254
379 nmdc:mga0yw44_250236_c1 3300050492 Bacteria 1179
380 nmdc:mga05p37_103839_c1 3300050507 Bacteria 3497
381 nmdc:mga09592_18252_c1 3300050508 Bacteria 5753
382 nmdc:mga0qj67_456859_c1 3300050509 Bacteria 1028
383 nmdc:mga06r32_1422554_c1 3300050510 Bacteria 635
384 nmdc:mga0rr50_435965_c1 3300050513 Bacteria 1109
385 Ga0495601_0029498 3300053077 Bacteria 3403
386 Ga0495601_0209695 3300053077 Bacteria 1273
387 Ga0495601_0366555 3300053077 Bacteria 936
388 Ga0500643_049130 3300053087 Unclassified 1211
389 Ga0500659_0264960 3300053135 Bacteria 790
390 Ga0500616_0065372 3300053153 Bacteria 1871
391 Ga0500616_0379667 3300053153 Unclassified 569
392 Ga0500622_0022769 3300053156 Bacteria 3318
393 Ga0500636_0021907 3300053177 Bacteria 3783
394 Ga0501082_0529722 3300060353 Bacteria 1030
395 2882634378 2882632389 Bacteria 8154593
396 2885311560 2885305155 Bacteria 7348390
397 2885327064 2885326080 Bacteria 7134805
398 2885341825 2885334103 Bacteria 7216818
399 2889041094 2889033259 Bacteria 9099371
400 2922392052 2922386360 Bacteria 7017218
401 2929615887 2929615660 Bacteria 9193770
402 2929630500 2929624759 Bacteria 9339455
403 2933578827 2933577622 Bacteria 9116884
404 2968118285 2968117919 Bacteria 6536078
405 2987658666 2987652177 Bacteria 6969023
406 8055747534 8055742211 Bacteria 9226248
407 8056680492 8056673599 Bacteria 7871253
408 Ga0500608_199271
409 JGI25153J46596_10000625
410 Ga0065712_10278922
411 Ga0065715_10115985
412 Ga0070676_10007826
413 Ga0070676_10130622
414 Ga0070683_100863676
415 Ga0070690_100007544
416 Ga0070690_100083587
417 Ga0070690_100305249
418 Ga0070690_100526523
419 Ga0070670_100073750
420 Ga0070670_101287352
421 Ga0070677_10734297
422 Ga0068869_100170043
423 Ga0068869_100701496
424 Ga0070666_10000930
425 Ga0070666_10028615
426 Ga0070666_10102734
427 Ga0070680_100715708
428 Ga0068868_100001477
429 Ga0068868_100125154
430 Ga0070660_100954609
431 Ga0070689_100042888
432 Ga0070689_100049724
433 Ga0070689_100082051
434 Ga0070691_10838688
435 Ga0070687_100045527
436 Ga0070687_100291103
437 Ga0070661_100944876
438 Ga0070692_10959102
439 Ga0070668_102272272
440 Ga0070675_100002416
441 Ga0070675_100125747
442 Ga0070675_101232817
443 Ga0070671_100012130
444 Ga0070671_100030696
445 Ga0070671_100042896
446 Ga0070671_101296880
447 Ga0070674_100199938
448 Ga0070674_100323220
449 Ga0070673_100002692
450 Ga0070673_100121484
451 Ga0070673_100292806
452 Ga0070673_100952237
453 Ga0070688_100343499
454 Ga0070659_100528562
455 Ga0070667_100002444
456 Ga0070667_100123581
457 Ga0070667_100188122
458 Ga0070705_100011732
459 Ga0070700_100826139
460 Ga0070694_100029333
461 Ga0070663_100973556
462 Ga0070663_101120506
463 Ga0070678_100000637
464 Ga0070678_100908477
465 Ga0070678_101504683
466 Ga0070662_100076177
467 Ga0070662_100413803
468 Ga0070662_101258098
469 Ga0068867_100059855
470 Ga0068867_100120440
471 Ga0068867_101283681
472 Ga0070685_10071084
473 Ga0070685_10885760
474 Ga0070706_100945680
475 Ga0070707_100015204
476 Ga0070699_100000162
477 Ga0070699_100321743
478 Ga0070679_100289962
479 Ga0070684_100018725
480 Ga0070684_101408149
481 Ga0068853_101899428
482 Ga0070672_100016959
483 Ga0070672_100272980
484 Ga0070672_101363482
485 Ga0070672_101770450
486 Ga0070686_100045192
487 Ga0070686_100320715
488 Ga0070686_100532535
489 Ga0070686_100633514
490 Ga0070695_100517389
491 Ga0070696_100132017
492 Ga0070693_101631281
493 Ga0070665_100503445
494 Ga0070704_100000222
495 Ga0068855_100233718
496 Ga0070664_100031611
497 Ga0070664_100237852
498 Ga0070664_101410105
499 Ga0070664_101521611
500 Ga0068854_100037665
501 Ga0068856_100083031
502 Ga0068856_100208387
503 Ga0070702_100024602
504 Ga0070702_100331846
505 Ga0068859_100001613
506 Ga0068859_100011418
507 Ga0068859_100442022
508 Ga0068864_100001828
509 Ga0068864_100038433
510 Ga0068864_100052004
511 Ga0068866_10065268
512 Ga0068866_10762374
513 Ga0068861_100200639
514 Ga0068861_100356573
515 Ga0068861_101616621
516 Ga0068861_102490991
517 Ga0068851_10017583
518 Ga0068851_10324047
519 Ga0068870_10666919
520 Ga0068863_100083293
521 Ga0068863_100203783
522 Ga0068863_100233278
523 Ga0068863_102322756
524 Ga0068858_100001347
525 Ga0068858_100012208
526 Ga0068860_100098816
527 Ga0068860_100120892
528 Ga0068862_100084065
529 Ga0068862_101635432
530 Ga0081455_10170251
531 Ga0081539_10017228
532 Ga0075366_10239729
533 Ga0097621_100007918
534 Ga0097621_100217710
535 Ga0097621_100605330
536 Ga0068871_100009531
537 Ga0068871_100170491
538 Ga0068871_100524841
539 Ga0068871_102402265
540 Ga0075428_100740157
541 Ga0075431_101561108
542 Ga0075429_100000045
543 Ga0097620_100001613
544 Ga0097620_100011418
545 Ga0097620_100442013
546 Ga0075435_100284753
547 Ga0105250_10493941
548 Ga0105240_10085144
549 Ga0111539_10379398
550 Ga0105245_10031382
551 Ga0105245_11249893
552 Ga0105247_10421585
553 Ga0114129_10015805
554 Ga0105243_10124277
555 Ga0105241_10439506
556 Ga0105242_10771856
557 Ga0105248_10005486
558 Ga0105248_10072588
559 Ga0105248_10157160
560 Ga0105248_10415252
561 Ga0105248_11309875
562 Ga0105248_12223036
563 Ga0105238_10230584
564 Ga0105249_10038743
565 Ga0105249_11219502
566 Ga0105249_11362003
567 Ga0105249_12211734
568 Ga0105239_10177700
569 Ga0105246_10543974
570 Ga0157373_11500240
571 Ga0157374_10033778
572 Ga0157374_10096804
573 Ga0157374_10350987
574 Ga0157378_10361786
575 Ga0163162_10016337
576 Ga0163162_10151174
577 Ga0163162_10275251
578 Ga0163162_10351230
579 Ga0157375_10004033
580 Ga0157375_10114320
581 Ga0157375_10216735
582 Ga0157375_10966303
583 Ga0163163_10003621
584 Ga0163163_10005263
585 Ga0163163_10272888
586 Ga0157380_10016401
587 Ga0157377_10060688
588 Ga0157377_10107083
589 Ga0157377_10569379
590 Ga0157379_10006033
591 Ga0157379_10131491
592 Ga0157376_10029878
593 Ga0157376_10043659
594 Ga0157376_10082094
595 Ga0157376_10145616
596 Ga0157376_10998257
597 Ga0163161_10162103
598 Ga0209758_1010781
599 Ga0209758_1146026
600 Ga0207656_10011434
601 Ga0207656_10299791
602 Ga0207682_10020100
603 Ga0207642_10020909
604 Ga0207680_10001996
605 Ga0207680_10019083
606 Ga0207645_10014239
607 Ga0207645_10093620
608 Ga0207643_10258601
609 Ga0207684_10550520
610 Ga0207695_10586582
611 Ga0207660_10726453
612 Ga0207662_10145605
613 Ga0207649_10190244
614 Ga0207652_10465949
615 Ga0207646_10055389
616 Ga0207694_10210306
617 Ga0207650_10143130
618 Ga0207650_10978149
619 Ga0207659_10001313
620 Ga0207659_10125844
621 Ga0207687_10027404
622 Ga0207664_11824797
623 Ga0207644_10003952
624 Ga0207644_10016186
625 Ga0207644_11219251
626 Ga0207690_11373650
627 Ga0207690_11543631
628 Ga0207706_10117527
629 Ga0207706_10180376
630 Ga0207706_10192415
631 Ga0207706_10302997
632 Ga0207670_10018483
633 Ga0207670_10178632
634 Ga0207670_10477904
635 Ga0207670_10598113
636 Ga0207669_11276680
637 Ga0207669_11314290
638 Ga0207669_11541625
639 Ga0207691_10595766
640 Ga0207711_10008571
641 Ga0207711_10019340
642 Ga0207711_10811476
643 Ga0207711_10815017
644 Ga0207711_10863526
645 Ga0207689_10101217
646 Ga0207689_10736601
647 Ga0207661_10688391
648 Ga0207679_10245176
649 Ga0207679_10718554
650 Ga0207651_10002814
651 Ga0207651_10207608
652 Ga0207651_11218539
653 Ga0207712_10890842
654 Ga0207640_10123040
655 Ga0207640_10218414
656 Ga0207658_10023239
657 Ga0207658_10317112
658 Ga0207677_10000836
659 Ga0207677_10126514
660 Ga0207703_10000361
661 Ga0207703_10012746
662 Ga0207703_12028846
663 Ga0207639_10893947
664 Ga0207639_12256754
665 Ga0207678_10448531
666 Ga0207708_10074373
667 Ga0207702_10799838
668 Ga0207702_12010925
669 Ga0207641_10013662
670 Ga0207641_10072615
671 Ga0207641_10136505
672 Ga0207641_10143735
673 Ga0207648_10149064
674 Ga0207648_10204347
675 Ga0207676_10001719
676 Ga0207676_10005984
677 Ga0207676_10114381
678 Ga0207676_10175982
679 Ga0207675_100269953
680 Ga0207675_100343052
681 Ga0207675_101826959
682 Ga0207683_10001709
683 Ga0207683_10508720
684 Ga0207683_10739446
685 Ga0207683_10841647
686 Ga0209974_10299195
687 Ga0268266_10457890
688 Ga0268266_11923079
689 Ga0268265_10499158
690 Ga0268265_11927386
691 Ga0268264_10029230
692 Ga0268264_10287790
693 Ga0268264_10364915
694 Ga0265318_10160363
695 Ga0265332_10455508
696 Ga0265320_10052650
697 Ga0307509_10139340
698 Ga0307408_100013777
699 Ga0307508_10592921
700 Ga0307405_10016815
701 Ga0307413_10191370
702 Ga0307410_10198747
703 Ga0307406_10182167
704 Ga0307407_10068744
705 Ga0307407_10611320
706 Ga0307412_10219236
707 Ga0307409_100004535
708 Ga0307416_100010922
709 Ga0307414_10001945
710 Ga0307411_10003890
711 Ga0307415_100006673
712 Ga0373934_0199508
713 Ga0373953_0153916
714 Ga0373954_0161707
715 Ga0373956_0451582
716 Ga0373957_0149003
717 Ga0373957_0192826
718 Ga0373955_0007885
719 Ga0373942_0117963
720 Ga0373924_0082373
721 Ga0373935_0466133
722 Ga0373933_0112722
723 Ga0373937_0007090
724 Ga0373937_0045362
725 Ga0373937_1959408
726 Ga0395901_0030144
727 Ga0439435_0019462
728 Ga0439444_0001786
729 Ga0451576_0206826
730 Ga0451576_2717746
731 Ga0495592_0000211
732 Ga0495603_0100450
733 Ga0495580_0405827
734 Ga0495582_0103179
735 Ga0495639_0214143
736 Ga0495630_0697473
737 Ga0495640_0434905
738 Ga0495586_0561234
739 Ga0495668_0163040
740 Ga0495635_0508947
741 Ga0495588_0680746
742 Ga0495647_0365807
743 Ga0495658_0482218
744 Ga0495658_0522170
745 Ga0495636_0136153
746 Ga0496100_0084758
747 Ga0496100_0377219
748 Ga0496101_0052423
749 Ga0496101_0063151
750 Ga0496101_0907007
751 Ga0496102_0488269
752 Ga0496104_0067989
753 Ga0496104_0206654
754 Ga0496104_0816711
755 Ga0496105_0019171
756 Ga0496106_0244330
757 Ga0496106_0349471
758 Ga0496107_0464006
759 Ga0496108_0049577
760 Ga0496108_0052507
761 Ga0496108_0108630
762 Ga0496108_0208143
763 Ga0496109_0027154
764 Ga0496109_0158611
765 Ga0496112_0093438
766 Ga0496112_0235794
767 Ga0496113_0155083
768 Ga0496113_0315945
769 Ga0496114_0002420
770 Ga0496114_0094349
771 Ga0496114_0593413
772 Ga0496115_0001723
773 Ga0496115_0391476
774 Ga0496126_1024142
775 Ga0501032_0502968
776 Ga0501036_1074452
777 Ga0501039_0887661
778 Ga0501067_0262822
779 Ga0501074_0889681
780 Ga0501076_0134798
781 Ga0501255_021533
782 Ga0501079_0256142
783 Ga0501045_0079978
784 Ga0501212_063297
785 nmdc:mga03683_103358_c1
786 nmdc:mga0yw44_250236_c1
787 nmdc:mga05p37_103839_c1
788 nmdc:mga09592_18252_c1
789 nmdc:mga0qj67_456859_c1
790 nmdc:mga06r32_1422554_c1
791 nmdc:mga0rr50_435965_c1
792 Ga0495601_0029498
793 Ga0495601_0209695
794 Ga0495601_0366555
795 Ga0500643_049130
796 Ga0500659_0264960
797 Ga0500616_0065372
798 Ga0500616_0379667
799 Ga0500622_0022769
800 Ga0500636_0021907
801 Ga0501082_0529722
802 2882634378
803 2885311560
804 2885327064
805 2885341825
806 2889041094
807 2922392052
808 2929615887
809 2929630500
810 2933578827
811 2968118285
812 2987658666
813 8055747534
814 8056680492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07045

DUF1330

Domain of unknown function (DUF1330)

3

96

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.9116 2 94
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9105 2 97
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.8839 2 97
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8757 2 94
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.7917 2 98
ID Description Score Start End Superfamily
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9018 1 94 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8752 1 94 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8678 1 95 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8593 1 95 3.30.70.100
3hhlC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.723 2 99 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A6P1RAM4-F1-model_v4 DUF1330 domain-containing protein 0.9797 2 98
AF-A0A845IGC5-F1-model_v4 deleted 0.9734 2 99
AF-A0A3A1WHZ3-F1-model_v4 deleted 0.9674 1 99
AF-A0A537QST1-F1-model_v4 DUF1330 domain-containing protein 0.9662 1 96
AF-A0A2E6UIB0-F1-model_v4 deleted 0.9637 1 96

Map