F436521

General Info

Members Datasets Scaffolds Average Seq Length
407 252 399 216

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0149749|Ga0466964_0149749_38_736
Length 232
Sequence MDPQVIIARRVALELRAGNLVNLGIGIPTLVANYLPPGLHVFFQSENGLIGTGPIPEQGMAHPLLTDAGGRPISALPGASTFDSATSFGLIRGGHVDITVLGGLQVDADGHLANWMIPGKMVPGMGGAMDLVSGAKRVIVAMQHAAKGKSKIVPRCGLPLTSTRSVDLVVTDMAVMGFAGGQMTLLETAPGVSVAEVIAVTEAELVIPDNIPEMKIGRDSAAPNDIGVRRLH

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
3 2842682962 Bacillus sp. R-72492 Isolate Unclassified
4 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
5 2857581216 Bacillus sp. R-71922 Isolate Unclassified
6 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
7 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
129 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
159 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
252 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.97
Nodule 0.49
Rhizoplane 3.44
Rhizosphere 90.66
Stem 0
Stem Tuber 0
Unclassified 3.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10205987 3300005289 Bacteria 1127
2 Ga0065707_10082380 3300005295 Bacteria 15887
3 Ga0070676_10239220 3300005328 Bacteria 1207
4 Ga0070683_100000244 3300005329 Bacteria 37279
5 Ga0070670_100329606 3300005331 Bacteria 1339
6 Ga0070666_10083209 3300005335 Bacteria 2189
7 Ga0070666_10196123 3300005335 Bacteria 1420
8 Ga0070680_100000715 3300005336 Bacteria 23059
9 Ga0070680_100171637 3300005336 Bacteria 1825
10 Ga0070682_100009825 3300005337 Bacteria 5417
11 Ga0068868_100487265 3300005338 Bacteria 1078
12 Ga0070660_100001964 3300005339 Bacteria 14177
13 Ga0070661_100115665 3300005344 Bacteria 2006
14 Ga0070669_100342352 3300005353 Bacteria 1212
15 Ga0070671_100010572 3300005355 Bacteria 7411
16 Ga0070671_100416851 3300005355 Bacteria 1150
17 Ga0070673_100166071 3300005364 Bacteria 1881
18 Ga0070659_100448670 3300005366 Bacteria 1094
19 Ga0070667_100019093 3300005367 Bacteria 5685
20 Ga0070709_10000274 3300005434 Bacteria 33042
21 Ga0070714_100002601 3300005435 Bacteria 13308
22 Ga0070713_100028315 3300005436 Bacteria 4424
23 Ga0070713_100392948 3300005436 Bacteria 1294
24 Ga0070710_10000279 3300005437 Bacteria 24157
25 Ga0070711_100000568 3300005439 Bacteria 19319
26 Ga0070711_100346237 3300005439 Bacteria 1194
27 Ga0070711_100534765 3300005439 Bacteria 970
28 Ga0070663_100755216 3300005455 Bacteria 831
29 Ga0070678_100411614 3300005456 Bacteria 1177
30 Ga0070662_100287863 3300005457 Bacteria 1331
31 Ga0070681_10382837 3300005458 Bacteria 1317
32 Ga0068867_100161639 3300005459 Bacteria 1766
33 Ga0070679_100083926 3300005530 Bacteria 3174
34 Ga0070679_100142839 3300005530 Bacteria 2372
35 Ga0070679_100317136 3300005530 Bacteria 1508
36 Ga0070684_100001779 3300005535 Bacteria 15735
37 Ga0068853_100003138 3300005539 Bacteria 12631
38 Ga0068853_100053637 3300005539 Bacteria 3472
39 Ga0070672_100009981 3300005543 Bacteria 6569
40 Ga0070665_100082102 3300005548 Bacteria 3228
41 Ga0070704_100129256 3300005549 Unclassified 1955
42 Ga0068855_100024006 3300005563 Bacteria 7300
43 Ga0068857_100005328 3300005577 Bacteria 10954
44 Ga0068857_100462832 3300005577 Bacteria 1187
45 Ga0068854_100381987 3300005578 Bacteria 1161
46 Ga0068852_100026879 3300005616 Bacteria 4684
47 Ga0068852_100263128 3300005616 Bacteria 1657
48 Ga0068859_100340461 3300005617 Bacteria 1594
49 Ga0068864_100045250 3300005618 Bacteria 3775
50 Ga0068866_10148680 3300005718 Bacteria 1354
51 Ga0068861_100359270 3300005719 Bacteria 1280
52 Ga0068851_10126421 3300005834 Bacteria 1379
53 Ga0068863_100458323 3300005841 Bacteria 1252
54 Ga0081455_10019715 3300005937 Bacteria 6370
55 Ga0081455_10102326 3300005937 Bacteria 2297
56 Ga0081455_10326523 3300005937 Bacteria 1091
57 Ga0081538_10011226 3300005981 Bacteria 7272
58 Ga0081540_1019580 3300005983 Bacteria 4105
59 Ga0081539_10002071 3300005985 Bacteria 30041
60 Ga0070717_10371165 3300006028 Bacteria 1282
61 Ga0075365_10013256 3300006038 Bacteria 4919
62 Ga0075364_10001860 3300006051 Bacteria 11713
63 Ga0070716_100010104 3300006173 Bacteria 4725
64 Ga0070716_100092770 3300006173 Bacteria 1831
65 Ga0070712_100683004 3300006175 Bacteria 874
66 Ga0068871_100029300 3300006358 Bacteria 4321
67 Ga0075428_100034493 3300006844 Bacteria 5581
68 Ga0075430_100008845 3300006846 Bacteria 8495
69 Ga0075430_100039449 3300006846 Bacteria 3998
70 Ga0075431_100006106 3300006847 Bacteria 11947
71 Ga0075431_100044620 3300006847 Bacteria 4572
72 Ga0075434_100013054 3300006871 Bacteria 7888
73 Ga0075434_100021710 3300006871 Bacteria 6244
74 Ga0075434_100029731 3300006871 Bacteria 5378
75 Ga0097620_100340477 3300006931 Bacteria 1594
76 Ga0075435_100331328 3300007076 Bacteria 1304
77 Ga0099794_10008948 3300007265 Bacteria 4177
78 Ga0099794_10015741 3300007265 Bacteria 3343
79 Ga0105240_10003096 3300009093 Bacteria 26156
80 Ga0111539_10031369 3300009094 Bacteria 6455
81 Ga0114129_10029858 3300009147 Bacteria 7720
82 Ga0114129_10675043 3300009147 Bacteria 1331
83 Ga0105241_10212156 3300009174 Bacteria 1623
84 Ga0105248_10001407 3300009177 Bacteria 26860
85 Ga0105248_10007457 3300009177 Bacteria 12001
86 Ga0105237_10002350 3300009545 Bacteria 23518
87 Ga0105238_10000408 3300009551 Bacteria 45693
88 Ga0105238_10065589 3300009551 Bacteria 3632
89 Ga0105238_10140071 3300009551 Bacteria 2396
90 Ga0105239_10026031 3300010375 Bacteria 6441
91 Ga0105239_11671024 3300010375 Bacteria 737
92 Ga0157369_10000685 3300013105 Bacteria 43830
93 Ga0157369_10007214 3300013105 Bacteria 12810
94 Ga0157369_10477856 3300013105 Bacteria 1290
95 Ga0157374_10210294 3300013296 Bacteria 1907
96 Ga0157378_10170687 3300013297 Unclassified 2040
97 Ga0163162_10021199 3300013306 Bacteria 6394
98 Ga0163162_10177126 3300013306 Bacteria 2258
99 Ga0163162_10363516 3300013306 Bacteria 1580
100 Ga0157372_10592821 3300013307 Bacteria 1292
101 Ga0157375_10977435 3300013308 Bacteria 987
102 Ga0157380_11290582 3300014326 Bacteria 777
103 Ga0157379_10150790 3300014968 Bacteria 2097
104 Ga0157376_10363676 3300014969 Bacteria 1388
105 Ga0213872_10111054 3300021361 Bacteria 1218
106 Ga0213876_10001337 3300021384 Bacteria 15450
107 Ga0209148_1011935 3300025254 Bacteria 1601
108 Ga0209025_1035116 3300025294 Bacteria 2272
109 Ga0207656_10005202 3300025321 Bacteria 4577
110 Ga0207692_10002196 3300025898 Bacteria 7463
111 Ga0207692_10297291 3300025898 Bacteria 981
112 Ga0207688_10113238 3300025901 Bacteria 1577
113 Ga0207680_10038641 3300025903 Bacteria 2764
114 Ga0207680_10057097 3300025903 Bacteria 2361
115 Ga0207647_10070464 3300025904 Bacteria 2112
116 Ga0207699_10000285 3300025906 Bacteria 27688
117 Ga0207699_10019565 3300025906 Bacteria 3614
118 Ga0207699_10069797 3300025906 Bacteria 2144
119 Ga0207684_10615131 3300025910 Bacteria 927
120 Ga0207654_10220802 3300025911 Bacteria 1257
121 Ga0207707_10000126 3300025912 Bacteria 78954
122 Ga0207695_10142482 3300025913 Bacteria 2344
123 Ga0207671_10119210 3300025914 Bacteria 2016
124 Ga0207693_10262211 3300025915 Bacteria 1355
125 Ga0207693_10291029 3300025915 Bacteria 1280
126 Ga0207663_10001369 3300025916 Bacteria 11308
127 Ga0207663_10372188 3300025916 Bacteria 1086
128 Ga0207660_10004286 3300025917 Bacteria 9303
129 Ga0207660_10247262 3300025917 Bacteria 1407
130 Ga0207657_10000261 3300025919 Bacteria 55977
131 Ga0207649_10094368 3300025920 Bacteria 1966
132 Ga0207652_10000994 3300025921 Bacteria 26203
133 Ga0207652_10106236 3300025921 Bacteria 2485
134 Ga0207652_10333949 3300025921 Bacteria 1368
135 Ga0207681_10147078 3300025923 Bacteria 1762
136 Ga0207694_10060710 3300025924 Bacteria 2942
137 Ga0207694_10475570 3300025924 Bacteria 1045
138 Ga0207687_10821177 3300025927 Bacteria 793
139 Ga0207700_10020158 3300025928 Bacteria 4521
140 Ga0207700_10342325 3300025928 Bacteria 1300
141 Ga0207664_10004606 3300025929 Bacteria 9346
142 Ga0207664_10013461 3300025929 Bacteria 5872
143 Ga0207644_10012262 3300025931 Bacteria 5690
144 Ga0207644_10046510 3300025931 Bacteria 3092
145 Ga0207644_10624219 3300025931 Bacteria 896
146 Ga0207706_10040677 3300025933 Bacteria 4120
147 Ga0207665_10015276 3300025939 Bacteria 5041
148 Ga0207711_10008607 3300025941 Bacteria 8528
149 Ga0207711_10011986 3300025941 Bacteria 7205
150 Ga0207661_10002724 3300025944 Bacteria 12164
151 Ga0207667_10002572 3300025949 Bacteria 22564
152 Ga0207651_10310342 3300025960 Bacteria 1315
153 Ga0207640_10855050 3300025981 Bacteria 792
154 Ga0207658_10075415 3300025986 Bacteria 2566
155 Ga0207639_10085546 3300026041 Bacteria 2508
156 Ga0207639_10138275 3300026041 Bacteria 2026
157 Ga0207676_10036241 3300026095 Bacteria 3751
158 Ga0207674_10009856 3300026116 Bacteria 10874
159 Ga0207674_10565232 3300026116 Bacteria 1099
160 Ga0207675_100408878 3300026118 Bacteria 1338
161 Ga0207675_101022564 3300026118 Bacteria 845
162 Ga0209179_1001307 3300027512 Bacteria 3004
163 Ga0209983_1035752 3300027665 Bacteria 1067
164 Ga0209588_1018639 3300027671 Bacteria 2161
165 Ga0207428_10002050 3300027907 Bacteria 20323
166 Ga0307415_100133291 3300032126 Bacteria 1885
167 Ga0373948_0019781 3300034817 Bacteria 1276
168 Ga0373928_0002592 3300035084 Bacteria 3502
169 Ga0373949_0002826 3300035090 Bacteria 4315
170 Ga0373932_0000455 3300035112 Bacteria 12513
171 Ga0373936_0048521 3300035113 Bacteria 1714
172 Ga0373939_0007682 3300035114 Bacteria 2624
173 Ga0373941_0003528 3300035115 Bacteria 3550
174 Ga0373954_0010774 3300035118 Bacteria 4043
175 Ga0373956_0008179 3300035119 Bacteria 4232
176 Ga0373956_0106107 3300035119 Bacteria 1306
177 Ga0373956_0218643 3300035119 Bacteria 904
178 Ga0373943_0048749 3300035170 Bacteria 2076
179 Ga0373946_0015444 3300035171 Bacteria 2896
180 Ga0373955_0003182 3300035172 Bacteria 7189
181 Ga0373955_0152392 3300035172 Bacteria 1361
182 Ga0373942_0005979 3300035207 Bacteria 2811
183 Ga0373961_0019454 3300035241 Bacteria 1784
184 Ga0373924_0069309 3300035410 Bacteria 1486
185 Ga0373924_0094051 3300035410 Bacteria 1284
186 Ga0373924_0356505 3300035410 Bacteria 652
187 Ga0373931_0000218 3300035691 Bacteria 24408
188 Ga0373935_0000186 3300035692 Bacteria 29290
189 Ga0373935_0007120 3300035692 Bacteria 6679
190 Ga0373935_0172960 3300035692 Bacteria 1478
191 Ga0373935_0174993 3300035692 Bacteria 1470
192 Ga0373927_0001649 3300035695 Bacteria 16726
193 Ga0373927_0029011 3300035695 Bacteria 3606
194 Ga0373927_0226061 3300035695 Bacteria 1229
195 Ga0373933_0026643 3300035724 Bacteria 3321
196 Ga0373933_0446740 3300035724 Bacteria 845
197 Ga0373947_0004236 3300035725 Bacteria 8412
198 Ga0373947_0009796 3300035725 Bacteria 5498
199 Ga0373947_0018853 3300035725 Bacteria 3975
200 Ga0373937_0005546 3300036401 Bacteria 10823
201 Ga0373937_0022692 3300036401 Bacteria 5646
202 Ga0373937_0076809 3300036401 Bacteria 3085
203 Ga0373925_0001973 3300037068 Bacteria 16990
204 Ga0373925_0034111 3300037068 Bacteria 3751
205 Ga0373925_0040570 3300037068 Bacteria 3447
206 Ga0373925_0147200 3300037068 Bacteria 1847
207 Ga0395899_0056548 3300037312 Bacteria 2899
208 Ga0395900_0002116 3300037418 Bacteria 22233
209 Ga0395900_0474017 3300037418 Bacteria 1205
210 Ga0395898_0004650 3300037466 Bacteria 14963
211 Ga0395901_0007798 3300038443 Bacteria 10800
212 Ga0395901_0137850 3300038443 Bacteria 2564
213 Ga0436365_0248834 3300039437 Bacteria 934
214 Ga0436365_1845823 3300039437 Bacteria 28721
215 Ga0436361_0434870 3300039447 Bacteria 1548
216 Ga0436363_0490383 3300039450 Bacteria 1152
217 Ga0436363_1296724 3300039450 Bacteria 3003
218 Ga0451807_2204629 3300041486 Bacteria 896
219 Ga0439460_0001614 3300042461 Bacteria 5341
220 Ga0450893_0017772 3300042532 Bacteria 1210
221 Ga0466966_0224832 3300044684 Bacteria 1133
222 Ga0466964_0149749 3300044706 Bacteria 1081
223 Ga0466957_0125173 3300044842 Bacteria 1642
224 Ga0451576_0007577 3300045051 Bacteria 12933
225 Ga0466967_0201057 3300045976 Bacteria 1887
226 Ga0466967_0929108 3300045976 Bacteria 865
227 Ga0495592_0036763 3300046454 Bacteria 3687
228 Ga0495592_0043076 3300046454 Bacteria 3379
229 Ga0495592_0199798 3300046454 Bacteria 1350
230 Ga0495603_0001827 3300046455 Bacteria 12557
231 Ga0495603_0011786 3300046455 Bacteria 5292
232 Ga0495629_0001739 3300046459 Bacteria 17078
233 Ga0495629_0020241 3300046459 Bacteria 4751
234 Ga0495641_0005678 3300046461 Bacteria 8314
235 Ga0495641_0013726 3300046461 Bacteria 4429
236 Ga0495653_0079941 3300046463 Bacteria 2420
237 Ga0495653_0305758 3300046463 Bacteria 1035
238 Ga0495580_0008936 3300046472 Bacteria 7925
239 Ga0495580_0034016 3300046472 Bacteria 3670
240 Ga0495582_0000547 3300046473 Bacteria 20786
241 Ga0495582_0024905 3300046473 Bacteria 3277
242 Ga0495639_0000163 3300046475 Bacteria 34576
243 Ga0495639_0003605 3300046475 Bacteria 6679
244 Ga0495662_0000616 3300046476 Bacteria 16523
245 Ga0495662_0001699 3300046476 Bacteria 10997
246 Ga0495662_0014629 3300046476 Bacteria 3814
247 Ga0495664_0002121 3300046477 Bacteria 10590
248 Ga0495664_0009904 3300046477 Bacteria 5347
249 Ga0495664_0024286 3300046477 Bacteria 3522
250 Ga0495664_0201956 3300046477 Bacteria 1204
251 Ga0495594_0001043 3300046499 Bacteria 14436
252 Ga0495594_0062469 3300046499 Bacteria 2062
253 Ga0495594_0255135 3300046499 Bacteria 999
254 Ga0495618_0013385 3300046514 Bacteria 4991
255 Ga0495618_0015615 3300046514 Bacteria 4635
256 Ga0495618_0032859 3300046514 Bacteria 3251
257 Ga0495618_0221256 3300046514 Bacteria 1194
258 Ga0495628_0370616 3300046516 Bacteria 1050
259 Ga0495630_0011607 3300046517 Bacteria 6382
260 Ga0495630_0030941 3300046517 Bacteria 3984
261 Ga0495630_0249268 3300046517 Bacteria 1357
262 Ga0495652_0065140 3300046529 Bacteria 3063
263 Ga0495652_0074664 3300046529 Bacteria 2819
264 Ga0495652_0559394 3300046529 Bacteria 785
265 Ga0495665_0003016 3300046531 Bacteria 9100
266 Ga0495665_0038214 3300046531 Bacteria 2560
267 Ga0495665_0051603 3300046531 Bacteria 2178
268 Ga0495665_0054338 3300046531 Bacteria 2116
269 Ga0495665_0078934 3300046531 Bacteria 1732
270 Ga0495640_0008977 3300046533 Bacteria 7807
271 Ga0495640_0014030 3300046533 Bacteria 6078
272 Ga0495640_0014858 3300046533 Bacteria 5874
273 Ga0495640_0126597 3300046533 Bacteria 1656
274 Ga0495586_0172069 3300046535 Bacteria 1224
275 Ga0495622_0003321 3300046557 Bacteria 7597
276 Ga0495622_0191090 3300046557 Bacteria 915
277 Ga0495667_0032545 3300046559 Bacteria 3494
278 Ga0495634_0002719 3300046642 Bacteria 14550
279 Ga0495634_0004319 3300046642 Bacteria 11200
280 Ga0495634_0022303 3300046642 Bacteria 4461
281 Ga0495634_0041258 3300046642 Bacteria 3134
282 Ga0495634_0047577 3300046642 Bacteria 2889
283 Ga0495635_0002402 3300046663 Bacteria 12759
284 Ga0495635_0009130 3300046663 Bacteria 6923
285 Ga0495635_0012006 3300046663 Bacteria 6071
286 Ga0495635_0079331 3300046663 Bacteria 2247
287 Ga0495588_0019172 3300046674 Bacteria 3348
288 Ga0495657_0037174 3300046675 Bacteria 3358
289 Ga0495599_0039220 3300046678 Bacteria 2976
290 Ga0495623_0147425 3300046679 Bacteria 1394
291 Ga0495647_0138754 3300046681 Bacteria 1035
292 Ga0495658_0004596 3300046683 Bacteria 6794
293 Ga0495658_0022835 3300046683 Bacteria 3313
294 Ga0495658_0047282 3300046683 Bacteria 2422
295 Ga0495658_0048887 3300046683 Bacteria 2387
296 Ga0495658_0545302 3300046683 Bacteria 742
297 Ga0495613_0004558 3300046689 Bacteria 10393
298 Ga0495613_0028055 3300046689 Bacteria 4189
299 Ga0495624_0003121 3300046690 Bacteria 12384
300 Ga0495624_0031698 3300046690 Bacteria 3433
301 Ga0495600_0078302 3300046809 Bacteria 2159
302 Ga0495581_0000979 3300047315 Bacteria 15353
303 Ga0495581_0003908 3300047315 Bacteria 8574
304 Ga0495604_0035530 3300047317 Bacteria 3936
305 Ga0495604_0569592 3300047317 Bacteria 729
306 Ga0495674_0001683 3300047319 Bacteria 21746
307 Ga0495674_0005950 3300047319 Bacteria 11703
308 Ga0495674_0025182 3300047319 Bacteria 5460
309 Ga0495674_0026239 3300047319 Bacteria 5333
310 Ga0495676_0045114 3300047321 Bacteria 3591
311 Ga0495676_0250853 3300047321 Bacteria 1207
312 Ga0495680_0104666 3300047322 Bacteria 2105
313 Ga0495680_0106215 3300047322 Bacteria 2087
314 Ga0495675_0189064 3300047444 Bacteria 1258
315 Ga0495684_0008291 3300047471 Bacteria 8046
316 Ga0495684_0206923 3300047471 Bacteria 1444
317 Ga0495686_0042656 3300047472 Bacteria 2882
318 Ga0495593_0005448 3300047673 Bacteria 7519
319 Ga0495593_0006169 3300047673 Bacteria 7050
320 Ga0495602_0162886 3300048088 Bacteria 1739
321 Ga0495602_0174763 3300048088 Bacteria 1663
322 Ga0496101_0086025 3300048904 Unclassified 2331
323 Ga0496101_0162434 3300048904 Bacteria 1714
324 Ga0496102_0067263 3300048905 Bacteria 3286
325 Ga0496102_0585634 3300048905 Bacteria 1038
326 Ga0496102_1290517 3300048905 Bacteria 649
327 Ga0496106_0010197 3300048909 Bacteria 6944
328 Ga0496106_0303746 3300048909 Bacteria 1280
329 Ga0496108_0538357 3300048911 Bacteria 1019
330 Ga0496109_0441065 3300048912 Bacteria 1230
331 Ga0496110_0075067 3300048913 Bacteria 3004
332 Ga0496110_0481841 3300048913 Bacteria 1130
333 Ga0496111_0501608 3300048914 Bacteria 893
334 Ga0496115_0466797 3300048918 Bacteria 1018
335 Ga0496121_0122919 3300048924 Bacteria 1957
336 Ga0496125_0048238 3300048928 Bacteria 3553
337 Ga0496126_0017173 3300048929 Bacteria 7216
338 Ga0496126_0030150 3300048929 Bacteria 5143
339 Ga0501036_0519324 3300049572 Bacteria 990
340 Ga0501038_0196655 3300049574 Bacteria 1620
341 Ga0501040_0035858 3300049576 Bacteria 3365
342 Ga0501040_0207915 3300049576 Bacteria 1391
343 Ga0501042_0422089 3300049578 Bacteria 966
344 Ga0501043_0177384 3300049579 Bacteria 1661
345 Ga0501048_0187824 3300049582 Bacteria 1464
346 Ga0501071_0019978 3300049587 Bacteria 4653
347 Ga0501072_0043830 3300049588 Bacteria 3517
348 Ga0501072_0051791 3300049588 Bacteria 3232
349 Ga0501073_0183413 3300049589 Bacteria 1449
350 Ga0501075_0010572 3300049591 Bacteria 6489
351 Ga0501075_0346414 3300049591 Bacteria 1132
352 Ga0501076_0020310 3300049592 Bacteria 5084
353 Ga0501077_0075537 3300049593 Bacteria 2134
354 Ga0501079_0040966 3300049741 Bacteria 3574
355 Ga0501080_0707418 3300049742 Bacteria 888
356 Ga0501081_0026219 3300049743 Bacteria 3928
357 Ga0501081_0039813 3300049743 Bacteria 3217
358 Ga0501045_0061879 3300049824 Bacteria 2746
359 nmdc:mga03683_13187_c1 3300050489 Bacteria 3035
360 nmdc:mga00v17_3487_c1 3300050491 Bacteria 8140
361 nmdc:mga0yw44_252086_c1 3300050492 Bacteria 1175
362 nmdc:mga05p37_265752_c1 3300050507 Bacteria 2052
363 nmdc:mga05p37_462853_c1 3300050507 Unclassified 1465
364 nmdc:mga09592_24299_c1 3300050508 Bacteria 5011
365 nmdc:mga09592_331658_c1 3300050508 Bacteria 1317
366 nmdc:mga0qj67_190726_c1 3300050509 Bacteria 1666
367 nmdc:mga0qj67_6595_c1 3300050509 Bacteria 8529
368 nmdc:mga06r32_8490_c1 3300050510 Bacteria 9260
369 nmdc:mga06r32_98429_c1 3300050510 Bacteria 2867
370 nmdc:mga08y16_23485_c1 3300050511 Bacteria 6515
371 nmdc:mga08y16_523760_c1 3300050511 Bacteria 1202
372 nmdc:mga0n895_122768_c1 3300050512 Bacteria 2619
373 nmdc:mga0n895_133683_c1 3300050512 Unclassified 2506
374 nmdc:mga0n895_3895_c1 3300050512 Bacteria 12132
375 nmdc:mga0n895_5274_c1 3300050512 Bacteria 10761
376 nmdc:mga0rr50_219848_c1 3300050513 Bacteria 1568
377 nmdc:mga0rr50_248880_c1 3300050513 Bacteria 1475
378 nmdc:mga0rr50_46967_c1 3300050513 Bacteria 3181
379 nmdc:mga0rr50_517575_c1 3300050513 Bacteria 1015
380 nmdc:mga0rr50_887532_c1 3300050513 Bacteria 760
381 nmdc:mga0rr50_995041_c1 3300050513 Bacteria 714
382 nmdc:mga08x19_605193_c1 3300050514 Bacteria 777
383 nmdc:mga0a205_41154_c1 3300050515 Bacteria 4450
384 nmdc:mga0a205_662837_c1 3300050515 Bacteria 894
385 Ga0495601_0010230 3300053077 Bacteria 5577
386 Ga0495601_0018364 3300053077 Bacteria 4255
387 Ga0495601_0021359 3300053077 Bacteria 3963
388 Ga0495601_0120168 3300053077 Bacteria 1706
389 Ga0495612_0008816 3300053078 Bacteria 4088
390 Ga0495612_0030130 3300053078 Bacteria 2186
391 Ga0495595_0000325 3300053084 Bacteria 18606
392 Ga0495619_0023453 3300053085 Bacteria 3956
393 Ga0495619_0030068 3300053085 Bacteria 3514
394 Ga0495619_0156736 3300053085 Bacteria 1571
395 Ga0500637_0002409 3300053178 Bacteria 8313
396 Ga0501082_0063082 3300060353 Bacteria 3191
397 Ga0501082_0199079 3300060353 Bacteria 1743
398 Ga0501082_0795027 3300060353 Bacteria 828
399 Ga0530510_0007515 3300061734 Bacteria 7590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0255135 Ga0495594_0255135_14_574 186
2 3300050514 nmdc:mga08x19_605193_c1 nmdc:mga08x19_605193_c1_37_600 187
3 3300053178 Ga0500637_0002409 Ga0500637_0002409_7718_8281 187
4 3300049593 Ga0501077_0075537 Ga0501077_0075537_187_774 192
5 3300035410 Ga0373924_0356505 Ga0373924_0356505_20_616 198
6 3300035692 Ga0373935_0172960 Ga0373935_0172960_872_1468 198
7 3300047322 Ga0495680_0104666 Ga0495680_0104666_19_615 198
8 3300048905 Ga0496102_1290517 Ga0496102_1290517_32_628 198
9 3300010375 Ga0105239_11671024 Ga0105239_116710241 203
10 3300013306 Ga0163162_10021199 Ga0163162_100211993 204
11 3300025294 Ga0209025_1035116 Ga0209025_10351163 205
12 iso_pu_bacteria 2816332186 2816865198 205
13 iso_pu_bacteria 2842682962 2842684105 205
14 iso_pu_bacteria 2857581216 2857582094 205
15 3300046463 Ga0495653_0305758 Ga0495653_0305758_397_1017 206
16 3300005455 Ga0070663_100755216 Ga0070663_1007552161 208
17 3300006871 Ga0075434_100029731 Ga0075434_1000297318 211
18 iso_pu_bacteria 2513237098 2513671918 212
19 iso_pu_bacteria 2857509624 2857515131 212
20 iso_pu_bacteria 2874604998 2874611308 212
21 iso_pu_bacteria 2903768456 2903771204 212
22 iso_pu_bacteria 8022948649 8022952030 212
23 3300005295 Ga0065707_10082380 Ga0065707_1008238020 215
24 3300025923 Ga0207681_10147078 Ga0207681_101470782 215
25 3300034817 Ga0373948_0019781 Ga0373948_0019781_280_942 215
26 3300035084 Ga0373928_0002592 Ga0373928_0002592_1230_1892 215
27 3300035090 Ga0373949_0002826 Ga0373949_0002826_410_1072 215
28 3300035112 Ga0373932_0000455 Ga0373932_0000455_7636_8298 215
29 3300035114 Ga0373939_0007682 Ga0373939_0007682_397_1059 215
30 3300035115 Ga0373941_0003528 Ga0373941_0003528_2062_2724 215
31 3300035207 Ga0373942_0005979 Ga0373942_0005979_1786_2448 215
32 3300035241 Ga0373961_0019454 Ga0373961_0019454_640_1302 215
33 3300035691 Ga0373931_0000218 Ga0373931_0000218_16505_17167 215
34 3300045051 Ga0451576_0007577 Ga0451576_0007577_7090_7752 215
35 3300046476 Ga0495662_0014629 Ga0495662_0014629_2510_3157 215
36 3300050511 nmdc:mga08y16_523760_c1 nmdc:mga08y16_523760_c1_54_716 215
37 3300005289 Ga0065704_10205987 Ga0065704_102059872 216
38 3300005328 Ga0070676_10239220 Ga0070676_102392202 216
39 3300005329 Ga0070683_100000244 Ga0070683_1000002446 216
40 3300005331 Ga0070670_100329606 Ga0070670_1003296062 216
41 3300005335 Ga0070666_10083209 Ga0070666_100832092 216
42 3300005335 Ga0070666_10196123 Ga0070666_101961232 216
43 3300005336 Ga0070680_100000715 Ga0070680_10000071523 216
44 3300005336 Ga0070680_100171637 Ga0070680_1001716372 216
45 3300005337 Ga0070682_100009825 Ga0070682_1000098254 216
46 3300005338 Ga0068868_100487265 Ga0068868_1004872651 216
47 3300005339 Ga0070660_100001964 Ga0070660_10000196412 216
48 3300005344 Ga0070661_100115665 Ga0070661_1001156653 216
49 3300005353 Ga0070669_100342352 Ga0070669_1003423521 216
50 3300005355 Ga0070671_100010572 Ga0070671_1000105725 216
51 3300005355 Ga0070671_100416851 Ga0070671_1004168512 216
52 3300005364 Ga0070673_100166071 Ga0070673_1001660712 216
53 3300005366 Ga0070659_100448670 Ga0070659_1004486702 216
54 3300005367 Ga0070667_100019093 Ga0070667_1000190936 216
55 3300005434 Ga0070709_10000274 Ga0070709_1000027415 216
56 3300005435 Ga0070714_100002601 Ga0070714_1000026016 216
57 3300005436 Ga0070713_100028315 Ga0070713_1000283152 216
58 3300005436 Ga0070713_100392948 Ga0070713_1003929482 216
59 3300005437 Ga0070710_10000279 Ga0070710_1000027911 216
60 3300005439 Ga0070711_100000568 Ga0070711_1000005684 216
61 3300005439 Ga0070711_100346237 Ga0070711_1003462372 216
62 3300005439 Ga0070711_100534765 Ga0070711_1005347652 216
63 3300005456 Ga0070678_100411614 Ga0070678_1004116141 216
64 3300005457 Ga0070662_100287863 Ga0070662_1002878632 216
65 3300005458 Ga0070681_10382837 Ga0070681_103828372 216
66 3300005459 Ga0068867_100161639 Ga0068867_1001616392 216
67 3300005530 Ga0070679_100083926 Ga0070679_1000839261 216
68 3300005530 Ga0070679_100142839 Ga0070679_1001428392 216
69 3300005530 Ga0070679_100317136 Ga0070679_1003171363 216
70 3300005535 Ga0070684_100001779 Ga0070684_1000017798 216
71 3300005539 Ga0068853_100003138 Ga0068853_1000031384 216
72 3300005539 Ga0068853_100053637 Ga0068853_1000536373 216
73 3300005543 Ga0070672_100009981 Ga0070672_1000099812 216
74 3300005548 Ga0070665_100082102 Ga0070665_1000821022 216
75 3300005549 Ga0070704_100129256 Ga0070704_1001292562 216
76 3300005563 Ga0068855_100024006 Ga0068855_1000240066 216
77 3300005577 Ga0068857_100005328 Ga0068857_1000053285 216
78 3300005577 Ga0068857_100462832 Ga0068857_1004628321 216
79 3300005578 Ga0068854_100381987 Ga0068854_1003819872 216
80 3300005616 Ga0068852_100026879 Ga0068852_1000268795 216
81 3300005616 Ga0068852_100263128 Ga0068852_1002631283 216
82 3300005617 Ga0068859_100340461 Ga0068859_1003404612 216
83 3300005618 Ga0068864_100045250 Ga0068864_1000452505 216
84 3300005718 Ga0068866_10148680 Ga0068866_101486802 216
85 3300005719 Ga0068861_100359270 Ga0068861_1003592702 216
86 3300005834 Ga0068851_10126421 Ga0068851_101264213 216
87 3300005841 Ga0068863_100458323 Ga0068863_1004583232 216
88 3300005937 Ga0081455_10019715 Ga0081455_100197154 216
89 3300005937 Ga0081455_10102326 Ga0081455_101023261 216
90 3300005937 Ga0081455_10326523 Ga0081455_103265232 216
91 3300005981 Ga0081538_10011226 Ga0081538_100112262 216
92 3300005983 Ga0081540_1019580 Ga0081540_10195803 216
93 3300005985 Ga0081539_10002071 Ga0081539_1000207126 216
94 3300006028 Ga0070717_10371165 Ga0070717_103711652 216
95 3300006038 Ga0075365_10013256 Ga0075365_100132566 216
96 3300006051 Ga0075364_10001860 Ga0075364_100018603 216
97 3300006173 Ga0070716_100010104 Ga0070716_1000101044 216
98 3300006173 Ga0070716_100092770 Ga0070716_1000927703 216
99 3300006175 Ga0070712_100683004 Ga0070712_1006830041 216
100 3300006358 Ga0068871_100029300 Ga0068871_1000293004 216
101 3300006844 Ga0075428_100034493 Ga0075428_1000344936 216
102 3300006846 Ga0075430_100008845 Ga0075430_1000088453 216
103 3300006846 Ga0075430_100039449 Ga0075430_1000394494 216
104 3300006847 Ga0075431_100006106 Ga0075431_10000610610 216
105 3300006847 Ga0075431_100044620 Ga0075431_1000446205 216
106 3300006871 Ga0075434_100013054 Ga0075434_1000130549 216
107 3300006871 Ga0075434_100021710 Ga0075434_1000217102 216
108 3300006931 Ga0097620_100340477 Ga0097620_1003404772 216
109 3300007076 Ga0075435_100331328 Ga0075435_1003313282 216
110 3300007265 Ga0099794_10008948 Ga0099794_100089485 216
111 3300007265 Ga0099794_10015741 Ga0099794_100157412 216
112 3300009093 Ga0105240_10003096 Ga0105240_1000309613 216
113 3300009094 Ga0111539_10031369 Ga0111539_100313697 216
114 3300009147 Ga0114129_10029858 Ga0114129_100298584 216
115 3300009147 Ga0114129_10675043 Ga0114129_106750432 216
116 3300009174 Ga0105241_10212156 Ga0105241_102121563 216
117 3300009177 Ga0105248_10001407 Ga0105248_1000140718 216
118 3300009177 Ga0105248_10007457 Ga0105248_100074577 216
119 3300009545 Ga0105237_10002350 Ga0105237_100023503 216
120 3300009551 Ga0105238_10000408 Ga0105238_1000040823 216
121 3300009551 Ga0105238_10065589 Ga0105238_100655892 216
122 3300009551 Ga0105238_10140071 Ga0105238_101400711 216
123 3300010375 Ga0105239_10026031 Ga0105239_100260316 216
124 3300013105 Ga0157369_10000685 Ga0157369_1000068542 216
125 3300013105 Ga0157369_10007214 Ga0157369_100072144 216
126 3300013105 Ga0157369_10477856 Ga0157369_104778562 216
127 3300013296 Ga0157374_10210294 Ga0157374_102102942 216
128 3300013297 Ga0157378_10170687 Ga0157378_101706872 216
129 3300013306 Ga0163162_10177126 Ga0163162_101771262 216
130 3300013306 Ga0163162_10363516 Ga0163162_103635162 216
131 3300013307 Ga0157372_10592821 Ga0157372_105928212 216
132 3300013308 Ga0157375_10977435 Ga0157375_109774352 216
133 3300014326 Ga0157380_11290582 Ga0157380_112905821 216
134 3300014968 Ga0157379_10150790 Ga0157379_101507902 216
135 3300014969 Ga0157376_10363676 Ga0157376_103636763 216
136 3300021361 Ga0213872_10111054 Ga0213872_101110542 216
137 3300021384 Ga0213876_10001337 Ga0213876_1000133712 216
138 3300025254 Ga0209148_1011935 Ga0209148_10119351 216
139 3300025321 Ga0207656_10005202 Ga0207656_100052025 216
140 3300025898 Ga0207692_10002196 Ga0207692_100021964 216
141 3300025898 Ga0207692_10297291 Ga0207692_102972912 216
142 3300025901 Ga0207688_10113238 Ga0207688_101132382 216
143 3300025903 Ga0207680_10038641 Ga0207680_100386413 216
144 3300025903 Ga0207680_10057097 Ga0207680_100570973 216
145 3300025904 Ga0207647_10070464 Ga0207647_100704643 216
146 3300025906 Ga0207699_10000285 Ga0207699_1000028512 216
147 3300025906 Ga0207699_10019565 Ga0207699_100195652 216
148 3300025906 Ga0207699_10069797 Ga0207699_100697972 216
149 3300025910 Ga0207684_10615131 Ga0207684_106151311 216
150 3300025911 Ga0207654_10220802 Ga0207654_102208021 216
151 3300025912 Ga0207707_10000126 Ga0207707_1000012637 216
152 3300025913 Ga0207695_10142482 Ga0207695_101424823 216
153 3300025914 Ga0207671_10119210 Ga0207671_101192102 216
154 3300025915 Ga0207693_10262211 Ga0207693_102622112 216
155 3300025915 Ga0207693_10291029 Ga0207693_102910292 216
156 3300025916 Ga0207663_10001369 Ga0207663_100013699 216
157 3300025916 Ga0207663_10372188 Ga0207663_103721882 216
158 3300025917 Ga0207660_10004286 Ga0207660_100042863 216
159 3300025917 Ga0207660_10247262 Ga0207660_102472622 216
160 3300025919 Ga0207657_10000261 Ga0207657_1000026128 216
161 3300025920 Ga0207649_10094368 Ga0207649_100943682 216
162 3300025921 Ga0207652_10000994 Ga0207652_1000099412 216
163 3300025921 Ga0207652_10106236 Ga0207652_101062364 216
164 3300025921 Ga0207652_10333949 Ga0207652_103339492 216
165 3300025924 Ga0207694_10060710 Ga0207694_100607104 216
166 3300025924 Ga0207694_10475570 Ga0207694_104755702 216
167 3300025927 Ga0207687_10821177 Ga0207687_108211771 216
168 3300025928 Ga0207700_10020158 Ga0207700_100201586 216
169 3300025928 Ga0207700_10342325 Ga0207700_103423252 216
170 3300025929 Ga0207664_10004606 Ga0207664_100046065 216
171 3300025929 Ga0207664_10013461 Ga0207664_100134615 216
172 3300025931 Ga0207644_10012262 Ga0207644_100122625 216
173 3300025931 Ga0207644_10046510 Ga0207644_100465102 216
174 3300025931 Ga0207644_10624219 Ga0207644_106242192 216
175 3300025933 Ga0207706_10040677 Ga0207706_100406775 216
176 3300025939 Ga0207665_10015276 Ga0207665_100152764 216
177 3300025941 Ga0207711_10008607 Ga0207711_100086073 216
178 3300025941 Ga0207711_10011986 Ga0207711_100119865 216
179 3300025944 Ga0207661_10002724 Ga0207661_100027246 216
180 3300025949 Ga0207667_10002572 Ga0207667_1000257222 216
181 3300025960 Ga0207651_10310342 Ga0207651_103103422 216
182 3300025981 Ga0207640_10855050 Ga0207640_108550502 216
183 3300025986 Ga0207658_10075415 Ga0207658_100754152 216
184 3300026041 Ga0207639_10085546 Ga0207639_100855462 216
185 3300026041 Ga0207639_10138275 Ga0207639_101382753 216
186 3300026095 Ga0207676_10036241 Ga0207676_100362413 216
187 3300026116 Ga0207674_10009856 Ga0207674_100098568 216
188 3300026116 Ga0207674_10565232 Ga0207674_105652321 216
189 3300026118 Ga0207675_100408878 Ga0207675_1004088782 216
190 3300026118 Ga0207675_101022564 Ga0207675_1010225642 216
191 3300027512 Ga0209179_1001307 Ga0209179_10013074 216
192 3300027665 Ga0209983_1035752 Ga0209983_10357522 216
193 3300027671 Ga0209588_1018639 Ga0209588_10186392 216
194 3300027907 Ga0207428_10002050 Ga0207428_100020503 216
195 3300032126 Ga0307415_100133291 Ga0307415_1001332913 216
196 3300035113 Ga0373936_0048521 Ga0373936_0048521_476_1126 216
197 3300035118 Ga0373954_0010774 Ga0373954_0010774_1257_1919 216
198 3300035119 Ga0373956_0008179 Ga0373956_0008179_1874_2536 216
199 3300035119 Ga0373956_0106107 Ga0373956_0106107_407_1057 216
200 3300035119 Ga0373956_0218643 Ga0373956_0218643_65_715 216
201 3300035170 Ga0373943_0048749 Ga0373943_0048749_392_1051 216
202 3300035171 Ga0373946_0015444 Ga0373946_0015444_337_987 216
203 3300035172 Ga0373955_0003182 Ga0373955_0003182_3324_3986 216
204 3300035172 Ga0373955_0152392 Ga0373955_0152392_55_705 216
205 3300035410 Ga0373924_0069309 Ga0373924_0069309_531_1181 216
206 3300035410 Ga0373924_0094051 Ga0373924_0094051_602_1264 216
207 3300035692 Ga0373935_0000186 Ga0373935_0000186_1017_1676 216
208 3300035692 Ga0373935_0007120 Ga0373935_0007120_1448_2098 216
209 3300035692 Ga0373935_0174993 Ga0373935_0174993_253_912 216
210 3300035695 Ga0373927_0001649 Ga0373927_0001649_6647_7306 216
211 3300035695 Ga0373927_0029011 Ga0373927_0029011_2314_2964 216
212 3300035695 Ga0373927_0226061 Ga0373927_0226061_218_877 216
213 3300035724 Ga0373933_0026643 Ga0373933_0026643_2057_2719 216
214 3300035724 Ga0373933_0446740 Ga0373933_0446740_16_675 216
215 3300035725 Ga0373947_0004236 Ga0373947_0004236_7727_8386 216
216 3300035725 Ga0373947_0009796 Ga0373947_0009796_3982_4632 216
217 3300035725 Ga0373947_0018853 Ga0373947_0018853_3094_3744 216
218 3300036401 Ga0373937_0005546 Ga0373937_0005546_2900_3562 216
219 3300036401 Ga0373937_0022692 Ga0373937_0022692_1129_1788 216
220 3300036401 Ga0373937_0076809 Ga0373937_0076809_936_1586 216
221 3300037068 Ga0373925_0001973 Ga0373925_0001973_11717_12376 216
222 3300037068 Ga0373925_0034111 Ga0373925_0034111_908_1558 216
223 3300037068 Ga0373925_0040570 Ga0373925_0040570_554_1213 216
224 3300037068 Ga0373925_0147200 Ga0373925_0147200_430_1080 216
225 3300037312 Ga0395899_0056548 Ga0395899_0056548_1580_2230 216
226 3300037418 Ga0395900_0002116 Ga0395900_0002116_15924_16574 216
227 3300037418 Ga0395900_0474017 Ga0395900_0474017_33_683 216
228 3300037466 Ga0395898_0004650 Ga0395898_0004650_11668_12318 216
229 3300038443 Ga0395901_0007798 Ga0395901_0007798_6538_7188 216
230 3300038443 Ga0395901_0137850 Ga0395901_0137850_903_1553 216
231 3300039437 Ga0436365_0248834 Ga0436365_0248834_229_879 216
232 3300039437 Ga0436365_1845823 Ga0436365_1845823_12432_13082 216
233 3300039447 Ga0436361_0434870 Ga0436361_0434870_577_1227 216
234 3300039450 Ga0436363_0490383 Ga0436363_0490383_213_863 216
235 3300039450 Ga0436363_1296724 Ga0436363_1296724_529_1179 216
236 3300041486 Ga0451807_2204629 Ga0451807_2204629_93_743 216
237 3300042461 Ga0439460_0001614 Ga0439460_0001614_2728_3381 216
238 3300042532 Ga0450893_0017772 Ga0450893_0017772_317_970 216
239 3300044684 Ga0466966_0224832 Ga0466966_0224832_381_1031 216
240 3300044706 Ga0466964_0149749 Ga0466964_0149749_38_736 216
241 3300044842 Ga0466957_0125173 Ga0466957_0125173_824_1474 216
242 3300045976 Ga0466967_0201057 Ga0466967_0201057_460_1110 216
243 3300045976 Ga0466967_0929108 Ga0466967_0929108_202_852 216
244 3300046454 Ga0495592_0036763 Ga0495592_0036763_1021_1671 216
245 3300046454 Ga0495592_0043076 Ga0495592_0043076_699_1358 216
246 3300046454 Ga0495592_0199798 Ga0495592_0199798_332_994 216
247 3300046455 Ga0495603_0001827 Ga0495603_0001827_10050_10709 216
248 3300046455 Ga0495603_0011786 Ga0495603_0011786_1514_2164 216
249 3300046459 Ga0495629_0001739 Ga0495629_0001739_6414_7073 216
250 3300046459 Ga0495629_0020241 Ga0495629_0020241_3403_4053 216
251 3300046461 Ga0495641_0005678 Ga0495641_0005678_849_1508 216
252 3300046461 Ga0495641_0013726 Ga0495641_0013726_2684_3334 216
253 3300046463 Ga0495653_0079941 Ga0495653_0079941_1198_1860 216
254 3300046472 Ga0495580_0008936 Ga0495580_0008936_1033_1692 216
255 3300046472 Ga0495580_0034016 Ga0495580_0034016_1411_2061 216
256 3300046473 Ga0495582_0000547 Ga0495582_0000547_5775_6434 216
257 3300046473 Ga0495582_0024905 Ga0495582_0024905_1034_1684 216
258 3300046475 Ga0495639_0000163 Ga0495639_0000163_10056_10715 216
259 3300046475 Ga0495639_0003605 Ga0495639_0003605_1299_1949 216
260 3300046476 Ga0495662_0000616 Ga0495662_0000616_8948_9607 216
261 3300046476 Ga0495662_0001699 Ga0495662_0001699_1925_2575 216
262 3300046477 Ga0495664_0002121 Ga0495664_0002121_7304_7963 216
263 3300046477 Ga0495664_0009904 Ga0495664_0009904_2535_3185 216
264 3300046477 Ga0495664_0024286 Ga0495664_0024286_174_824 216
265 3300046477 Ga0495664_0201956 Ga0495664_0201956_381_1040 216
266 3300046499 Ga0495594_0001043 Ga0495594_0001043_5084_5743 216
267 3300046499 Ga0495594_0062469 Ga0495594_0062469_1286_1936 216
268 3300046514 Ga0495618_0013385 Ga0495618_0013385_539_1198 216
269 3300046514 Ga0495618_0015615 Ga0495618_0015615_1475_2125 216
270 3300046514 Ga0495618_0032859 Ga0495618_0032859_1897_2556 216
271 3300046514 Ga0495618_0221256 Ga0495618_0221256_390_1040 216
272 3300046516 Ga0495628_0370616 Ga0495628_0370616_10_660 216
273 3300046517 Ga0495630_0011607 Ga0495630_0011607_5447_6106 216
274 3300046517 Ga0495630_0030941 Ga0495630_0030941_1892_2542 216
275 3300046517 Ga0495630_0249268 Ga0495630_0249268_426_1076 216
276 3300046529 Ga0495652_0065140 Ga0495652_0065140_1874_2536 216
277 3300046529 Ga0495652_0074664 Ga0495652_0074664_1880_2530 216
278 3300046529 Ga0495652_0559394 Ga0495652_0559394_66_725 216
279 3300046531 Ga0495665_0003016 Ga0495665_0003016_151_810 216
280 3300046531 Ga0495665_0038214 Ga0495665_0038214_466_1125 216
281 3300046531 Ga0495665_0051603 Ga0495665_0051603_781_1431 216
282 3300046531 Ga0495665_0054338 Ga0495665_0054338_585_1235 216
283 3300046531 Ga0495665_0078934 Ga0495665_0078934_654_1304 216
284 3300046533 Ga0495640_0008977 Ga0495640_0008977_2720_3370 216
285 3300046533 Ga0495640_0014030 Ga0495640_0014030_5381_6040 216
286 3300046533 Ga0495640_0014858 Ga0495640_0014858_1155_1814 216
287 3300046533 Ga0495640_0126597 Ga0495640_0126597_111_761 216
288 3300046535 Ga0495586_0172069 Ga0495586_0172069_334_984 216
289 3300046557 Ga0495622_0003321 Ga0495622_0003321_5761_6420 216
290 3300046557 Ga0495622_0191090 Ga0495622_0191090_84_734 216
291 3300046559 Ga0495667_0032545 Ga0495667_0032545_475_1125 216
292 3300046642 Ga0495634_0002719 Ga0495634_0002719_11204_11854 216
293 3300046642 Ga0495634_0004319 Ga0495634_0004319_5429_6088 216
294 3300046642 Ga0495634_0022303 Ga0495634_0022303_989_1648 216
295 3300046642 Ga0495634_0041258 Ga0495634_0041258_1484_2134 216
296 3300046642 Ga0495634_0047577 Ga0495634_0047577_1314_1973 216
297 3300046663 Ga0495635_0002402 Ga0495635_0002402_2027_2686 216
298 3300046663 Ga0495635_0009130 Ga0495635_0009130_2341_2991 216
299 3300046663 Ga0495635_0012006 Ga0495635_0012006_1141_1791 216
300 3300046663 Ga0495635_0079331 Ga0495635_0079331_65_727 216
301 3300046674 Ga0495588_0019172 Ga0495588_0019172_1636_2295 216
302 3300046675 Ga0495657_0037174 Ga0495657_0037174_377_1039 216
303 3300046678 Ga0495599_0039220 Ga0495599_0039220_1442_2092 216
304 3300046679 Ga0495623_0147425 Ga0495623_0147425_446_1108 216
305 3300046681 Ga0495647_0138754 Ga0495647_0138754_187_837 216
306 3300046683 Ga0495658_0004596 Ga0495658_0004596_5728_6387 216
307 3300046683 Ga0495658_0022835 Ga0495658_0022835_1433_2083 216
308 3300046683 Ga0495658_0047282 Ga0495658_0047282_868_1518 216
309 3300046683 Ga0495658_0048887 Ga0495658_0048887_342_992 216
310 3300046683 Ga0495658_0545302 Ga0495658_0545302_80_730 216
311 3300046689 Ga0495613_0004558 Ga0495613_0004558_965_1624 216
312 3300046689 Ga0495613_0028055 Ga0495613_0028055_715_1365 216
313 3300046690 Ga0495624_0003121 Ga0495624_0003121_9613_10272 216
314 3300046690 Ga0495624_0031698 Ga0495624_0031698_1805_2455 216
315 3300046809 Ga0495600_0078302 Ga0495600_0078302_263_925 216
316 3300047315 Ga0495581_0000979 Ga0495581_0000979_10077_10736 216
317 3300047315 Ga0495581_0003908 Ga0495581_0003908_5276_5926 216
318 3300047317 Ga0495604_0035530 Ga0495604_0035530_757_1419 216
319 3300047317 Ga0495604_0569592 Ga0495604_0569592_16_666 216
320 3300047319 Ga0495674_0001683 Ga0495674_0001683_9352_10002 216
321 3300047319 Ga0495674_0005950 Ga0495674_0005950_10063_10722 216
322 3300047319 Ga0495674_0025182 Ga0495674_0025182_1280_1939 216
323 3300047319 Ga0495674_0026239 Ga0495674_0026239_14_664 216
324 3300047321 Ga0495676_0045114 Ga0495676_0045114_1850_2509 216
325 3300047321 Ga0495676_0250853 Ga0495676_0250853_226_876 216
326 3300047322 Ga0495680_0106215 Ga0495680_0106215_509_1168 216
327 3300047444 Ga0495675_0189064 Ga0495675_0189064_305_964 216
328 3300047471 Ga0495684_0008291 Ga0495684_0008291_5253_5903 216
329 3300047471 Ga0495684_0206923 Ga0495684_0206923_437_1096 216
330 3300047472 Ga0495686_0042656 Ga0495686_0042656_470_1120 216
331 3300047673 Ga0495593_0005448 Ga0495593_0005448_4200_4850 216
332 3300047673 Ga0495593_0006169 Ga0495593_0006169_5181_5840 216
333 3300048088 Ga0495602_0162886 Ga0495602_0162886_311_973 216
334 3300048088 Ga0495602_0174763 Ga0495602_0174763_389_1048 216
335 3300048904 Ga0496101_0086025 Ga0496101_0086025_934_1584 216
336 3300048904 Ga0496101_0162434 Ga0496101_0162434_576_1226 216
337 3300048905 Ga0496102_0067263 Ga0496102_0067263_1178_1828 216
338 3300048905 Ga0496102_0585634 Ga0496102_0585634_207_857 216
339 3300048909 Ga0496106_0010197 Ga0496106_0010197_6048_6698 216
340 3300048909 Ga0496106_0303746 Ga0496106_0303746_35_685 216
341 3300048911 Ga0496108_0538357 Ga0496108_0538357_216_866 216
342 3300048912 Ga0496109_0441065 Ga0496109_0441065_47_697 216
343 3300048913 Ga0496110_0075067 Ga0496110_0075067_2068_2718 216
344 3300048913 Ga0496110_0481841 Ga0496110_0481841_372_1022 216
345 3300048914 Ga0496111_0501608 Ga0496111_0501608_190_840 216
346 3300048918 Ga0496115_0466797 Ga0496115_0466797_309_959 216
347 3300048924 Ga0496121_0122919 Ga0496121_0122919_989_1639 216
348 3300048928 Ga0496125_0048238 Ga0496125_0048238_2641_3291 216
349 3300048929 Ga0496126_0017173 Ga0496126_0017173_1909_2559 216
350 3300048929 Ga0496126_0030150 Ga0496126_0030150_4467_5129 216
351 3300049572 Ga0501036_0519324 Ga0501036_0519324_299_949 216
352 3300049574 Ga0501038_0196655 Ga0501038_0196655_933_1583 216
353 3300049576 Ga0501040_0035858 Ga0501040_0035858_918_1571 216
354 3300049576 Ga0501040_0207915 Ga0501040_0207915_431_1081 216
355 3300049578 Ga0501042_0422089 Ga0501042_0422089_56_715 216
356 3300049579 Ga0501043_0177384 Ga0501043_0177384_655_1314 216
357 3300049582 Ga0501048_0187824 Ga0501048_0187824_726_1385 216
358 3300049587 Ga0501071_0019978 Ga0501071_0019978_3547_4197 216
359 3300049588 Ga0501072_0043830 Ga0501072_0043830_2171_2821 216
360 3300049588 Ga0501072_0051791 Ga0501072_0051791_2489_3148 216
361 3300049589 Ga0501073_0183413 Ga0501073_0183413_622_1272 216
362 3300049591 Ga0501075_0010572 Ga0501075_0010572_4679_5338 216
363 3300049591 Ga0501075_0346414 Ga0501075_0346414_162_815 216
364 3300049592 Ga0501076_0020310 Ga0501076_0020310_2614_3267 216
365 3300049741 Ga0501079_0040966 Ga0501079_0040966_788_1438 216
366 3300049742 Ga0501080_0707418 Ga0501080_0707418_92_745 216
367 3300049743 Ga0501081_0026219 Ga0501081_0026219_3016_3675 216
368 3300049743 Ga0501081_0039813 Ga0501081_0039813_1406_2056 216
369 3300049824 Ga0501045_0061879 Ga0501045_0061879_153_803 216
370 3300050489 nmdc:mga03683_13187_c1 nmdc:mga03683_13187_c1_966_1616 216
371 3300050491 nmdc:mga00v17_3487_c1 nmdc:mga00v17_3487_c1_1094_1744 216
372 3300050492 nmdc:mga0yw44_252086_c1 nmdc:mga0yw44_252086_c1_495_1145 216
373 3300050507 nmdc:mga05p37_265752_c1 nmdc:mga05p37_265752_c1_858_1508 216
374 3300050507 nmdc:mga05p37_462853_c1 nmdc:mga05p37_462853_c1_672_1322 216
375 3300050508 nmdc:mga09592_24299_c1 nmdc:mga09592_24299_c1_577_1227 216
376 3300050508 nmdc:mga09592_331658_c1 nmdc:mga09592_331658_c1_233_883 216
377 3300050509 nmdc:mga0qj67_190726_c1 nmdc:mga0qj67_190726_c1_726_1376 216
378 3300050509 nmdc:mga0qj67_6595_c1 nmdc:mga0qj67_6595_c1_6474_7124 216
379 3300050510 nmdc:mga06r32_8490_c1 nmdc:mga06r32_8490_c1_7195_7845 216
380 3300050510 nmdc:mga06r32_98429_c1 nmdc:mga06r32_98429_c1_569_1219 216
381 3300050511 nmdc:mga08y16_23485_c1 nmdc:mga08y16_23485_c1_5094_5744 216
382 3300050512 nmdc:mga0n895_122768_c1 nmdc:mga0n895_122768_c1_206_871 216
383 3300050512 nmdc:mga0n895_133683_c1 nmdc:mga0n895_133683_c1_1023_1673 216
384 3300050512 nmdc:mga0n895_3895_c1 nmdc:mga0n895_3895_c1_10495_11145 216
385 3300050512 nmdc:mga0n895_5274_c1 nmdc:mga0n895_5274_c1_76_735 216
386 3300050513 nmdc:mga0rr50_219848_c1 nmdc:mga0rr50_219848_c1_478_1128 216
387 3300050513 nmdc:mga0rr50_248880_c1 nmdc:mga0rr50_248880_c1_344_994 216
388 3300050513 nmdc:mga0rr50_46967_c1 nmdc:mga0rr50_46967_c1_1457_2107 216
389 3300050513 nmdc:mga0rr50_517575_c1 nmdc:mga0rr50_517575_c1_223_873 216
390 3300050513 nmdc:mga0rr50_887532_c1 nmdc:mga0rr50_887532_c1_10_660 216
391 3300050513 nmdc:mga0rr50_995041_c1 nmdc:mga0rr50_995041_c1_22_672 216
392 3300050515 nmdc:mga0a205_41154_c1 nmdc:mga0a205_41154_c1_1433_2083 216
393 3300050515 nmdc:mga0a205_662837_c1 nmdc:mga0a205_662837_c1_118_768 216
394 3300053077 Ga0495601_0010230 Ga0495601_0010230_2710_3372 216
395 3300053077 Ga0495601_0018364 Ga0495601_0018364_1330_1980 216
396 3300053077 Ga0495601_0021359 Ga0495601_0021359_2025_2684 216
397 3300053077 Ga0495601_0120168 Ga0495601_0120168_766_1416 216
398 3300053078 Ga0495612_0008816 Ga0495612_0008816_1972_2622 216
399 3300053078 Ga0495612_0030130 Ga0495612_0030130_1180_1830 216
400 3300053084 Ga0495595_0000325 Ga0495595_0000325_14146_14808 216
401 3300053085 Ga0495619_0023453 Ga0495619_0023453_2291_2941 216
402 3300053085 Ga0495619_0030068 Ga0495619_0030068_286_948 216
403 3300053085 Ga0495619_0156736 Ga0495619_0156736_770_1429 216
404 3300060353 Ga0501082_0063082 Ga0501082_0063082_270_929 216
405 3300060353 Ga0501082_0199079 Ga0501082_0199079_650_1300 216
406 3300060353 Ga0501082_0795027 Ga0501082_0795027_10_660 216
407 3300061734 Ga0530510_0007515 Ga0530510_0007515_2739_3398 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

5

200

0.95

PF13336

AcetylCoA_hyd_C

Acetyl-CoA hydrolase/transferase C-terminal domain

83

187

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dbn-assembly1.cif.gz_D crystal structure of atoda complex 0.8506 2 211
4kgb-assembly1.cif.gz_B structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster 0.8437 4 215
6lp1-assembly1.cif.gz_B crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. 0.8382 2 216
6lp1-assembly1.cif.gz_A crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. 0.838 4 216
3cdk-assembly1.cif.gz_B crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis 0.8372 3 211
ID Description Score Start End Superfamily
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8506 2 211 3.40.1080.10
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8318 2 211 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8263 3 211 3.40.1080.10
af_P32144_74_134_3.30.750.70 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;4-hydroxybutyrate coenzyme 0.8184 4 45 3.30.750.70
af_P52043_334_473_3.40.1080.20 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Acetyl-CoA hydrolase/transferase C-terminal domain 0.7787 85 180 3.40.1080.20
ID Description Score Start End GO Terms
AF-A0A4Q9VLF0-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9815 138 216 GO:0008410
AF-A0A1H6P3V1-F1-model_v4 deleted 0.9686 87 216
AF-A0A660QKH2-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9597 91 216 GO:0008410
AF-A0A1G8KE35-F1-model_v4 3-oxoacid CoA-transferase, B subunit 0.9578 126 216 GO:0008410
AF-A0A4Q9VLF0-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9576 138 216 GO:0008410

Feature Viewer

pLDDT pTM Quality
82.98 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map