F436516

General Info

Members Datasets Scaffolds Average Seq Length
407 209 814 248

Family's Representative Sequence

Representative Sequence 3300042133|Ga0450896_000516|Ga0450896_000516_2486_3349
Length 287
Sequence VGIPSFHWWRTVFFLIPAIGVYTAVLGTLSLGSSLFDRRGHFAHACARLWSWLILATTGVSADVRGLDRLRPGTTYIFVSNHQSIYDIPVVFASLPYQLRIIAKESLGTFPFLGWHLRRTGHLLVDRKNPDRAGILRRWKALVEQGLSLIIFPEGTRSETGRVGIFKAGSFLLAIEAGLPIVPLSVDGTRHVMRKGQLTTRPGHATLVVHAPIETASLTVSDARSLAQRVREVVSSGLAEQPWMSHERKSAPCETGSCVRGSPTIARRGSAPAPRSAGVWWRRANQR

Samples

Sample ID Description Type Environment
1 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
143 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
144 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
145 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
146 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.44
Nodule 0
Rhizoplane 8.11
Rhizosphere 88.45
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450896_000516 3300042133 Bacteria 4056
2 Ga0065712_10006688 3300005290 Bacteria 2830
3 Ga0065712_10075884 3300005290 Bacteria 3770
4 Ga0065712_10127213 3300005290 Bacteria 1593
5 Ga0065712_10163203 3300005290 Unclassified 1288
6 Ga0065715_10033263 3300005293 Bacteria 1516
7 Ga0065715_10110685 3300005293 Bacteria 2608
8 Ga0065715_10124120 3300005293 Unclassified 2162
9 Ga0065707_10095611 3300005295 Bacteria 3359
10 Ga0070683_100000094 3300005329 Bacteria 58242
11 Ga0070683_100026068 3300005329 Bacteria 5258
12 Ga0070683_100030821 3300005329 Bacteria 4873
13 Ga0070683_100122233 3300005329 Bacteria 2460
14 Ga0070683_100243962 3300005329 Bacteria 1709
15 Ga0070670_100013591 3300005331 Bacteria 6978
16 Ga0070670_100018452 3300005331 Bacteria 5986
17 Ga0070670_100050681 3300005331 Bacteria 3566
18 Ga0070670_100093307 3300005331 Bacteria 2589
19 Ga0070680_100058764 3300005336 Bacteria 3145
20 Ga0070680_100119153 3300005336 Bacteria 2202
21 Ga0070682_100282322 3300005337 Bacteria 1211
22 Ga0070682_100392696 3300005337 Bacteria 1047
23 Ga0068868_100096253 3300005338 Bacteria 2391
24 Ga0068868_100489986 3300005338 Unclassified 1075
25 Ga0070660_100012406 3300005339 Bacteria 6084
26 Ga0070687_100251255 3300005343 Bacteria 1099
27 Ga0070661_100022927 3300005344 Bacteria 4472
28 Ga0070661_100338143 3300005344 Bacteria 1179
29 Ga0070668_100054313 3300005347 Bacteria 3090
30 Ga0070669_100001822 3300005353 Bacteria 15344
31 Ga0070669_100304522 3300005353 Bacteria 1283
32 Ga0070675_100061137 3300005354 Bacteria 3110
33 Ga0070675_100305837 3300005354 Bacteria 1402
34 Ga0070675_100311877 3300005354 Bacteria 1388
35 Ga0070671_100039024 3300005355 Bacteria 3942
36 Ga0070674_100009322 3300005356 Bacteria 5877
37 Ga0070674_100013217 3300005356 Bacteria 5096
38 Ga0070673_100268094 3300005364 Bacteria 1493
39 Ga0070673_100282117 3300005364 Bacteria 1457
40 Ga0070688_100093114 3300005365 Bacteria 1973
41 Ga0070688_100450305 3300005365 Archaea 962
42 Ga0070659_100263676 3300005366 Bacteria 1430
43 Ga0070659_100317022 3300005366 Bacteria 1303
44 Ga0070711_100195847 3300005439 Bacteria 1556
45 Ga0070700_100251105 3300005441 Bacteria 1269
46 Ga0070663_100008778 3300005455 Bacteria 6234
47 Ga0070663_100259082 3300005455 Bacteria 1379
48 Ga0070678_100065204 3300005456 Bacteria 2703
49 Ga0070662_100102749 3300005457 Unclassified 2166
50 Ga0070662_100201633 3300005457 Bacteria 1579
51 Ga0070681_10052652 3300005458 Bacteria 4060
52 Ga0070681_10515467 3300005458 Bacteria 1109
53 Ga0068867_100116831 3300005459 Bacteria 2056
54 Ga0070685_10127098 3300005466 Bacteria 1589
55 Ga0070698_100762686 3300005471 Bacteria 911
56 Ga0070684_100006365 3300005535 Bacteria 9130
57 Ga0070684_100968984 3300005535 Unclassified 798
58 Ga0070672_100036831 3300005543 Bacteria 3730
59 Ga0070672_100063073 3300005543 Bacteria 2926
60 Ga0070672_100093838 3300005543 Bacteria 2425
61 Ga0070686_100118004 3300005544 Bacteria 1818
62 Ga0070696_100093154 3300005546 Bacteria 2148
63 Ga0070693_100044764 3300005547 Bacteria 2505
64 Ga0070665_100044418 3300005548 Bacteria 4462
65 Ga0070665_100096291 3300005548 Bacteria 2965
66 Ga0068855_100030065 3300005563 Bacteria 6496
67 Ga0068855_100442819 3300005563 Bacteria 1419
68 Ga0070664_100000479 3300005564 Bacteria 30222
69 Ga0070664_100027169 3300005564 Bacteria 4754
70 Ga0070664_100048136 3300005564 Bacteria 3603
71 Ga0070664_100422678 3300005564 Bacteria 1221
72 Ga0068857_100048900 3300005577 Bacteria 3752
73 Ga0068857_100258244 3300005577 Bacteria 1599
74 Ga0068854_100595401 3300005578 Unclassified 943
75 Ga0068859_100177383 3300005617 Bacteria 2213
76 Ga0068859_100863290 3300005617 Bacteria 991
77 Ga0068864_100007603 3300005618 Bacteria 8926
78 Ga0068864_100033968 3300005618 Bacteria 4337
79 Ga0068864_100374955 3300005618 Unclassified 1347
80 Ga0068851_10058320 3300005834 Bacteria 1973
81 Ga0068863_100437192 3300005841 Bacteria 1283
82 Ga0068862_100003872 3300005844 Bacteria 12736
83 Ga0068862_100279491 3300005844 Bacteria 1530
84 Ga0075365_10069948 3300006038 Bacteria 2360
85 Ga0075368_10007369 3300006042 Bacteria 3879
86 Ga0075368_10022935 3300006042 Bacteria 2380
87 Ga0075364_10008627 3300006051 Bacteria 6097
88 Ga0075367_10036020 3300006178 Bacteria 2867
89 Ga0075367_10086370 3300006178 Bacteria 1904
90 Ga0075366_10016608 3300006195 Bacteria 4232
91 Ga0097621_100107960 3300006237 Bacteria 2349
92 Ga0097621_100221652 3300006237 Bacteria 1648
93 Ga0097621_100609277 3300006237 Bacteria 999
94 Ga0068871_100067423 3300006358 Bacteria 2935
95 Ga0068871_100098167 3300006358 Bacteria 2450
96 Ga0068871_100119161 3300006358 Bacteria 2228
97 Ga0075428_100003278 3300006844 Bacteria 17699
98 Ga0075428_100005429 3300006844 Bacteria 14163
99 Ga0075428_100008684 3300006844 Bacteria 11272
100 Ga0075428_100466415 3300006844 Bacteria 1352
101 Ga0075430_100006929 3300006846 Bacteria 9552
102 Ga0075430_100028604 3300006846 Bacteria 4734
103 Ga0075430_100030132 3300006846 Bacteria 4607
104 Ga0075430_100307346 3300006846 Bacteria 1311
105 Ga0075431_100010222 3300006847 Bacteria 9436
106 Ga0075431_100023957 3300006847 Bacteria 6249
107 Ga0075431_100030556 3300006847 Bacteria 5550
108 Ga0075431_100122920 3300006847 Bacteria 2678
109 Ga0075433_10169324 3300006852 Bacteria 1944
110 Ga0075433_10227885 3300006852 Unclassified 1655
111 Ga0075434_100084460 3300006871 Bacteria 3174
112 Ga0075434_100133719 3300006871 Bacteria 2500
113 Ga0075434_100683449 3300006871 Bacteria 1044
114 Ga0075429_100004608 3300006880 Bacteria 11857
115 Ga0075429_100066780 3300006880 Bacteria 3131
116 Ga0068865_100103324 3300006881 Bacteria 2090
117 Ga0068865_100177075 3300006881 Bacteria 1640
118 Ga0097620_100177391 3300006931 Bacteria 2213
119 Ga0097620_100863201 3300006931 Bacteria 991
120 Ga0105240_10987179 3300009093 Unclassified 901
121 Ga0111539_10007496 3300009094 Bacteria 13967
122 Ga0111539_10017454 3300009094 Bacteria 8885
123 Ga0111539_10065109 3300009094 Bacteria 4309
124 Ga0111539_10085138 3300009094 Bacteria 3716
125 Ga0111539_10177017 3300009094 Bacteria 2492
126 Ga0111539_10340152 3300009094 Bacteria 1747
127 Ga0111539_10399317 3300009094 Bacteria 1601
128 Ga0105245_10062855 3300009098 Bacteria 3351
129 Ga0105245_10237268 3300009098 Bacteria 1766
130 Ga0105245_10745387 3300009098 Unclassified 1015
131 Ga0114129_10001667 3300009147 Bacteria 30241
132 Ga0114129_10014680 3300009147 Bacteria 11160
133 Ga0114129_10049178 3300009147 Bacteria 5926
134 Ga0114129_10109342 3300009147 Bacteria 3816
135 Ga0114129_10377029 3300009147 Bacteria 1874
136 Ga0105243_10438996 3300009148 Bacteria 1222
137 Ga0105243_10966513 3300009148 Bacteria 852
138 Ga0105242_10102859 3300009176 Bacteria 2423
139 Ga0105248_10025354 3300009177 Bacteria 6592
140 Ga0105248_10045913 3300009177 Bacteria 4898
141 Ga0105248_10076960 3300009177 Bacteria 3750
142 Ga0105248_10711647 3300009177 Bacteria 1133
143 Ga0105238_10717049 3300009551 Unclassified 1013
144 Ga0105249_10005969 3300009553 Bacteria 10554
145 Ga0105249_10059481 3300009553 Bacteria 3504
146 Ga0105249_10568647 3300009553 Bacteria 1186
147 Ga0105239_11012291 3300010375 Unclassified 955
148 Ga0105246_10303257 3300011119 Unclassified 1291
149 Ga0157374_10054541 3300013296 Bacteria 3729
150 Ga0157374_10173956 3300013296 Bacteria 2101
151 Ga0157378_10248106 3300013297 Bacteria 1703
152 Ga0157378_10481408 3300013297 Bacteria 1237
153 Ga0157378_10856075 3300013297 Bacteria 938
154 Ga0163162_10097740 3300013306 Bacteria 3024
155 Ga0157375_10141075 3300013308 Bacteria 2537
156 Ga0157375_10210597 3300013308 Bacteria 2101
157 Ga0157375_10248735 3300013308 Bacteria 1938
158 Ga0163163_10022775 3300014325 Bacteria 5937
159 Ga0163163_10025272 3300014325 Bacteria 5663
160 Ga0163163_10056111 3300014325 Bacteria 3893
161 Ga0163163_10184743 3300014325 Unclassified 2132
162 Ga0163163_10188640 3300014325 Bacteria 2110
163 Ga0163163_10524259 3300014325 Bacteria 1247
164 Ga0157380_10551144 3300014326 Bacteria 1131
165 Ga0157380_10606577 3300014326 Bacteria 1084
166 Ga0157377_10041454 3300014745 Bacteria 2554
167 Ga0157379_10014894 3300014968 Bacteria 6821
168 Ga0157379_10339033 3300014968 Bacteria 1375
169 Ga0157379_10618100 3300014968 Bacteria 1012
170 Ga0163161_10057159 3300017792 Bacteria 2834
171 Ga0207697_10004966 3300025315 Bacteria 6271
172 Ga0207688_10144757 3300025901 Bacteria 1400
173 Ga0207647_10184949 3300025904 Bacteria 1209
174 Ga0207645_10176507 3300025907 Bacteria 1401
175 Ga0207643_10127873 3300025908 Bacteria 1509
176 Ga0207707_10304692 3300025912 Bacteria 1377
177 Ga0207707_10309213 3300025912 Bacteria 1366
178 Ga0207695_10673453 3300025913 Unclassified 915
179 Ga0207660_10030822 3300025917 Bacteria 3688
180 Ga0207660_10083028 3300025917 Bacteria 2358
181 Ga0207662_10131443 3300025918 Bacteria 1579
182 Ga0207662_10181655 3300025918 Bacteria 1354
183 Ga0207657_10005005 3300025919 Bacteria 13923
184 Ga0207649_10027313 3300025920 Bacteria 3348
185 Ga0207652_10046556 3300025921 Bacteria 3701
186 Ga0207681_10021017 3300025923 Bacteria 4143
187 Ga0207681_10073864 3300025923 Bacteria 2387
188 Ga0207681_10253570 3300025923 Bacteria 1375
189 Ga0207694_10132206 3300025924 Bacteria 2001
190 Ga0207650_10011879 3300025925 Bacteria 6000
191 Ga0207650_10135508 3300025925 Bacteria 1931
192 Ga0207659_10203150 3300025926 Bacteria 1584
193 Ga0207659_10211574 3300025926 Bacteria 1554
194 Ga0207687_10173148 3300025927 Bacteria 1666
195 Ga0207644_10077224 3300025931 Bacteria 2452
196 Ga0207644_10115360 3300025931 Bacteria 2037
197 Ga0207690_10108469 3300025932 Bacteria 1995
198 Ga0207706_10040943 3300025933 Bacteria 4107
199 Ga0207706_10047583 3300025933 Bacteria 3794
200 Ga0207709_10151864 3300025935 Bacteria 1605
201 Ga0207670_10086585 3300025936 Bacteria 2205
202 Ga0207669_10004496 3300025937 Bacteria 6149
203 Ga0207669_10074494 3300025937 Bacteria 2147
204 Ga0207704_10166988 3300025938 Bacteria 1573
205 Ga0207704_10183313 3300025938 Bacteria 1515
206 Ga0207691_10020687 3300025940 Bacteria 6222
207 Ga0207689_10141567 3300025942 Bacteria 1981
208 Ga0207661_10004428 3300025944 Bacteria 9857
209 Ga0207661_10023395 3300025944 Bacteria 4667
210 Ga0207661_10254867 3300025944 Bacteria 1561
211 Ga0207679_10188201 3300025945 Bacteria 1714
212 Ga0207679_10262047 3300025945 Bacteria 1475
213 Ga0207679_10409826 3300025945 Bacteria 1194
214 Ga0207667_10324744 3300025949 Bacteria 1571
215 Ga0207667_10629432 3300025949 Bacteria 1080
216 Ga0207651_10192649 3300025960 Bacteria 1627
217 Ga0207712_10006542 3300025961 Bacteria 7352
218 Ga0207668_10140905 3300025972 Bacteria 1854
219 Ga0207668_10342912 3300025972 Bacteria 1247
220 Ga0207640_10522997 3300025981 Unclassified 992
221 Ga0207677_10109217 3300026023 Bacteria 2056
222 Ga0207703_10132701 3300026035 Unclassified 2153
223 Ga0207678_10049992 3300026067 Bacteria 3612
224 Ga0207678_10290793 3300026067 Bacteria 1403
225 Ga0207708_10046534 3300026075 Bacteria 3304
226 Ga0207641_10029652 3300026088 Bacteria 4526
227 Ga0207641_10249876 3300026088 Bacteria 1656
228 Ga0207641_10533328 3300026088 Bacteria 1143
229 Ga0207648_10079971 3300026089 Bacteria 2851
230 Ga0207648_10784783 3300026089 Unclassified 886
231 Ga0207676_10007127 3300026095 Bacteria 7919
232 Ga0207676_10041996 3300026095 Bacteria 3515
233 Ga0207676_10076637 3300026095 Bacteria 2702
234 Ga0207676_10326196 3300026095 Bacteria 1411
235 Ga0207674_10063745 3300026116 Bacteria 3719
236 Ga0207674_10186236 3300026116 Bacteria 2026
237 Ga0207675_100061817 3300026118 Bacteria 3497
238 Ga0207683_10024456 3300026121 Bacteria 5203
239 Ga0207683_10315768 3300026121 Bacteria 1431
240 Ga0207698_10081919 3300026142 Bacteria 2607
241 Ga0209998_10027730 3300027717 Bacteria 1243
242 Ga0209813_10008785 3300027866 Bacteria 2562
243 Ga0207428_10004630 3300027907 Bacteria 13038
244 Ga0207428_10067222 3300027907 Bacteria 2822
245 Ga0268266_10029727 3300028379 Bacteria 4643
246 Ga0268266_10142415 3300028379 Bacteria 2152
247 Ga0268265_10005894 3300028380 Bacteria 8350
248 Ga0268265_10247394 3300028380 Bacteria 1577
249 Ga0268264_10576097 3300028381 Bacteria 1107
250 Ga0307408_100010625 3300031548 Bacteria 6073
251 Ga0307405_10101472 3300031731 Bacteria 1931
252 Ga0307413_10129244 3300031824 Bacteria 1726
253 Ga0307413_10307520 3300031824 Bacteria 1205
254 Ga0307407_10011426 3300031903 Bacteria 4226
255 Ga0307409_100068710 3300031995 Bacteria 2803
256 Ga0307416_100009990 3300032002 Bacteria 6246
257 Ga0307416_100010997 3300032002 Bacteria 6009
258 Ga0307416_100032051 3300032002 Bacteria 3966
259 Ga0307414_10008224 3300032004 Bacteria 5902
260 Ga0307411_10035070 3300032005 Bacteria 3128
261 Ga0307411_10449848 3300032005 Unclassified 1077
262 Ga0307415_100127545 3300032126 Bacteria 1920
263 Ga0373943_0174831 3300035170 Unclassified 1177
264 Ga0373955_0212274 3300035172 Bacteria 1154
265 Ga0373925_0352637 3300037068 Unclassified 1195
266 Ga0439445_0010116 3300042004 Bacteria 2228
267 Ga0439462_0003698 3300042015 Bacteria 3689
268 Ga0450923_021498 3300042125 Bacteria 1258
269 Ga0450894_002038 3300042131 Bacteria 2784
270 Ga0450896_004169 3300042133 Bacteria 1952
271 Ga0450906_027729 3300042145 Bacteria 1004
272 Ga0439434_0010045 3300042435 Bacteria 2787
273 Ga0451577_0219179 3300042876 Bacteria 1720
274 Ga0466963_0039263 3300044694 Unclassified 3100
275 Ga0495651_0223321 3300046462 Bacteria 1302
276 Ga0495653_0119379 3300046463 Bacteria 1882
277 Ga0495635_0262357 3300046663 Bacteria 1163
278 Ga0495647_0013278 3300046681 Bacteria 2851
279 Ga0495647_0269447 3300046681 Unclassified 762
280 Ga0495600_0187596 3300046809 Bacteria 1331
281 Ga0495672_0233840 3300047320 Bacteria 901
282 Ga0495676_0288535 3300047321 Bacteria 1109
283 Ga0496101_0055117 3300048904 Bacteria 2871
284 Ga0496101_0082923 3300048904 Bacteria 2373
285 Ga0496101_0153925 3300048904 Bacteria 1760
286 Ga0496102_0275180 3300048905 Bacteria 1587
287 Ga0496104_0003182 3300048907 Bacteria 14111
288 Ga0496104_0021855 3300048907 Bacteria 5877
289 Ga0496104_0042685 3300048907 Bacteria 4257
290 Ga0496104_0102720 3300048907 Bacteria 2738
291 Ga0496105_0018660 3300048908 Bacteria 5584
292 Ga0496106_0045097 3300048909 Bacteria 3311
293 Ga0496106_0049794 3300048909 Bacteria 3157
294 Ga0496106_0373599 3300048909 Bacteria 1146
295 Ga0496107_0156549 3300048910 Bacteria 1687
296 Ga0496108_0026415 3300048911 Bacteria 4788
297 Ga0496108_0030581 3300048911 Bacteria 4463
298 Ga0496108_0232549 3300048911 Bacteria 1603
299 Ga0496108_0453213 3300048911 Bacteria 1121
300 Ga0496109_0000869 3300048912 Bacteria 25170
301 Ga0496109_0117771 3300048912 Bacteria 2473
302 Ga0496109_0733281 3300048912 Bacteria 926
303 Ga0496110_0009331 3300048913 Bacteria 7939
304 Ga0496110_0018833 3300048913 Bacteria 5799
305 Ga0496110_0128963 3300048913 Bacteria 2283
306 Ga0496111_0003983 3300048914 Bacteria 9274
307 Ga0496111_0238161 3300048914 Bacteria 1352
308 Ga0496112_0015012 3300048915 Bacteria 7211
309 Ga0496112_0017967 3300048915 Bacteria 6654
310 Ga0496112_0081151 3300048915 Bacteria 3207
311 Ga0496112_0153463 3300048915 Bacteria 2270
312 Ga0496113_0034713 3300048916 Bacteria 3682
313 Ga0496114_0434774 3300048917 Bacteria 1162
314 Ga0496114_0456423 3300048917 Bacteria 1131
315 Ga0496115_0464159 3300048918 Bacteria 1021
316 Ga0501034_0008933 3300049571 Bacteria 10534
317 Ga0501036_0070194 3300049572 Bacteria 2962
318 Ga0501036_0158883 3300049572 Bacteria 1906
319 Ga0501036_0286845 3300049572 Bacteria 1377
320 Ga0501038_0054602 3300049574 Bacteria 3436
321 Ga0501039_0040885 3300049575 Bacteria 3579
322 Ga0501040_0021505 3300049576 Bacteria 4309
323 Ga0501040_0488121 3300049576 Bacteria 888
324 Ga0501041_0066064 3300049577 Bacteria 2216
325 Ga0501041_0136912 3300049577 Bacteria 1526
326 Ga0501042_0018015 3300049578 Bacteria 4886
327 Ga0501042_0091145 3300049578 Bacteria 2188
328 Ga0501042_0448735 3300049578 Bacteria 935
329 Ga0501046_0049762 3300049580 Bacteria 3314
330 Ga0501046_0132482 3300049580 Unclassified 1890
331 Ga0501048_0507089 3300049582 Bacteria 865
332 Ga0501071_0017167 3300049587 Bacteria 4988
333 Ga0501071_0022688 3300049587 Bacteria 4378
334 Ga0501071_0040592 3300049587 Bacteria 3330
335 Ga0501071_0091292 3300049587 Bacteria 2237
336 Ga0501072_0044194 3300049588 Bacteria 3503
337 Ga0501072_0076753 3300049588 Bacteria 2644
338 Ga0501072_0160855 3300049588 Bacteria 1791
339 Ga0501072_0203935 3300049588 Bacteria 1577
340 Ga0501072_0346681 3300049588 Unclassified 1179
341 Ga0501074_0042870 3300049590 Bacteria 3274
342 Ga0501075_0007335 3300049591 Bacteria 7647
343 Ga0501075_0018277 3300049591 Bacteria 5072
344 Ga0501075_0031044 3300049591 Bacteria 3963
345 Ga0501075_0033988 3300049591 Bacteria 3795
346 Ga0501075_0134838 3300049591 Bacteria 1881
347 Ga0501076_0005066 3300049592 Bacteria 9434
348 Ga0501076_0011647 3300049592 Bacteria 6562
349 Ga0501076_0017162 3300049592 Bacteria 5499
350 Ga0501076_0350975 3300049592 Bacteria 1211
351 Ga0501076_0355163 3300049592 Bacteria 1204
352 Ga0501076_0417421 3300049592 Bacteria 1104
353 Ga0501076_0448972 3300049592 Bacteria 1061
354 Ga0501077_0159674 3300049593 Bacteria 1431
355 Ga0501077_0369110 3300049593 Bacteria 916
356 Ga0501079_0197426 3300049741 Bacteria 1571
357 Ga0501079_0214284 3300049741 Bacteria 1504
358 Ga0501079_0601268 3300049741 Bacteria 866
359 Ga0501083_0187573 3300049744 Bacteria 1350
360 Ga0501045_0011397 3300049824 Bacteria 6243
361 Ga0501045_0196494 3300049824 Bacteria 1503
362 nmdc:mga00v17_345994_c1 3300050491 Bacteria 967
363 nmdc:mga0yw44_159270_c1 3300050492 Bacteria 1477
364 nmdc:mga0k408_22772_c1 3300050493 Bacteria 3530
365 nmdc:mga04h51_25597_c1 3300050495 Bacteria 1818
366 nmdc:mga07m45_26765_c1 3300050496 Bacteria 3171
367 nmdc:mga07m45_95152_c1 3300050496 Bacteria 1708
368 nmdc:mga05p37_10752_c1 3300050507 Bacteria 10865
369 nmdc:mga05p37_1991_c1 3300050507 Bacteria 23842
370 nmdc:mga05p37_290478_c1 3300050507 Bacteria 1946
371 nmdc:mga05p37_75155_c1 3300050507 Bacteria 4159
372 nmdc:mga05p37_88486_c1 3300050507 Bacteria 3817
373 nmdc:mga09592_142349_c1 3300050508 Unclassified 2067
374 nmdc:mga09592_29194_c1 3300050508 Bacteria 4586
375 nmdc:mga09592_5191_c1 3300050508 Bacteria 10582
376 nmdc:mga0qj67_12486_c1 3300050509 Bacteria 6399
377 nmdc:mga0qj67_2689_c1 3300050509 Bacteria 12744
378 nmdc:mga0qj67_30793_c1 3300050509 Bacteria 4178
379 nmdc:mga0qj67_59823_c1 3300050509 Bacteria 3022
380 nmdc:mga06r32_12285_c1 3300050510 Bacteria 7723
381 nmdc:mga06r32_14868_c1 3300050510 Bacteria 7062
382 nmdc:mga06r32_8040_c1 3300050510 Bacteria 9490
383 nmdc:mga08y16_116244_c1 3300050511 Bacteria 2784
384 nmdc:mga08y16_15742_c1 3300050511 Bacteria 7953
385 nmdc:mga08y16_196624_c1 3300050511 Unclassified 2090
386 nmdc:mga08y16_30140_c1 3300050511 Bacteria 5710
387 nmdc:mga08y16_30570_c1 3300050511 Bacteria 5667
388 nmdc:mga08y16_7358_c1 3300050511 Bacteria 11548
389 nmdc:mga0n895_136591_c1 3300050512 Bacteria 2478
390 nmdc:mga0n895_454863_c1 3300050512 Unclassified 1292
391 nmdc:mga0n895_88727_c1 3300050512 Bacteria 3092
392 nmdc:mga0a205_46534_c1 3300050515 Bacteria 4184
393 nmdc:mga0a205_90615_c1 3300050515 Bacteria 2955
394 Ga0495595_0118985 3300053084 Bacteria 1286
395 Ga0495595_0152120 3300053084 Bacteria 1139
396 Ga0495595_0187902 3300053084 Bacteria 1026
397 Ga0495619_0013567 3300053085 Bacteria 5134
398 Ga0501084_0010653 3300054114 Bacteria 7610
399 Ga0501084_0039431 3300054114 Bacteria 3951
400 Ga0501084_0131906 3300054114 Bacteria 2103
401 Ga0501084_0235604 3300054114 Bacteria 1545
402 Ga0590071_005228 3300059421 Bacteria 3127
403 Ga0590074_001693 3300059423 Bacteria 3598
404 Ga0590075_001162 3300059424 Bacteria 6666
405 Ga0590077_004815 3300059426 Bacteria 2761
406 Ga0501082_0320483 3300060353 Bacteria 1350
407 Ga0530510_0011523 3300061734 Bacteria 6204
408 Ga0450896_000516
409 Ga0065712_10006688
410 Ga0065712_10075884
411 Ga0065712_10127213
412 Ga0065712_10163203
413 Ga0065715_10033263
414 Ga0065715_10110685
415 Ga0065715_10124120
416 Ga0065707_10095611
417 Ga0070683_100000094
418 Ga0070683_100026068
419 Ga0070683_100030821
420 Ga0070683_100122233
421 Ga0070683_100243962
422 Ga0070670_100013591
423 Ga0070670_100018452
424 Ga0070670_100050681
425 Ga0070670_100093307
426 Ga0070680_100058764
427 Ga0070680_100119153
428 Ga0070682_100282322
429 Ga0070682_100392696
430 Ga0068868_100096253
431 Ga0068868_100489986
432 Ga0070660_100012406
433 Ga0070687_100251255
434 Ga0070661_100022927
435 Ga0070661_100338143
436 Ga0070668_100054313
437 Ga0070669_100001822
438 Ga0070669_100304522
439 Ga0070675_100061137
440 Ga0070675_100305837
441 Ga0070675_100311877
442 Ga0070671_100039024
443 Ga0070674_100009322
444 Ga0070674_100013217
445 Ga0070673_100268094
446 Ga0070673_100282117
447 Ga0070688_100093114
448 Ga0070688_100450305
449 Ga0070659_100263676
450 Ga0070659_100317022
451 Ga0070711_100195847
452 Ga0070700_100251105
453 Ga0070663_100008778
454 Ga0070663_100259082
455 Ga0070678_100065204
456 Ga0070662_100102749
457 Ga0070662_100201633
458 Ga0070681_10052652
459 Ga0070681_10515467
460 Ga0068867_100116831
461 Ga0070685_10127098
462 Ga0070698_100762686
463 Ga0070684_100006365
464 Ga0070684_100968984
465 Ga0070672_100036831
466 Ga0070672_100063073
467 Ga0070672_100093838
468 Ga0070686_100118004
469 Ga0070696_100093154
470 Ga0070693_100044764
471 Ga0070665_100044418
472 Ga0070665_100096291
473 Ga0068855_100030065
474 Ga0068855_100442819
475 Ga0070664_100000479
476 Ga0070664_100027169
477 Ga0070664_100048136
478 Ga0070664_100422678
479 Ga0068857_100048900
480 Ga0068857_100258244
481 Ga0068854_100595401
482 Ga0068859_100177383
483 Ga0068859_100863290
484 Ga0068864_100007603
485 Ga0068864_100033968
486 Ga0068864_100374955
487 Ga0068851_10058320
488 Ga0068863_100437192
489 Ga0068862_100003872
490 Ga0068862_100279491
491 Ga0075365_10069948
492 Ga0075368_10007369
493 Ga0075368_10022935
494 Ga0075364_10008627
495 Ga0075367_10036020
496 Ga0075367_10086370
497 Ga0075366_10016608
498 Ga0097621_100107960
499 Ga0097621_100221652
500 Ga0097621_100609277
501 Ga0068871_100067423
502 Ga0068871_100098167
503 Ga0068871_100119161
504 Ga0075428_100003278
505 Ga0075428_100005429
506 Ga0075428_100008684
507 Ga0075428_100466415
508 Ga0075430_100006929
509 Ga0075430_100028604
510 Ga0075430_100030132
511 Ga0075430_100307346
512 Ga0075431_100010222
513 Ga0075431_100023957
514 Ga0075431_100030556
515 Ga0075431_100122920
516 Ga0075433_10169324
517 Ga0075433_10227885
518 Ga0075434_100084460
519 Ga0075434_100133719
520 Ga0075434_100683449
521 Ga0075429_100004608
522 Ga0075429_100066780
523 Ga0068865_100103324
524 Ga0068865_100177075
525 Ga0097620_100177391
526 Ga0097620_100863201
527 Ga0105240_10987179
528 Ga0111539_10007496
529 Ga0111539_10017454
530 Ga0111539_10065109
531 Ga0111539_10085138
532 Ga0111539_10177017
533 Ga0111539_10340152
534 Ga0111539_10399317
535 Ga0105245_10062855
536 Ga0105245_10237268
537 Ga0105245_10745387
538 Ga0114129_10001667
539 Ga0114129_10014680
540 Ga0114129_10049178
541 Ga0114129_10109342
542 Ga0114129_10377029
543 Ga0105243_10438996
544 Ga0105243_10966513
545 Ga0105242_10102859
546 Ga0105248_10025354
547 Ga0105248_10045913
548 Ga0105248_10076960
549 Ga0105248_10711647
550 Ga0105238_10717049
551 Ga0105249_10005969
552 Ga0105249_10059481
553 Ga0105249_10568647
554 Ga0105239_11012291
555 Ga0105246_10303257
556 Ga0157374_10054541
557 Ga0157374_10173956
558 Ga0157378_10248106
559 Ga0157378_10481408
560 Ga0157378_10856075
561 Ga0163162_10097740
562 Ga0157375_10141075
563 Ga0157375_10210597
564 Ga0157375_10248735
565 Ga0163163_10022775
566 Ga0163163_10025272
567 Ga0163163_10056111
568 Ga0163163_10184743
569 Ga0163163_10188640
570 Ga0163163_10524259
571 Ga0157380_10551144
572 Ga0157380_10606577
573 Ga0157377_10041454
574 Ga0157379_10014894
575 Ga0157379_10339033
576 Ga0157379_10618100
577 Ga0163161_10057159
578 Ga0207697_10004966
579 Ga0207688_10144757
580 Ga0207647_10184949
581 Ga0207645_10176507
582 Ga0207643_10127873
583 Ga0207707_10304692
584 Ga0207707_10309213
585 Ga0207695_10673453
586 Ga0207660_10030822
587 Ga0207660_10083028
588 Ga0207662_10131443
589 Ga0207662_10181655
590 Ga0207657_10005005
591 Ga0207649_10027313
592 Ga0207652_10046556
593 Ga0207681_10021017
594 Ga0207681_10073864
595 Ga0207681_10253570
596 Ga0207694_10132206
597 Ga0207650_10011879
598 Ga0207650_10135508
599 Ga0207659_10203150
600 Ga0207659_10211574
601 Ga0207687_10173148
602 Ga0207644_10077224
603 Ga0207644_10115360
604 Ga0207690_10108469
605 Ga0207706_10040943
606 Ga0207706_10047583
607 Ga0207709_10151864
608 Ga0207670_10086585
609 Ga0207669_10004496
610 Ga0207669_10074494
611 Ga0207704_10166988
612 Ga0207704_10183313
613 Ga0207691_10020687
614 Ga0207689_10141567
615 Ga0207661_10004428
616 Ga0207661_10023395
617 Ga0207661_10254867
618 Ga0207679_10188201
619 Ga0207679_10262047
620 Ga0207679_10409826
621 Ga0207667_10324744
622 Ga0207667_10629432
623 Ga0207651_10192649
624 Ga0207712_10006542
625 Ga0207668_10140905
626 Ga0207668_10342912
627 Ga0207640_10522997
628 Ga0207677_10109217
629 Ga0207703_10132701
630 Ga0207678_10049992
631 Ga0207678_10290793
632 Ga0207708_10046534
633 Ga0207641_10029652
634 Ga0207641_10249876
635 Ga0207641_10533328
636 Ga0207648_10079971
637 Ga0207648_10784783
638 Ga0207676_10007127
639 Ga0207676_10041996
640 Ga0207676_10076637
641 Ga0207676_10326196
642 Ga0207674_10063745
643 Ga0207674_10186236
644 Ga0207675_100061817
645 Ga0207683_10024456
646 Ga0207683_10315768
647 Ga0207698_10081919
648 Ga0209998_10027730
649 Ga0209813_10008785
650 Ga0207428_10004630
651 Ga0207428_10067222
652 Ga0268266_10029727
653 Ga0268266_10142415
654 Ga0268265_10005894
655 Ga0268265_10247394
656 Ga0268264_10576097
657 Ga0307408_100010625
658 Ga0307405_10101472
659 Ga0307413_10129244
660 Ga0307413_10307520
661 Ga0307407_10011426
662 Ga0307409_100068710
663 Ga0307416_100009990
664 Ga0307416_100010997
665 Ga0307416_100032051
666 Ga0307414_10008224
667 Ga0307411_10035070
668 Ga0307411_10449848
669 Ga0307415_100127545
670 Ga0373943_0174831
671 Ga0373955_0212274
672 Ga0373925_0352637
673 Ga0439445_0010116
674 Ga0439462_0003698
675 Ga0450923_021498
676 Ga0450894_002038
677 Ga0450896_004169
678 Ga0450906_027729
679 Ga0439434_0010045
680 Ga0451577_0219179
681 Ga0466963_0039263
682 Ga0495651_0223321
683 Ga0495653_0119379
684 Ga0495635_0262357
685 Ga0495647_0013278
686 Ga0495647_0269447
687 Ga0495600_0187596
688 Ga0495672_0233840
689 Ga0495676_0288535
690 Ga0496101_0055117
691 Ga0496101_0082923
692 Ga0496101_0153925
693 Ga0496102_0275180
694 Ga0496104_0003182
695 Ga0496104_0021855
696 Ga0496104_0042685
697 Ga0496104_0102720
698 Ga0496105_0018660
699 Ga0496106_0045097
700 Ga0496106_0049794
701 Ga0496106_0373599
702 Ga0496107_0156549
703 Ga0496108_0026415
704 Ga0496108_0030581
705 Ga0496108_0232549
706 Ga0496108_0453213
707 Ga0496109_0000869
708 Ga0496109_0117771
709 Ga0496109_0733281
710 Ga0496110_0009331
711 Ga0496110_0018833
712 Ga0496110_0128963
713 Ga0496111_0003983
714 Ga0496111_0238161
715 Ga0496112_0015012
716 Ga0496112_0017967
717 Ga0496112_0081151
718 Ga0496112_0153463
719 Ga0496113_0034713
720 Ga0496114_0434774
721 Ga0496114_0456423
722 Ga0496115_0464159
723 Ga0501034_0008933
724 Ga0501036_0070194
725 Ga0501036_0158883
726 Ga0501036_0286845
727 Ga0501038_0054602
728 Ga0501039_0040885
729 Ga0501040_0021505
730 Ga0501040_0488121
731 Ga0501041_0066064
732 Ga0501041_0136912
733 Ga0501042_0018015
734 Ga0501042_0091145
735 Ga0501042_0448735
736 Ga0501046_0049762
737 Ga0501046_0132482
738 Ga0501048_0507089
739 Ga0501071_0017167
740 Ga0501071_0022688
741 Ga0501071_0040592
742 Ga0501071_0091292
743 Ga0501072_0044194
744 Ga0501072_0076753
745 Ga0501072_0160855
746 Ga0501072_0203935
747 Ga0501072_0346681
748 Ga0501074_0042870
749 Ga0501075_0007335
750 Ga0501075_0018277
751 Ga0501075_0031044
752 Ga0501075_0033988
753 Ga0501075_0134838
754 Ga0501076_0005066
755 Ga0501076_0011647
756 Ga0501076_0017162
757 Ga0501076_0350975
758 Ga0501076_0355163
759 Ga0501076_0417421
760 Ga0501076_0448972
761 Ga0501077_0159674
762 Ga0501077_0369110
763 Ga0501079_0197426
764 Ga0501079_0214284
765 Ga0501079_0601268
766 Ga0501083_0187573
767 Ga0501045_0011397
768 Ga0501045_0196494
769 nmdc:mga00v17_345994_c1
770 nmdc:mga0yw44_159270_c1
771 nmdc:mga0k408_22772_c1
772 nmdc:mga04h51_25597_c1
773 nmdc:mga07m45_26765_c1
774 nmdc:mga07m45_95152_c1
775 nmdc:mga05p37_10752_c1
776 nmdc:mga05p37_1991_c1
777 nmdc:mga05p37_290478_c1
778 nmdc:mga05p37_75155_c1
779 nmdc:mga05p37_88486_c1
780 nmdc:mga09592_142349_c1
781 nmdc:mga09592_29194_c1
782 nmdc:mga09592_5191_c1
783 nmdc:mga0qj67_12486_c1
784 nmdc:mga0qj67_2689_c1
785 nmdc:mga0qj67_30793_c1
786 nmdc:mga0qj67_59823_c1
787 nmdc:mga06r32_12285_c1
788 nmdc:mga06r32_14868_c1
789 nmdc:mga06r32_8040_c1
790 nmdc:mga08y16_116244_c1
791 nmdc:mga08y16_15742_c1
792 nmdc:mga08y16_196624_c1
793 nmdc:mga08y16_30140_c1
794 nmdc:mga08y16_30570_c1
795 nmdc:mga08y16_7358_c1
796 nmdc:mga0n895_136591_c1
797 nmdc:mga0n895_454863_c1
798 nmdc:mga0n895_88727_c1
799 nmdc:mga0a205_46534_c1
800 nmdc:mga0a205_90615_c1
801 Ga0495595_0118985
802 Ga0495595_0152120
803 Ga0495595_0187902
804 Ga0495619_0013567
805 Ga0501084_0010653
806 Ga0501084_0039431
807 Ga0501084_0131906
808 Ga0501084_0235604
809 Ga0590071_005228
810 Ga0590074_001693
811 Ga0590075_001162
812 Ga0590077_004815
813 Ga0501082_0320483
814 Ga0530510_0011523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

61

187

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8474 8 245
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8425 7 245
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8207 8 245
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8075 7 245
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.6204 10 241
ID Description Score Start End Superfamily
af_I6YDI9_312_439_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9134 63 185 3.40.50.620
af_Q8I5S7_22_233_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9086 63 177 3.40.50.2000
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9018 61 185 3.40.50.2000
af_Q4DRS8_153_366_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9004 61 185 3.40.50.2000
af_Q9US20_86_212_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8982 61 183 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7W1I2G3-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) 0.9398 6 238 GO:0003841
GO:0006654
GO:0016020
AF-A0A2V8TLQ0-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) 0.939 7 243 GO:0003841
GO:0006654
GO:0016020
AF-A0A2J6J858-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) 0.936 10 238 GO:0003841
GO:0006654
GO:0016020
GO:0016024
AF-A0A7C0X0S0-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) 0.9345 14 237 GO:0003841
GO:0006654
GO:0016020
GO:0016024
AF-A0A496TMT2-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) 0.9331 11 245 GO:0003841
GO:0006654
GO:0016020

Map