F436484

General Info

Members Datasets Scaffolds Average Seq Length
407 218 814 177

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10775012|Ga0207670_107750122
Length 195
Sequence MSCGLISSPSQFKPDSLLRIGKKPVPVPNGVTVSIDGSKITVKGPRGELTRALHPEVGVSMENGEVVVTRPSDESRHKALHGLSRTLVANMIEGVTKGYVKQLEITGVGYKAEVKPYGLLFSLGYSHQIEFKAPGGIKLTAPVPTQVVVEGANKEIVGQVAAEIRSLRKPEPYKGKGVKYAGEVVRRKAGKAGGK

Samples

Sample ID Description Type Environment
1 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.25
Rhizosphere 99.51
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207670_10775012 3300025936 Bacteria 798
2 Ga0058863_11613772 3300004799 Bacteria 2238
3 Ga0070658_10507395 3300005327 Bacteria 1042
4 Ga0070658_11197062 3300005327 Bacteria 660
5 Ga0070676_10200853 3300005328 Bacteria 1307
6 Ga0070683_100017261 3300005329 Bacteria 6377
7 Ga0070683_100049709 3300005329 Bacteria 3879
8 Ga0070683_100145954 3300005329 Bacteria 2242
9 Ga0070683_100165900 3300005329 Bacteria 2095
10 Ga0070683_100460640 3300005329 Bacteria 1213
11 Ga0070683_100479026 3300005329 Bacteria 1188
12 Ga0070690_100023994 3300005330 Bacteria 3748
13 Ga0070670_100025380 3300005331 Bacteria 5099
14 Ga0070670_100158202 3300005331 Bacteria 1963
15 Ga0070670_100479958 3300005331 Bacteria 1104
16 Ga0070677_10126562 3300005333 Bacteria 1161
17 Ga0068869_101062679 3300005334 Bacteria 707
18 Ga0070680_100000910 3300005336 Bacteria 20950
19 Ga0070680_100032805 3300005336 Bacteria 4181
20 Ga0070680_100096822 3300005336 Bacteria 2447
21 Ga0070680_100292371 3300005336 Bacteria 1381
22 Ga0070680_100304133 3300005336 Bacteria 1352
23 Ga0070680_100502473 3300005336 Bacteria 1037
24 Ga0070682_100002676 3300005337 Bacteria 9852
25 Ga0068868_100013085 3300005338 Bacteria 6075
26 Ga0068868_100136673 3300005338 Bacteria 2009
27 Ga0068868_100163856 3300005338 Bacteria 1838
28 Ga0068868_100559549 3300005338 Bacteria 1009
29 Ga0070689_100193131 3300005340 Bacteria 1658
30 Ga0070689_101307304 3300005340 Bacteria 653
31 Ga0070691_10022394 3300005341 Bacteria 2931
32 Ga0070691_10102384 3300005341 Bacteria 1424
33 Ga0070687_100571041 3300005343 Bacteria 773
34 Ga0070661_100001922 3300005344 Bacteria 14385
35 Ga0070692_10108195 3300005345 Bacteria 1534
36 Ga0070668_100275443 3300005347 Bacteria 1404
37 Ga0070669_100002074 3300005353 Bacteria 14482
38 Ga0070669_100229266 3300005353 Bacteria 1471
39 Ga0070675_100005173 3300005354 Bacteria 9948
40 Ga0070671_100038461 3300005355 Bacteria 3971
41 Ga0070674_100106391 3300005356 Bacteria 2053
42 Ga0070674_100152353 3300005356 Bacteria 1746
43 Ga0070674_100283229 3300005356 Bacteria 1314
44 Ga0070673_100022620 3300005364 Bacteria 4579
45 Ga0070673_100042656 3300005364 Bacteria 3499
46 Ga0070673_100204578 3300005364 Bacteria 1702
47 Ga0070673_100265238 3300005364 Bacteria 1501
48 Ga0070688_100216880 3300005365 Bacteria 1346
49 Ga0070659_100013102 3300005366 Bacteria 6167
50 Ga0070659_101470717 3300005366 Bacteria 607
51 Ga0070667_100038074 3300005367 Bacteria 4032
52 Ga0070709_10114462 3300005434 Bacteria 1818
53 Ga0070700_100023700 3300005441 Bacteria 3593
54 Ga0070700_100083780 3300005441 Bacteria 2065
55 Ga0070700_100315280 3300005441 Bacteria 1147
56 Ga0070663_100175806 3300005455 Bacteria 1658
57 Ga0070663_100329139 3300005455 Bacteria 1231
58 Ga0070663_100395580 3300005455 Bacteria 1128
59 Ga0070678_101022002 3300005456 Bacteria 760
60 Ga0070678_101122270 3300005456 Bacteria 727
61 Ga0070662_100114290 3300005457 Bacteria 2061
62 Ga0070662_100148325 3300005457 Bacteria 1823
63 Ga0070681_10020787 3300005458 Bacteria 6575
64 Ga0070681_10157362 3300005458 Bacteria 2196
65 Ga0070681_10673774 3300005458 Bacteria 949
66 Ga0070681_11017531 3300005458 Bacteria 748
67 Ga0068867_100035800 3300005459 Bacteria 3602
68 Ga0068867_100124454 3300005459 Bacteria 1996
69 Ga0068867_100176452 3300005459 Bacteria 1696
70 Ga0070707_100215232 3300005468 Bacteria 1872
71 Ga0070698_100116218 3300005471 Bacteria 2639
72 Ga0070698_100313685 3300005471 Bacteria 1499
73 Ga0070699_100093602 3300005518 Bacteria 2629
74 Ga0070699_100124257 3300005518 Bacteria 2271
75 Ga0070699_100176205 3300005518 Unclassified 1896
76 Ga0070679_100020857 3300005530 Bacteria 6393
77 Ga0070679_100310597 3300005530 Bacteria 1526
78 Ga0070684_100139752 3300005535 Bacteria 2189
79 Ga0070684_100296210 3300005535 Bacteria 1484
80 Ga0070697_100292674 3300005536 Bacteria 1399
81 Ga0070697_100708922 3300005536 Bacteria 888
82 Ga0068853_100315958 3300005539 Bacteria 1447
83 Ga0068853_100813632 3300005539 Bacteria 895
84 Ga0070672_100027315 3300005543 Bacteria 4255
85 Ga0070672_100049540 3300005543 Bacteria 3268
86 Ga0070695_100268923 3300005545 Bacteria 1248
87 Ga0070696_100004370 3300005546 Bacteria 9415
88 Ga0070696_100024258 3300005546 Bacteria 4121
89 Ga0070693_100000799 3300005547 Bacteria 13905
90 Ga0070665_100017661 3300005548 Bacteria 7165
91 Ga0068855_100063511 3300005563 Bacteria 4309
92 Ga0070664_100051312 3300005564 Bacteria 3492
93 Ga0070664_100162820 3300005564 Bacteria 1975
94 Ga0070664_100375028 3300005564 Bacteria 1298
95 Ga0070664_101539050 3300005564 Bacteria 630
96 Ga0068854_100021737 3300005578 Bacteria 4358
97 Ga0068854_100178803 3300005578 Bacteria 1656
98 Ga0068854_101096700 3300005578 Bacteria 709
99 Ga0070702_100100208 3300005615 Bacteria 1775
100 Ga0068859_100780182 3300005617 Bacteria 1044
101 Ga0068859_100940235 3300005617 Bacteria 948
102 Ga0068864_100982572 3300005618 Bacteria 837
103 Ga0068866_10012329 3300005718 Bacteria 3723
104 Ga0068866_10015080 3300005718 Bacteria 3427
105 Ga0068861_100035146 3300005719 Bacteria 3711
106 Ga0068861_100758901 3300005719 Bacteria 907
107 Ga0068851_10208350 3300005834 Bacteria 1094
108 Ga0068870_10019634 3300005840 Bacteria 3280
109 Ga0068863_100360643 3300005841 Bacteria 1417
110 Ga0068858_100398466 3300005842 Bacteria 1322
111 Ga0068862_100027213 3300005844 Bacteria 4812
112 Ga0068862_100669448 3300005844 Bacteria 1003
113 Ga0081538_10240599 3300005981 Bacteria 698
114 Ga0070712_100031932 3300006175 Bacteria 3552
115 Ga0075428_100133379 3300006844 Bacteria 2700
116 Ga0075428_100171468 3300006844 Bacteria 2351
117 Ga0075428_101273136 3300006844 Bacteria 774
118 Ga0075430_100039427 3300006846 Bacteria 4000
119 Ga0075430_100053053 3300006846 Bacteria 3414
120 Ga0075430_100054794 3300006846 Bacteria 3355
121 Ga0075430_100115400 3300006846 Bacteria 2237
122 Ga0075430_100289245 3300006846 Bacteria 1356
123 Ga0075431_100044223 3300006847 Bacteria 4593
124 Ga0075431_100068058 3300006847 Bacteria 3675
125 Ga0075431_100071547 3300006847 Bacteria 3578
126 Ga0075431_100292355 3300006847 Bacteria 1648
127 Ga0075433_10062436 3300006852 Bacteria 3262
128 Ga0075433_10220701 3300006852 Bacteria 1684
129 Ga0075429_100148845 3300006880 Bacteria 2049
130 Ga0075429_100396320 3300006880 Bacteria 1209
131 Ga0075429_100567206 3300006880 Bacteria 995
132 Ga0068865_100005317 3300006881 Bacteria 7794
133 Ga0068865_100137600 3300006881 Bacteria 1837
134 Ga0097620_100780216 3300006931 Bacteria 1044
135 Ga0097620_100940414 3300006931 Bacteria 948
136 Ga0075435_100289011 3300007076 Unclassified 1400
137 Ga0105240_10251280 3300009093 Bacteria 2045
138 Ga0105240_10258655 3300009093 Bacteria 2009
139 Ga0105240_10358222 3300009093 Bacteria 1653
140 Ga0105240_10471915 3300009093 Bacteria 1400
141 Ga0111539_10355442 3300009094 Bacteria 1705
142 Ga0105245_10063450 3300009098 Bacteria 3336
143 Ga0105245_10085660 3300009098 Bacteria 2889
144 Ga0114129_10029107 3300009147 Bacteria 7824
145 Ga0114129_10417307 3300009147 Bacteria 1766
146 Ga0105243_10373099 3300009148 Bacteria 1317
147 Ga0105243_10382826 3300009148 Bacteria 1302
148 Ga0105243_10774369 3300009148 Bacteria 943
149 Ga0105242_10037458 3300009176 Bacteria 3896
150 Ga0105248_10047869 3300009177 Bacteria 4795
151 Ga0105248_10178279 3300009177 Bacteria 2395
152 Ga0105237_10027394 3300009545 Bacteria 5818
153 Ga0105249_10000277 3300009553 Bacteria 54091
154 Ga0105249_11036283 3300009553 Bacteria 890
155 Ga0157373_10001735 3300013100 Bacteria 16567
156 Ga0157370_10275311 3300013104 Bacteria 1555
157 Ga0157370_10337717 3300013104 Bacteria 1389
158 Ga0157369_11298643 3300013105 Bacteria 742
159 Ga0157369_11475877 3300013105 Bacteria 692
160 Ga0157374_10130874 3300013296 Bacteria 2428
161 Ga0157378_10140034 3300013297 Bacteria 2246
162 Ga0157378_10148856 3300013297 Bacteria 2180
163 Ga0157378_10321397 3300013297 Bacteria 1504
164 Ga0157378_10398294 3300013297 Bacteria 1356
165 Ga0163162_10832703 3300013306 Bacteria 1039
166 Ga0163162_11018174 3300013306 Bacteria 937
167 Ga0157372_10041811 3300013307 Bacteria 5068
168 Ga0157372_10591864 3300013307 Bacteria 1293
169 Ga0157375_10011929 3300013308 Bacteria 7689
170 Ga0157375_10082493 3300013308 Bacteria 3257
171 Ga0157375_10215683 3300013308 Bacteria 2077
172 Ga0157380_10021202 3300014326 Bacteria 4870
173 Ga0182008_10098681 3300014497 Bacteria 1442
174 Ga0163161_10204048 3300017792 Bacteria 1524
175 Ga0163161_10429137 3300017792 Bacteria 1065
176 Ga0163161_10433080 3300017792 Bacteria 1060
177 Ga0163161_10470171 3300017792 Bacteria 1019
178 Ga0207697_10052186 3300025315 Bacteria 1691
179 Ga0207656_10076010 3300025321 Bacteria 1501
180 Ga0207682_10098213 3300025893 Bacteria 1277
181 Ga0207642_10172760 3300025899 Bacteria 1171
182 Ga0207642_10558326 3300025899 Bacteria 708
183 Ga0207680_10140918 3300025903 Bacteria 1598
184 Ga0207699_10193534 3300025906 Bacteria 1374
185 Ga0207645_10131697 3300025907 Bacteria 1627
186 Ga0207645_10695810 3300025907 Bacteria 691
187 Ga0207643_10002350 3300025908 Bacteria 10282
188 Ga0207705_10044719 3300025909 Bacteria 3182
189 Ga0207705_10208102 3300025909 Bacteria 1483
190 Ga0207705_10920735 3300025909 Bacteria 677
191 Ga0207654_10167645 3300025911 Bacteria 1423
192 Ga0207707_10000784 3300025912 Bacteria 31134
193 Ga0207707_10002248 3300025912 Bacteria 17457
194 Ga0207707_10280708 3300025912 Bacteria 1443
195 Ga0207707_10330821 3300025912 Bacteria 1314
196 Ga0207695_10002690 3300025913 Bacteria 25925
197 Ga0207671_10169229 3300025914 Bacteria 1696
198 Ga0207663_10270807 3300025916 Bacteria 1258
199 Ga0207660_10001291 3300025917 Bacteria 16748
200 Ga0207660_10003119 3300025917 Bacteria 10840
201 Ga0207660_10074443 3300025917 Bacteria 2478
202 Ga0207660_10092154 3300025917 Bacteria 2249
203 Ga0207660_10255380 3300025917 Bacteria 1384
204 Ga0207662_10050955 3300025918 Bacteria 2462
205 Ga0207662_10084536 3300025918 Bacteria 1942
206 Ga0207662_10163073 3300025918 Bacteria 1425
207 Ga0207662_10631550 3300025918 Bacteria 747
208 Ga0207657_10093100 3300025919 Bacteria 2510
209 Ga0207657_10177614 3300025919 Bacteria 1722
210 Ga0207649_10002377 3300025920 Bacteria 10552
211 Ga0207649_10452101 3300025920 Bacteria 970
212 Ga0207649_10590802 3300025920 Bacteria 853
213 Ga0207652_10002905 3300025921 Bacteria 14334
214 Ga0207652_10004165 3300025921 Bacteria 11797
215 Ga0207652_11314630 3300025921 Bacteria 626
216 Ga0207681_10006774 3300025923 Bacteria 7026
217 Ga0207681_10010839 3300025923 Bacteria 5600
218 Ga0207650_10155751 3300025925 Bacteria 1807
219 Ga0207659_10008049 3300025926 Bacteria 6526
220 Ga0207659_10123115 3300025926 Bacteria 1990
221 Ga0207687_10291684 3300025927 Bacteria 1311
222 Ga0207687_10558137 3300025927 Bacteria 961
223 Ga0207644_10437328 3300025931 Bacteria 1073
224 Ga0207644_10578262 3300025931 Bacteria 931
225 Ga0207690_10008184 3300025932 Bacteria 6203
226 Ga0207706_10000352 3300025933 Bacteria 49647
227 Ga0207706_10048635 3300025933 Bacteria 3750
228 Ga0207706_10169174 3300025933 Bacteria 1921
229 Ga0207706_10363349 3300025933 Bacteria 1257
230 Ga0207686_10778611 3300025934 Bacteria 765
231 Ga0207709_10537967 3300025935 Bacteria 917
232 Ga0207669_10092131 3300025937 Bacteria 1976
233 Ga0207669_10102221 3300025937 Bacteria 1898
234 Ga0207669_10291667 3300025937 Bacteria 1235
235 Ga0207669_10344988 3300025937 Bacteria 1148
236 Ga0207691_10003543 3300025940 Bacteria 15184
237 Ga0207691_10038089 3300025940 Bacteria 4449
238 Ga0207691_10054092 3300025940 Bacteria 3662
239 Ga0207689_10087742 3300025942 Bacteria 2555
240 Ga0207689_10812203 3300025942 Bacteria 789
241 Ga0207661_10017202 3300025944 Bacteria 5346
242 Ga0207661_10332322 3300025944 Bacteria 1368
243 Ga0207661_10544955 3300025944 Bacteria 1062
244 Ga0207661_10696300 3300025944 Unclassified 934
245 Ga0207661_10916165 3300025944 Bacteria 807
246 Ga0207679_10572597 3300025945 Bacteria 1015
247 Ga0207679_11353675 3300025945 Bacteria 653
248 Ga0207667_10057146 3300025949 Bacteria 4096
249 Ga0207651_10053787 3300025960 Bacteria 2754
250 Ga0207712_10002118 3300025961 Bacteria 12979
251 Ga0207668_10039873 3300025972 Bacteria 3165
252 Ga0207640_10000324 3300025981 Bacteria 31977
253 Ga0207640_10001124 3300025981 Bacteria 14743
254 Ga0207640_10585757 3300025981 Bacteria 942
255 Ga0207658_10089788 3300025986 Bacteria 2380
256 Ga0207658_10537691 3300025986 Bacteria 1044
257 Ga0207677_10398964 3300026023 Bacteria 1166
258 Ga0207703_10562576 3300026035 Bacteria 1076
259 Ga0207639_10279352 3300026041 Bacteria 1468
260 Ga0207639_10902983 3300026041 Bacteria 826
261 Ga0207678_10124884 3300026067 Bacteria 2196
262 Ga0207678_10333536 3300026067 Bacteria 1306
263 Ga0207708_10176275 3300026075 Bacteria 1696
264 Ga0207708_10274134 3300026075 Bacteria 1365
265 Ga0207648_10147992 3300026089 Bacteria 2072
266 Ga0207648_10177342 3300026089 Bacteria 1885
267 Ga0207648_10198576 3300026089 Bacteria 1779
268 Ga0207648_10227331 3300026089 Bacteria 1659
269 Ga0207648_10407127 3300026089 Bacteria 1233
270 Ga0207676_10255270 3300026095 Bacteria 1580
271 Ga0207675_100132844 3300026118 Bacteria 2360
272 Ga0207675_100314140 3300026118 Bacteria 1529
273 Ga0207675_100882673 3300026118 Bacteria 910
274 Ga0207675_101550391 3300026118 Bacteria 683
275 Ga0207683_10012487 3300026121 Bacteria 7247
276 Ga0207683_10238094 3300026121 Bacteria 1660
277 Ga0207683_10776734 3300026121 Bacteria 889
278 Ga0209996_1004496 3300027395 Bacteria 1769
279 Ga0209995_1018125 3300027471 Bacteria 1160
280 Ga0209968_1004793 3300027526 Bacteria 2026
281 Ga0209999_1000199 3300027543 Bacteria 8320
282 Ga0209971_1039920 3300027682 Bacteria 1129
283 Ga0209966_1095610 3300027695 Bacteria 668
284 Ga0207428_10224196 3300027907 Bacteria 1408
285 Ga0207428_10448565 3300027907 Bacteria 941
286 Ga0268265_10002880 3300028380 Bacteria 12637
287 Ga0268265_10585662 3300028380 Bacteria 1064
288 Ga0268264_10087060 3300028381 Bacteria 2685
289 Ga0265318_10095682 3300028577 Bacteria 1093
290 Ga0265332_10001239 3300031238 Bacteria 14770
291 Ga0265320_10105530 3300031240 Bacteria 1295
292 Ga0265331_10057088 3300031250 Bacteria 1852
293 Ga0265327_10004939 3300031251 Bacteria 11475
294 Ga0307408_100121315 3300031548 Bacteria 2025
295 Ga0307408_100161573 3300031548 Bacteria 1780
296 Ga0307408_100199436 3300031548 Bacteria 1618
297 Ga0265314_10004621 3300031711 Bacteria 12682
298 Ga0265314_10007107 3300031711 Bacteria 9763
299 Ga0265342_10032432 3300031712 Bacteria 3222
300 Ga0307405_10016807 3300031731 Bacteria 3998
301 Ga0307405_10140466 3300031731 Bacteria 1683
302 Ga0307405_10817539 3300031731 Bacteria 782
303 Ga0307413_10009226 3300031824 Bacteria 4711
304 Ga0307413_10767836 3300031824 Bacteria 807
305 Ga0307410_10120885 3300031852 Bacteria 1910
306 Ga0307410_10337426 3300031852 Bacteria 1200
307 Ga0307406_10067981 3300031901 Bacteria 2325
308 Ga0307406_10075378 3300031901 Bacteria 2225
309 Ga0307406_10559828 3300031901 Bacteria 937
310 Ga0307407_10044948 3300031903 Bacteria 2492
311 Ga0307407_10339978 3300031903 Bacteria 1059
312 Ga0307407_10891510 3300031903 Bacteria 682
313 Ga0307412_10103011 3300031911 Bacteria 2022
314 Ga0307412_11239196 3300031911 Bacteria 669
315 Ga0307409_100018405 3300031995 Bacteria 4695
316 Ga0307409_100466543 3300031995 Bacteria 1222
317 Ga0307409_100543580 3300031995 Bacteria 1139
318 Ga0307409_101025484 3300031995 Bacteria 844
319 Ga0307409_101175820 3300031995 Bacteria 790
320 Ga0307416_100192716 3300032002 Bacteria 1924
321 Ga0307416_100195465 3300032002 Bacteria 1913
322 Ga0307416_100485622 3300032002 Bacteria 1296
323 Ga0307416_102444959 3300032002 Bacteria 621
324 Ga0307414_10235338 3300032004 Bacteria 1513
325 Ga0307414_10796838 3300032004 Bacteria 861
326 Ga0307411_10024316 3300032005 Bacteria 3608
327 Ga0307411_10080119 3300032005 Bacteria 2244
328 Ga0307411_10661875 3300032005 Bacteria 905
329 Ga0307415_100100541 3300032126 Bacteria 2119
330 Ga0307415_100532183 3300032126 Bacteria 1033
331 Ga0307415_100587442 3300032126 Bacteria 989
332 Ga0307415_100916360 3300032126 Bacteria 809
333 Ga0373958_0019788 3300034819 Bacteria 1233
334 Ga0373959_0039042 3300034820 Bacteria 989
335 Ga0373961_0009278 3300035241 Bacteria 2405
336 Ga0395899_0016397 3300037312 Bacteria 5647
337 Ga0395900_0024491 3300037418 Bacteria 6181
338 Ga0395905_0036928 3300037471 Bacteria 4589
339 Ga0395905_1424588 3300037471 Bacteria 597
340 Ga0395901_0001770 3300038443 Bacteria 22280
341 Ga0436365_0349199 3300039437 Bacteria 759
342 Ga0439433_0056841 3300041999 Bacteria 929
343 Ga0439448_0144775 3300042005 Bacteria 823
344 Ga0439455_0028530 3300042012 Bacteria 1375
345 Ga0439446_0021745 3300042156 Bacteria 1815
346 Ga0439434_0089043 3300042435 Bacteria 985
347 Ga0451577_0000001 3300042876 Bacteria 2461803
348 Ga0451577_0003185 3300042876 Bacteria 18443
349 Ga0451577_0587478 3300042876 Bacteria 1011
350 Ga0453683_0251784 3300044673 Bacteria 1126
351 Ga0466966_0001530 3300044684 Bacteria 14826
352 Ga0466961_0356294 3300044693 Bacteria 890
353 Ga0453684_0000375 3300044712 Bacteria 183706
354 Ga0453684_0098653 3300044712 Bacteria 3580
355 Ga0453684_0175778 3300044712 Bacteria 2518
356 Ga0453684_0860503 3300044712 Bacteria 974
357 Ga0466971_0196097 3300044719 Bacteria 952
358 Ga0466959_0006514 3300045049 Bacteria 8095
359 Ga0466959_0083208 3300045049 Bacteria 2305
360 Ga0451576_0326485 3300045051 Bacteria 1606
361 Ga0466967_0364338 3300045976 Bacteria 1401
362 Ga0495662_0036669 3300046476 Bacteria 2366
363 Ga0496112_0002541 3300048915 Bacteria 14732
364 Ga0501031_0037526 3300049568 Bacteria 3162
365 Ga0501033_0192130 3300049570 Bacteria 1461
366 Ga0501036_0111057 3300049572 Bacteria 2316
367 Ga0501037_0210998 3300049573 Bacteria 1369
368 Ga0501039_0760516 3300049575 Bacteria 756
369 Ga0501040_0009272 3300049576 Bacteria 6410
370 Ga0501041_0030218 3300049577 Bacteria 3270
371 Ga0501042_0017389 3300049578 Bacteria 4959
372 Ga0501046_0053213 3300049580 Bacteria 3189
373 Ga0501048_0028696 3300049582 Bacteria 4040
374 Ga0501072_0367608 3300049588 Bacteria 1142
375 Ga0501075_0088078 3300049591 Bacteria 2353
376 Ga0501075_0509928 3300049591 Bacteria 918
377 Ga0501076_0046987 3300049592 Bacteria 3412
378 Ga0501079_0024530 3300049741 Bacteria 4628
379 Ga0501080_0199329 3300049742 Bacteria 1838
380 Ga0501273_042123 3300049770 Bacteria 678
381 Ga0501035_0178644 3300049822 Bacteria 1830
382 Ga0501044_0180101 3300049823 Bacteria 2081
383 Ga0501045_0051094 3300049824 Bacteria 3017
384 nmdc:mga05p37_829061_c1 3300050507 Bacteria 1008
385 nmdc:mga05p37_87239_c1 3300050507 Bacteria 3846
386 nmdc:mga09592_474072_c1 3300050508 Bacteria 1079
387 nmdc:mga09592_526857_c1 3300050508 Bacteria 1016
388 nmdc:mga09592_558664_c1 3300050508 Bacteria 983
389 nmdc:mga0qj67_130433_c1 3300050509 Bacteria 2036
390 nmdc:mga0qj67_15584_c1 3300050509 Bacteria 5756
391 nmdc:mga0qj67_22576_c1 3300050509 Bacteria 4834
392 nmdc:mga0qj67_967541_c1 3300050509 Bacteria 669
393 nmdc:mga06r32_145939_c1 3300050510 Bacteria 2343
394 nmdc:mga06r32_275906_c1 3300050510 Bacteria 1668
395 nmdc:mga06r32_32023_c1 3300050510 Bacteria 4942
396 nmdc:mga06r32_6558_c1 3300050510 Bacteria 10457
397 nmdc:mga08y16_29521_c1 3300050511 Bacteria 3703
398 nmdc:mga08y16_40240_c1 3300050511 Bacteria 4900
399 nmdc:mga0n895_106035_c1 3300050512 Bacteria 2823
400 nmdc:mga0n895_847694_c1 3300050512 Unclassified 902
401 nmdc:mga0rr50_274347_c1 3300050513 Unclassified 1406
402 nmdc:mga0a205_144052_c1 3300050515 Bacteria 2283
403 nmdc:mga0a205_228694_c1 3300050515 Bacteria 1744
404 Ga0501084_0138627 3300054114 Bacteria 2048
405 Ga0501082_0155959 3300060353 Bacteria 1984
406 Ga0501082_0322417 3300060353 Bacteria 1346
407 Ga0530510_1509493 3300061734 Bacteria 516
408 Ga0207670_10775012
409 Ga0058863_11613772
410 Ga0070658_10507395
411 Ga0070658_11197062
412 Ga0070676_10200853
413 Ga0070683_100017261
414 Ga0070683_100049709
415 Ga0070683_100145954
416 Ga0070683_100165900
417 Ga0070683_100460640
418 Ga0070683_100479026
419 Ga0070690_100023994
420 Ga0070670_100025380
421 Ga0070670_100158202
422 Ga0070670_100479958
423 Ga0070677_10126562
424 Ga0068869_101062679
425 Ga0070680_100000910
426 Ga0070680_100032805
427 Ga0070680_100096822
428 Ga0070680_100292371
429 Ga0070680_100304133
430 Ga0070680_100502473
431 Ga0070682_100002676
432 Ga0068868_100013085
433 Ga0068868_100136673
434 Ga0068868_100163856
435 Ga0068868_100559549
436 Ga0070689_100193131
437 Ga0070689_101307304
438 Ga0070691_10022394
439 Ga0070691_10102384
440 Ga0070687_100571041
441 Ga0070661_100001922
442 Ga0070692_10108195
443 Ga0070668_100275443
444 Ga0070669_100002074
445 Ga0070669_100229266
446 Ga0070675_100005173
447 Ga0070671_100038461
448 Ga0070674_100106391
449 Ga0070674_100152353
450 Ga0070674_100283229
451 Ga0070673_100022620
452 Ga0070673_100042656
453 Ga0070673_100204578
454 Ga0070673_100265238
455 Ga0070688_100216880
456 Ga0070659_100013102
457 Ga0070659_101470717
458 Ga0070667_100038074
459 Ga0070709_10114462
460 Ga0070700_100023700
461 Ga0070700_100083780
462 Ga0070700_100315280
463 Ga0070663_100175806
464 Ga0070663_100329139
465 Ga0070663_100395580
466 Ga0070678_101022002
467 Ga0070678_101122270
468 Ga0070662_100114290
469 Ga0070662_100148325
470 Ga0070681_10020787
471 Ga0070681_10157362
472 Ga0070681_10673774
473 Ga0070681_11017531
474 Ga0068867_100035800
475 Ga0068867_100124454
476 Ga0068867_100176452
477 Ga0070707_100215232
478 Ga0070698_100116218
479 Ga0070698_100313685
480 Ga0070699_100093602
481 Ga0070699_100124257
482 Ga0070699_100176205
483 Ga0070679_100020857
484 Ga0070679_100310597
485 Ga0070684_100139752
486 Ga0070684_100296210
487 Ga0070697_100292674
488 Ga0070697_100708922
489 Ga0068853_100315958
490 Ga0068853_100813632
491 Ga0070672_100027315
492 Ga0070672_100049540
493 Ga0070695_100268923
494 Ga0070696_100004370
495 Ga0070696_100024258
496 Ga0070693_100000799
497 Ga0070665_100017661
498 Ga0068855_100063511
499 Ga0070664_100051312
500 Ga0070664_100162820
501 Ga0070664_100375028
502 Ga0070664_101539050
503 Ga0068854_100021737
504 Ga0068854_100178803
505 Ga0068854_101096700
506 Ga0070702_100100208
507 Ga0068859_100780182
508 Ga0068859_100940235
509 Ga0068864_100982572
510 Ga0068866_10012329
511 Ga0068866_10015080
512 Ga0068861_100035146
513 Ga0068861_100758901
514 Ga0068851_10208350
515 Ga0068870_10019634
516 Ga0068863_100360643
517 Ga0068858_100398466
518 Ga0068862_100027213
519 Ga0068862_100669448
520 Ga0081538_10240599
521 Ga0070712_100031932
522 Ga0075428_100133379
523 Ga0075428_100171468
524 Ga0075428_101273136
525 Ga0075430_100039427
526 Ga0075430_100053053
527 Ga0075430_100054794
528 Ga0075430_100115400
529 Ga0075430_100289245
530 Ga0075431_100044223
531 Ga0075431_100068058
532 Ga0075431_100071547
533 Ga0075431_100292355
534 Ga0075433_10062436
535 Ga0075433_10220701
536 Ga0075429_100148845
537 Ga0075429_100396320
538 Ga0075429_100567206
539 Ga0068865_100005317
540 Ga0068865_100137600
541 Ga0097620_100780216
542 Ga0097620_100940414
543 Ga0075435_100289011
544 Ga0105240_10251280
545 Ga0105240_10258655
546 Ga0105240_10358222
547 Ga0105240_10471915
548 Ga0111539_10355442
549 Ga0105245_10063450
550 Ga0105245_10085660
551 Ga0114129_10029107
552 Ga0114129_10417307
553 Ga0105243_10373099
554 Ga0105243_10382826
555 Ga0105243_10774369
556 Ga0105242_10037458
557 Ga0105248_10047869
558 Ga0105248_10178279
559 Ga0105237_10027394
560 Ga0105249_10000277
561 Ga0105249_11036283
562 Ga0157373_10001735
563 Ga0157370_10275311
564 Ga0157370_10337717
565 Ga0157369_11298643
566 Ga0157369_11475877
567 Ga0157374_10130874
568 Ga0157378_10140034
569 Ga0157378_10148856
570 Ga0157378_10321397
571 Ga0157378_10398294
572 Ga0163162_10832703
573 Ga0163162_11018174
574 Ga0157372_10041811
575 Ga0157372_10591864
576 Ga0157375_10011929
577 Ga0157375_10082493
578 Ga0157375_10215683
579 Ga0157380_10021202
580 Ga0182008_10098681
581 Ga0163161_10204048
582 Ga0163161_10429137
583 Ga0163161_10433080
584 Ga0163161_10470171
585 Ga0207697_10052186
586 Ga0207656_10076010
587 Ga0207682_10098213
588 Ga0207642_10172760
589 Ga0207642_10558326
590 Ga0207680_10140918
591 Ga0207699_10193534
592 Ga0207645_10131697
593 Ga0207645_10695810
594 Ga0207643_10002350
595 Ga0207705_10044719
596 Ga0207705_10208102
597 Ga0207705_10920735
598 Ga0207654_10167645
599 Ga0207707_10000784
600 Ga0207707_10002248
601 Ga0207707_10280708
602 Ga0207707_10330821
603 Ga0207695_10002690
604 Ga0207671_10169229
605 Ga0207663_10270807
606 Ga0207660_10001291
607 Ga0207660_10003119
608 Ga0207660_10074443
609 Ga0207660_10092154
610 Ga0207660_10255380
611 Ga0207662_10050955
612 Ga0207662_10084536
613 Ga0207662_10163073
614 Ga0207662_10631550
615 Ga0207657_10093100
616 Ga0207657_10177614
617 Ga0207649_10002377
618 Ga0207649_10452101
619 Ga0207649_10590802
620 Ga0207652_10002905
621 Ga0207652_10004165
622 Ga0207652_11314630
623 Ga0207681_10006774
624 Ga0207681_10010839
625 Ga0207650_10155751
626 Ga0207659_10008049
627 Ga0207659_10123115
628 Ga0207687_10291684
629 Ga0207687_10558137
630 Ga0207644_10437328
631 Ga0207644_10578262
632 Ga0207690_10008184
633 Ga0207706_10000352
634 Ga0207706_10048635
635 Ga0207706_10169174
636 Ga0207706_10363349
637 Ga0207686_10778611
638 Ga0207709_10537967
639 Ga0207669_10092131
640 Ga0207669_10102221
641 Ga0207669_10291667
642 Ga0207669_10344988
643 Ga0207691_10003543
644 Ga0207691_10038089
645 Ga0207691_10054092
646 Ga0207689_10087742
647 Ga0207689_10812203
648 Ga0207661_10017202
649 Ga0207661_10332322
650 Ga0207661_10544955
651 Ga0207661_10696300
652 Ga0207661_10916165
653 Ga0207679_10572597
654 Ga0207679_11353675
655 Ga0207667_10057146
656 Ga0207651_10053787
657 Ga0207712_10002118
658 Ga0207668_10039873
659 Ga0207640_10000324
660 Ga0207640_10001124
661 Ga0207640_10585757
662 Ga0207658_10089788
663 Ga0207658_10537691
664 Ga0207677_10398964
665 Ga0207703_10562576
666 Ga0207639_10279352
667 Ga0207639_10902983
668 Ga0207678_10124884
669 Ga0207678_10333536
670 Ga0207708_10176275
671 Ga0207708_10274134
672 Ga0207648_10147992
673 Ga0207648_10177342
674 Ga0207648_10198576
675 Ga0207648_10227331
676 Ga0207648_10407127
677 Ga0207676_10255270
678 Ga0207675_100132844
679 Ga0207675_100314140
680 Ga0207675_100882673
681 Ga0207675_101550391
682 Ga0207683_10012487
683 Ga0207683_10238094
684 Ga0207683_10776734
685 Ga0209996_1004496
686 Ga0209995_1018125
687 Ga0209968_1004793
688 Ga0209999_1000199
689 Ga0209971_1039920
690 Ga0209966_1095610
691 Ga0207428_10224196
692 Ga0207428_10448565
693 Ga0268265_10002880
694 Ga0268265_10585662
695 Ga0268264_10087060
696 Ga0265318_10095682
697 Ga0265332_10001239
698 Ga0265320_10105530
699 Ga0265331_10057088
700 Ga0265327_10004939
701 Ga0307408_100121315
702 Ga0307408_100161573
703 Ga0307408_100199436
704 Ga0265314_10004621
705 Ga0265314_10007107
706 Ga0265342_10032432
707 Ga0307405_10016807
708 Ga0307405_10140466
709 Ga0307405_10817539
710 Ga0307413_10009226
711 Ga0307413_10767836
712 Ga0307410_10120885
713 Ga0307410_10337426
714 Ga0307406_10067981
715 Ga0307406_10075378
716 Ga0307406_10559828
717 Ga0307407_10044948
718 Ga0307407_10339978
719 Ga0307407_10891510
720 Ga0307412_10103011
721 Ga0307412_11239196
722 Ga0307409_100018405
723 Ga0307409_100466543
724 Ga0307409_100543580
725 Ga0307409_101025484
726 Ga0307409_101175820
727 Ga0307416_100192716
728 Ga0307416_100195465
729 Ga0307416_100485622
730 Ga0307416_102444959
731 Ga0307414_10235338
732 Ga0307414_10796838
733 Ga0307411_10024316
734 Ga0307411_10080119
735 Ga0307411_10661875
736 Ga0307415_100100541
737 Ga0307415_100532183
738 Ga0307415_100587442
739 Ga0307415_100916360
740 Ga0373958_0019788
741 Ga0373959_0039042
742 Ga0373961_0009278
743 Ga0395899_0016397
744 Ga0395900_0024491
745 Ga0395905_0036928
746 Ga0395905_1424588
747 Ga0395901_0001770
748 Ga0436365_0349199
749 Ga0439433_0056841
750 Ga0439448_0144775
751 Ga0439455_0028530
752 Ga0439446_0021745
753 Ga0439434_0089043
754 Ga0451577_0000001
755 Ga0451577_0003185
756 Ga0451577_0587478
757 Ga0453683_0251784
758 Ga0466966_0001530
759 Ga0466961_0356294
760 Ga0453684_0000375
761 Ga0453684_0098653
762 Ga0453684_0175778
763 Ga0453684_0860503
764 Ga0466971_0196097
765 Ga0466959_0006514
766 Ga0466959_0083208
767 Ga0451576_0326485
768 Ga0466967_0364338
769 Ga0495662_0036669
770 Ga0496112_0002541
771 Ga0501031_0037526
772 Ga0501033_0192130
773 Ga0501036_0111057
774 Ga0501037_0210998
775 Ga0501039_0760516
776 Ga0501040_0009272
777 Ga0501041_0030218
778 Ga0501042_0017389
779 Ga0501046_0053213
780 Ga0501048_0028696
781 Ga0501072_0367608
782 Ga0501075_0088078
783 Ga0501075_0509928
784 Ga0501076_0046987
785 Ga0501079_0024530
786 Ga0501080_0199329
787 Ga0501273_042123
788 Ga0501035_0178644
789 Ga0501044_0180101
790 Ga0501045_0051094
791 nmdc:mga05p37_829061_c1
792 nmdc:mga05p37_87239_c1
793 nmdc:mga09592_474072_c1
794 nmdc:mga09592_526857_c1
795 nmdc:mga09592_558664_c1
796 nmdc:mga0qj67_130433_c1
797 nmdc:mga0qj67_15584_c1
798 nmdc:mga0qj67_22576_c1
799 nmdc:mga0qj67_967541_c1
800 nmdc:mga06r32_145939_c1
801 nmdc:mga06r32_275906_c1
802 nmdc:mga06r32_32023_c1
803 nmdc:mga06r32_6558_c1
804 nmdc:mga08y16_29521_c1
805 nmdc:mga08y16_40240_c1
806 nmdc:mga0n895_106035_c1
807 nmdc:mga0n895_847694_c1
808 nmdc:mga0rr50_274347_c1
809 nmdc:mga0a205_144052_c1
810 nmdc:mga0a205_228694_c1
811 Ga0501084_0138627
812 Ga0501082_0155959
813 Ga0501082_0322417
814 Ga0530510_1509493

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

27

98

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

106

181

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9716 9 171
487d-assembly1.cif.gz_J seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution 0.9704 8 170
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9621 9 172
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9601 9 171
487d-assembly1.cif.gz_J seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution 0.9589 8 170
ID Description Score Start End Superfamily
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9548 83 173 3.90.930.12
2awbG02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9531 83 171 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9499 83 168 3.90.930.12
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9486 1 82 3.90.930.12
4g5lH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9462 83 170 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A357CQG9-F1-model_v4 50S ribosomal protein L6 0.9911 51 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A358FVP3-F1-model_v4 50S ribosomal protein L6 0.9859 81 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-X1G5X1-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9845 82 154 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2J1D431-F1-model_v4 deleted 0.9828 73 168
AF-A0A448QXD1-F1-model_v4 deleted 0.982 76 172

Map