metagRoot

F436306

General Info

Members	Datasets	Scaffolds	Average Seq Length
406	289	336	209

Family's Representative Sequence

Representative Sequence	3300046516\|Ga0495628_0076460\|Ga0495628_0076460_1699_2427
Length	242
Sequence	MKLYHAPGSCSQAICIVLQETGLNADVVTVDARRHLLPDGTSYYDVSELGYVPLLELEDGTLLREGTVIAQYLADQSPESKLAPVHGSIERYRLLEWLNFLSTEIHKGFIPLLYAVAAGKWVDTARPKLESRFGWIDRQLNGQRFLMGDSFTIADAYLFALTGWGTASWMKSVYHANIDLGPYRHLQAWYQRIRDRPAVQRVLREDGLLDRLATPATNSLWRMSIFDHQLRRRCMSHLKELP

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
3	2510065045	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
4	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
5	2519103095	Burkholderia sp. KJ006	Isolate	Nodule
6	2576861471	Stenotrophomonas rhizophila DSM 14405	Isolate	Rhizosphere
7	2582581311	Burkholderia sp. WP42	Isolate	Rhizosphere
8	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
9	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
10	2599185240	Burkholderia sp. NFPP32	Isolate	Rhizoplane
11	2599185355	Burkholderia sp. NFACC33-1	Isolate	Rhizoplane
12	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
13	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
14	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
15	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
16	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
17	2643221645	Massilia sp. Root351	Isolate	Unclassified
18	2643221664	Massilia sp. Root418	Isolate	Unclassified
19	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
20	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
21	2675903129	Burkholderia pyrrocinia NFIX32	Isolate	Rhizoplane
22	2718217991	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
23	2721755523	Delftia sp. HK171	Isolate	Unclassified
24	2738541280	Massilia sp. GV090	Isolate	Unclassified
25	2738541300	Massilia sp. GV016	Isolate	Unclassified
26	2738543018	Massilia sp. GV045	Isolate	Unclassified
27	2738543030	Massilia sp. GV097	Isolate	Unclassified
28	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
29	2816332253	Burkholderia vietnamiensis HI2297	Isolate	Unclassified
30	2816332256	Burkholderia vietnamiensis MSMB608WGS	Isolate	Unclassified
31	2816332286	Burkholderia vietnamiensis HI2221	Isolate	Rhizosphere
32	2818991452	Burkholderia cepacia 561	Isolate	Unclassified
33	2839138175	Delftia acidovorans B15	Isolate	Rhizosphere
34	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
35	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
36	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
37	2852649853	Stenotrophomonas sp. JAI102	Isolate	Rhizosphere
38	2852684882	Xanthomonas sp. JAI131	Isolate	Rhizosphere
39	2863421361	Burkholderia cenocepacia CACua-24	Isolate	Rhizosphere
40	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
41	2881412998	Achromobacter aloeverae AVA-1	Isolate	Unclassified
42	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
43	2902330777	Methylobacterium sp. 2A	Isolate	Unclassified
44	2904479285	Comamonas sediminis 4487	Isolate	Rhizosphere
45	2904483920	Paraburkholderia caledonica 575	Isolate	Unclassified
46	2904504865	Serratia marcescens 1822	Isolate	Unclassified
47	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
48	2904564687	Burkholderia sp. 571	Isolate	Unclassified
49	2904571731	Burkholderia cenocepacia 574	Isolate	Unclassified
50	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
51	2919130084	Xanthomonas sp. 1678	Isolate	Rhizosphere
52	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
53	2919527303	Paraburkholderia strydomiana 3827	Isolate	Unclassified
54	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
55	2928170801	Burkholderia sp. 572	Isolate	Unclassified
56	2928536128	Burkholderia sola 565	Isolate	Unclassified
57	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
58	2929195423	Xanthomonas sp. R-73098 Hybrid assembly	Isolate	Unclassified
59	2984587000	Agrobacterium larrymoorei SORGH_AS974	Isolate	Aerial Root
60	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
61	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
62	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
63	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
64	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
65	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
66	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
67	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
68	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
69	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
70	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
71	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
72	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
73	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
74	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
75	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
76	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
77	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
78	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
79	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
80	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
81	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
82	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
83	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
84	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
85	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
86	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
87	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
88	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
89	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
90	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
91	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
92	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
93	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
94	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
95	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
96	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
97	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
98	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
99	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
100	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
101	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
102	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
103	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
104	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
105	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
106	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
107	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
108	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
109	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
110	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
111	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
112	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
113	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
114	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
115	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
116	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
117	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
118	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
119	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
120	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
121	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
122	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
125	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
126	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
128	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
131	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
132	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
133	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
135	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
136	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
137	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
138	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
140	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
142	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
144	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
145	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
148	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
149	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
150	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
162	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
165	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
167	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
168	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
169	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
170	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
171	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
172	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
173	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
174	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
175	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
176	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
177	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
178	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
179	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
180	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
181	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
182	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
183	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
184	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
185	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
186	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
187	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
188	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
189	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
190	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
191	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
192	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
193	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
194	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
195	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
196	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
197	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
198	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
199	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
200	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
201	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
202	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
203	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
204	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
205	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
206	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
207	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
208	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
209	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
210	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
211	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
212	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
213	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
214	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
215	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
216	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
217	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
218	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
219	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
220	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
221	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
222	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
223	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
224	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
225	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
226	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
227	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
228	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
229	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
230	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
231	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
232	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
233	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
234	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
235	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
236	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
237	3300049161	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
238	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
239	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
240	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
242	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
243	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
244	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
245	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
246	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
247	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
248	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
249	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
250	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
251	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
252	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
253	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
254	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
255	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
256	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
257	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
258	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
259	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
260	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
261	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
262	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
263	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
264	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
265	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
266	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
267	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
268	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
269	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
270	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
271	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
272	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
273	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
274	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
275	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
276	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
277	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
278	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
279	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
280	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
281	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
282	8020807995	Burkholderia sp. B10	Isolate	Rhizosphere
283	8020938398	Burkholderia sp. BE12	Isolate	Rhizosphere
284	8020945358	Burkholderia sp. BE17	Isolate	Rhizosphere
285	8020953355	Burkholderia sp. BE24	Isolate	Rhizosphere
286	8021120328	Burkholderia sp. LS-044	Isolate	Rhizosphere
287	8040167225	Burkholderia vietnamiensis RS1	Isolate	Unclassified
288	8040173305	Burkholderia vietnamiensis BE10	Isolate	Rhizosphere
289	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	82.51
Metatranscriptomes	0.25
Isolates	17.24

Biome Distribution

Category	Percentage (%)
Aerial Root	0.25
Bulb	0
Endosphere	26.85
Nodule	3.69
Rhizoplane	2.46
Rhizosphere	46.8
Stem	0
Stem Tuber	0
Unclassified	19.95

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1447860	2162886007	Bacteria	7303
2	SwRhRL2b_contig_2459773	2162886007	Bacteria	1543
3	JGI24740J21852_10000239	3300001979	Bacteria	23175
4	JGI25156J39149_1000001	3300002705	Bacteria	354557
5	JGI25156J39149_1000478	3300002705	Bacteria	24092
6	JGI25162J39368_1000112	3300002737	Bacteria	89231
7	JGI25162J39368_1000328	3300002737	Bacteria	41728
8	JGI25162J39368_1000568	3300002737	Bacteria	27099
9	JGI25154J39366_1000150	3300002738	Bacteria	54544
10	JGI25157J39369_1000044	3300002741	Bacteria	122466
11	JGI25152J39213_1001222	3300002773	Bacteria	11759
12	JGI25152J39213_1008643	3300002773	Bacteria	2506
13	JGI25152J39213_1011770	3300002773	Bacteria	1916
14	JGI25159J45721_1000153	3300002987	Bacteria	32127
15	JGI25151J46595_10000437	3300003187	Bacteria	41251
16	JGI25151J46595_10000593	3300003187	Bacteria	32127
17	JGI25151J46595_10005981	3300003187	Bacteria	6194
18	JGI25151J46595_10011170	3300003187	Bacteria	4137
19	JGI25165J46597_1000381	3300003214	Bacteria	48196
20	JGI25165J46597_1000543	3300003214	Bacteria	34671
21	JGI25165J46597_1000979	3300003214	Bacteria	19146
22	JGI25153J46596_10002256	3300003215	Bacteria	11226
23	JGI25153J46596_10020412	3300003215	Bacteria	2506
24	JGI25160J50197_1000334	3300003354	Bacteria	32127
25	Ga0055533_1000072	3300003756	Bacteria	144571
26	Ga0055532_1000013	3300003758	Bacteria	380677
27	Ga0055527_1000010	3300003760	Bacteria	380677
28	Ga0055535_1000010	3300003761	Bacteria	380677
29	Ga0055535_1000388	3300003761	Bacteria	41639
30	Ga0055542_1000016	3300003762	Bacteria	380677
31	Ga0055542_1000073	3300003762	Bacteria	145255
32	Ga0055529_1000012	3300003763	Bacteria	380677
33	Ga0055526_1000335	3300003771	Bacteria	38888
34	Ga0055537_1000435	3300003773	Bacteria	26845
35	Ga0055534_1000392	3300003784	Bacteria	27221
36	Ga0055528_1005065	3300003790	Bacteria	6221
37	Ga0058692_1000049	3300003856	Bacteria	108875
38	Ga0055543_1000426	3300004625	Bacteria	26136
39	Ga0065165_1001099	3300005262	Bacteria	32165
40	Ga0065704_10073285	3300005289	Bacteria	7346
41	Ga0065704_10073330	3300005289	Bacteria	7298
42	Ga0065704_10129992	3300005289	Bacteria	1636
43	Ga0070658_10347979	3300005327	Bacteria	1268
44	Ga0070670_100004373	3300005331	Bacteria	11827
45	Ga0070669_100103918	3300005353	Bacteria	2147
46	Ga0070667_100023838	3300005367	Bacteria	5081
47	Ga0070714_100384999	3300005435	Bacteria	1323
48	Ga0070681_10193561	3300005458	Bacteria	1953
49	Ga0070706_100001745	3300005467	Bacteria	22564
50	Ga0070707_100269482	3300005468	Bacteria	1655
51	Ga0070699_100888093	3300005518	Bacteria	816
52	Ga0070665_100985890	3300005548	Bacteria	855
53	Ga0068855_100055538	3300005563	Bacteria	4651
54	Ga0068863_100472616	3300005841	Bacteria	1232
55	Ga0075364_10058186	3300006051	Bacteria	2533
56	Ga0075367_10037394	3300006178	Bacteria	2820
57	Ga0075367_10193129	3300006178	Bacteria	1270
58	Ga0075369_10018284	3300006186	Bacteria	2852
59	Ga0075366_10123550	3300006195	Bacteria	1560
60	Ga0075366_10328028	3300006195	Bacteria	938
61	Ga0075370_10176981	3300006353	Bacteria	1255
62	Ga0075370_10518266	3300006353	Bacteria	720
63	Ga0079104_1000004	3300006946	Bacteria	444549
64	Ga0099826_10000043	3300006948	Bacteria	91959
65	Ga0105251_10001457	3300009011	Bacteria	20342
66	Ga0105250_10000001	3300009092	Bacteria	617357
67	Ga0105250_10008535	3300009092	Bacteria	4344
68	Ga0105240_10001578	3300009093	Bacteria	38665
69	Ga0105243_10000352	3300009148	Bacteria	49052
70	Ga0105243_10229894	3300009148	Bacteria	1645
71	Ga0105237_10377159	3300009545	Bacteria	1423
72	Ga0105246_10109999	3300011119	Bacteria	2023
73	Ga0157373_10090558	3300013100	Bacteria	2154
74	Ga0157371_10000136	3300013102	Bacteria	107554
75	Ga0157370_10345627	3300013104	Bacteria	1371
76	Ga0157369_10572380	3300013105	Bacteria	1167
77	Ga0163162_10359157	3300013306	Bacteria	1590
78	Ga0157375_10000161	3300013308	Bacteria	63104
79	Ga0157380_10007285	3300014326	Bacteria	7850
80	Ga0182008_10257078	3300014497	Unclassified	902
81	Ga0182005_1001601	3300015265	Bacteria	8866
82	Ga0163161_10015798	3300017792	Bacteria	5265
83	Ga0209435_100012	3300025206	Bacteria	401621
84	Ga0209566_100331	3300025225	Bacteria	42302
85	Ga0209674_100011	3300025226	Bacteria	997175
86	Ga0209674_100945	3300025226	Bacteria	9227
87	Ga0209672_100002	3300025228	Bacteria	1733325
88	Ga0209672_101562	3300025228	Bacteria	7817
89	Ga0209147_100003	3300025229	Bacteria	1733325
90	Ga0209147_100271	3300025229	Bacteria	46959
91	Ga0209563_102121	3300025230	Bacteria	4668
92	Ga0207427_100907	3300025231	Bacteria	12779
93	Ga0209437_100051	3300025233	Bacteria	392523
94	Ga0209437_100098	3300025233	Bacteria	229766
95	Ga0209258_100042	3300025242	Bacteria	380729
96	Ga0209258_100069	3300025242	Bacteria	280496
97	Ga0207425_1001406	3300025245	Bacteria	10113
98	Ga0207425_1005706	3300025245	Bacteria	3510
99	Ga0209646_1000026	3300025246	Bacteria	401621
100	Ga0209026_1000014	3300025250	Bacteria	401621
101	Ga0209026_1025295	3300025250	Bacteria	896
102	Ga0209148_1000006	3300025254	Bacteria	1733325
103	Ga0209148_1000076	3300025254	Bacteria	301449
104	Ga0209759_1000012	3300025256	Bacteria	401621
105	Ga0209759_1000051	3300025256	Bacteria	214016
106	Ga0209129_1000161	3300025258	Bacteria	102017
107	Ga0209129_1000244	3300025258	Bacteria	57688
108	Ga0209129_1000398	3300025258	Bacteria	34565
109	Ga0209233_1000033	3300025261	Bacteria	596094
110	Ga0209233_1000048	3300025261	Bacteria	453669
111	Ga0209233_1000069	3300025261	Bacteria	367639
112	Ga0209565_1000500	3300025263	Bacteria	28554
113	Ga0209565_1005358	3300025263	Bacteria	3739
114	Ga0209455_1000003	3300025272	Bacteria	1471893
115	Ga0209673_1000108	3300025273	Bacteria	183732
116	Ga0209673_1000512	3300025273	Bacteria	63988
117	Ga0209130_1000275	3300025284	Bacteria	63988
118	Ga0209675_1000547	3300025291	Bacteria	27468
119	Ga0209675_1024013	3300025291	Bacteria	1566
120	Ga0209676_1002495	3300025292	Bacteria	12901
121	Ga0209025_1000521	3300025294	Bacteria	73251
122	Ga0209025_1001040	3300025294	Bacteria	40746
123	Ga0209025_1003057	3300025294	Bacteria	16472
124	Ga0209025_1036073	3300025294	Bacteria	2222
125	Ga0209564_1000507	3300025295	Bacteria	63988
126	Ga0209564_1006397	3300025295	Bacteria	6366
127	Ga0209758_1000996	3300025297	Bacteria	37707
128	Ga0209758_1001154	3300025297	Bacteria	33798
129	Ga0209050_1028773	3300025298	Unclassified	1795
130	Ga0209256_1009838	3300025299	Bacteria	4113
131	Ga0209256_1040664	3300025299	Bacteria	1186
132	Ga0207426_1000713	3300025302	Bacteria	38754
133	Ga0209051_1014661	3300025303	Bacteria	3645
134	Ga0207713_1000414	3300025735	Bacteria	45438
135	Ga0207684_10010010	3300025910	Bacteria	8355
136	Ga0207695_10000305	3300025913	Bacteria	119810
137	Ga0207671_10293725	3300025914	Bacteria	1283
138	Ga0207650_10000774	3300025925	Bacteria	24596
139	Ga0207664_10136854	3300025929	Bacteria	2068
140	Ga0207709_10000138	3300025935	Bacteria	104006
141	Ga0207709_10002596	3300025935	Bacteria	11257
142	Ga0207679_10022035	3300025945	Bacteria	4332
143	Ga0207667_10044102	3300025949	Bacteria	4728
144	Ga0207668_10424642	3300025972	Bacteria	1129
145	Ga0207641_10338457	3300026088	Bacteria	1431
146	Ga0209281_1000005	3300027111	Bacteria	1242284
147	Ga0209371_1000152	3300027312	Bacteria	108927
148	Ga0209371_1000515	3300027312	Bacteria	36993
149	Ga0209970_1005609	3300027614	Bacteria	2069
150	Ga0209282_1000151	3300027666	Bacteria	40170
151	Ga0209974_10013465	3300027876	Bacteria	2724
152	Ga0268256_1000119	3300030500	Bacteria	114623
153	Ga0268256_1000127	3300030500	Bacteria	108927
154	Ga0307408_100005430	3300031548	Bacteria	8535
155	Ga0307408_100280976	3300031548	Unclassified	1386
156	Ga0307405_10012006	3300031731	Bacteria	4565
157	Ga0307405_10265587	3300031731	Bacteria	1284
158	Ga0307413_10028050	3300031824	Bacteria	3129
159	Ga0307410_10054383	3300031852	Bacteria	2713
160	Ga0307406_10140564	3300031901	Bacteria	1708
161	Ga0307406_10299767	3300031901	Unclassified	1234
162	Ga0307412_10279400	3300031911	Bacteria	1310
163	Ga0307412_10288082	3300031911	Bacteria	1292
164	Ga0307409_100004689	3300031995	Bacteria	7736
165	Ga0307409_100285775	3300031995	Bacteria	1527
166	Ga0307416_100050607	3300032002	Bacteria	3312
167	Ga0307416_100093724	3300032002	Bacteria	2588
168	Ga0307414_10370487	3300032004	Bacteria	1235
169	Ga0307414_10535607	3300032004	Bacteria	1041
170	Ga0307411_10038614	3300032005	Bacteria	3013
171	Ga0307411_10431571	3300032005	Bacteria	1097
172	Ga0307415_100001787	3300032126	Bacteria	10529
173	Ga0307415_100193252	3300032126	Unclassified	1608
174	Ga0451841_1019455	3300041498	Bacteria	925
175	Ga0439441_060235	3300042001	Bacteria	798
176	Ga0450896_001688	3300042133	Bacteria	2766
177	Ga0450902_001163	3300042137	Bacteria	3517
178	Ga0450902_009994	3300042137	Bacteria	1499
179	Ga0450903_011224	3300042138	Bacteria	1445
180	Ga0439435_0001567	3300042436	Bacteria	4279
181	Ga0450918_047744	3300042531	Unclassified	776
182	Ga0495627_029484	3300046453	Bacteria	1746
183	Ga0495603_0012456	3300046455	Bacteria	5148
184	Ga0495638_0057763	3300046460	Bacteria	2406
185	Ga0495653_0300809	3300046463	Bacteria	1046
186	Ga0495580_0040294	3300046472	Bacteria	3337
187	Ga0495605_0004035	3300046474	Bacteria	8668
188	Ga0495584_0010563	3300046491	Bacteria	4742
189	Ga0495585_0000056	3300046492	Bacteria	113739
190	Ga0495585_0012913	3300046492	Bacteria	4908
191	Ga0495607_0002936	3300046501	Bacteria	13412
192	Ga0495583_0025131	3300046506	Bacteria	2980
193	Ga0495606_0002164	3300046507	Bacteria	23646
194	Ga0495606_0100149	3300046507	Bacteria	1766
195	Ga0495610_0012911	3300046512	Bacteria	4995
196	Ga0495628_0076460	3300046516	Bacteria	2605
197	Ga0495630_0033709	3300046517	Bacteria	3820
198	Ga0495643_0022814	3300046522	Bacteria	3564
199	Ga0495643_0110762	3300046522	Bacteria	1396
200	Ga0495648_0000392	3300046524	Bacteria	47998
201	Ga0495642_0145181	3300046528	Bacteria	1025
202	Ga0495652_0419177	3300046529	Bacteria	944
203	Ga0495654_0039357	3300046530	Bacteria	2361
204	Ga0495654_0072162	3300046530	Bacteria	1635
205	Ga0495597_0004268	3300046542	Bacteria	7904
206	Ga0495597_0005400	3300046542	Bacteria	6768
207	Ga0495645_0116415	3300046543	Bacteria	1886
208	Ga0495622_0016557	3300046557	Bacteria	3435
209	Ga0495633_0030540	3300046558	Bacteria	2617
210	Ga0495668_0160999	3300046616	Bacteria	1229
211	Ga0495668_0421736	3300046616	Bacteria	734
212	Ga0495625_0004405	3300046660	Bacteria	13347
213	Ga0495625_0035292	3300046660	Bacteria	3687
214	Ga0495659_0000019	3300046664	Bacteria	74610
215	Ga0495661_0050812	3300046665	Bacteria	2507
216	Ga0495661_0130162	3300046665	Bacteria	1380
217	Ga0495588_0007915	3300046674	Bacteria	4857
218	Ga0495671_0002991	3300046692	Bacteria	10505
219	Ga0495671_0094377	3300046692	Bacteria	1464
220	Ga0495649_0037766	3300046694	Bacteria	2651
221	Ga0495649_0104879	3300046694	Bacteria	1501
222	Ga0495660_0066154	3300046810	Bacteria	1928
223	Ga0495660_0079187	3300046810	Bacteria	1726
224	Ga0495674_0004325	3300047319	Bacteria	13662
225	Ga0495674_0261393	3300047319	Bacteria	1422
226	Ga0495672_0000756	3300047320	Bacteria	35362
227	Ga0495672_0011632	3300047320	Bacteria	6197
228	Ga0495683_0011688	3300047323	Bacteria	4618
229	Ga0495687_011542	3300047443	Bacteria	4741
230	Ga0495675_0042974	3300047444	Bacteria	2879
231	Ga0495675_0301653	3300047444	Bacteria	951
232	Ga0495673_0002431	3300047469	Bacteria	13117
233	Ga0495602_0014273	3300048088	Bacteria	8069
234	Ga0495614_0096801	3300048089	Bacteria	1287
235	Ga0496106_0000038	3300048909	Bacteria	111983
236	Ga0496106_0000659	3300048909	Bacteria	24702
237	Ga0496110_0231679	3300048913	Bacteria	1680
238	Ga0496116_0086721	3300048919	Bacteria	1919
239	Ga0496117_0000033	3300048920	Bacteria	345605
240	Ga0496117_0000766	3300048920	Bacteria	50647
241	Ga0496118_0011386	3300048921	Bacteria	8687
242	Ga0496118_0017020	3300048921	Bacteria	6638
243	Ga0496118_0069231	3300048921	Bacteria	2557
244	Ga0496119_0003641	3300048922	Bacteria	15824
245	Ga0496119_0026708	3300048922	Bacteria	3993
246	Ga0496120_0001433	3300048923	Bacteria	28743
247	Ga0496120_0081214	3300048923	Bacteria	1755
248	Ga0496121_0000001	3300048924	Bacteria	1830318
249	Ga0496121_0005561	3300048924	Bacteria	16097
250	Ga0496121_0051150	3300048924	Bacteria	3482
251	Ga0496121_0057155	3300048924	Bacteria	3235
252	Ga0496122_0001314	3300048925	Bacteria	40765
253	Ga0496122_0003613	3300048925	Bacteria	20138
254	Ga0496122_0010164	3300048925	Bacteria	9753
255	Ga0496122_0025224	3300048925	Bacteria	5171
256	Ga0496122_0046644	3300048925	Bacteria	3353
257	Ga0496122_0090599	3300048925	Bacteria	2086
258	Ga0496122_0138667	3300048925	Bacteria	1526
259	Ga0496123_0001741	3300048926	Bacteria	28741
260	Ga0496123_0006891	3300048926	Bacteria	10876
261	Ga0496123_0039480	3300048926	Bacteria	3301
262	Ga0496123_0097360	3300048926	Bacteria	1724
263	Ga0496123_0161802	3300048926	Bacteria	1192
264	Ga0496124_0012623	3300048927	Bacteria	8314
265	Ga0496124_0023501	3300048927	Bacteria	5625
266	Ga0496124_0025859	3300048927	Bacteria	5305
267	Ga0496124_0076855	3300048927	Bacteria	2755
268	Ga0496124_0086300	3300048927	Bacteria	2569
269	Ga0496124_0172931	3300048927	Bacteria	1670
270	Ga0496124_0181404	3300048927	Bacteria	1619
271	Ga0496124_0390168	3300048927	Bacteria	970
272	Ga0496125_0000001	3300048928	Bacteria	1766138
273	Ga0496125_0000135	3300048928	Bacteria	160987
274	Ga0496125_0101926	3300048928	Bacteria	2111
275	Ga0496125_0273565	3300048928	Bacteria	1051
276	Ga0496125_0329983	3300048928	Bacteria	920
277	Ga0496126_0033260	3300048929	Bacteria	4851
278	Ga0496126_0097832	3300048929	Bacteria	2571
279	Ga0501305_024180	3300049161	Bacteria	914
280	Ga0495678_002806	3300049459	Bacteria	11316
281	Ga0495682_0012117	3300049460	Bacteria	3312
282	Ga0495682_0086255	3300049460	Bacteria	1128
283	Ga0501033_0459683	3300049570	Bacteria	883
284	Ga0501036_0027402	3300049572	Bacteria	4815
285	Ga0501037_0293628	3300049573	Bacteria	1130
286	Ga0501038_0101439	3300049574	Bacteria	2396
287	Ga0501039_0180379	3300049575	Bacteria	1661
288	Ga0501039_0677873	3300049575	Bacteria	807
289	Ga0501040_0012978	3300049576	Bacteria	5477
290	Ga0501040_0304362	3300049576	Bacteria	1140
291	Ga0501041_0035095	3300049577	Bacteria	3038
292	Ga0501041_0234439	3300049577	Bacteria	1153
293	Ga0501048_0148724	3300049582	Bacteria	1656
294	Ga0501048_0558574	3300049582	Bacteria	821
295	Ga0501072_0005305	3300049588	Bacteria	9816
296	Ga0501075_0100174	3300049591	Bacteria	2200
297	Ga0501075_0832036	3300049591	Bacteria	702
298	Ga0501076_0004572	3300049592	Bacteria	9850
299	Ga0501076_0266884	3300049592	Bacteria	1401
300	Ga0501077_0066680	3300049593	Bacteria	2283
301	Ga0501079_0479404	3300049741	Bacteria	978
302	Ga0501080_0122886	3300049742	Bacteria	2405
303	Ga0501081_0238227	3300049743	Bacteria	1326
304	Ga0501083_0060098	3300049744	Bacteria	2540
305	Ga0501035_0783202	3300049822	Bacteria	763
306	Ga0501035_0834627	3300049822	Bacteria	734
307	Ga0501045_0003295	3300049824	Bacteria	11029
308	nmdc:mga03683_823_c1	3300050489	Bacteria	8896
309	nmdc:mga00v17_336882_c1	3300050491	Bacteria	981
310	nmdc:mga00v17_49928_c1	3300050491	Bacteria	2540
311	nmdc:mga0k408_310841_c1	3300050493	Bacteria	941
312	nmdc:mga0k408_86066_c1	3300050493	Bacteria	1845
313	nmdc:mga06z11_91783_c1	3300050494	Bacteria	1650
314	nmdc:mga0sz30_223159_c1	3300050516	Bacteria	838
315	nmdc:mga0sz30_770_c1	3300050516	Bacteria	11699
316	Ga0500651_0007277	3300053093	Bacteria	6456
317	Ga0500651_0111289	3300053093	Bacteria	1671
318	Ga0500566_0001198	3300053094	Bacteria	15145
319	Ga0500562_000692	3300053108	Bacteria	8229
320	Ga0500618_014722	3300053125	Bacteria	1991
321	Ga0500658_0013169	3300053134	Bacteria	3054
322	Ga0500561_0001933	3300053137	Bacteria	3427
323	Ga0500568_0023215	3300053139	Bacteria	2640
324	Ga0500603_001880	3300053150	Bacteria	4685
325	Ga0500622_0000367	3300053156	Bacteria	43429
326	Ga0500624_002622	3300053157	Bacteria	2410
327	Ga0500634_0000911	3300053161	Bacteria	10587
328	Ga0500634_0015808	3300053161	Bacteria	4014
329	Ga0500634_0050893	3300053161	Bacteria	2230
330	Ga0500638_222097	3300053162	Bacteria	783
331	Ga0500636_0047631	3300053177	Bacteria	2525
332	Ga0500636_0088865	3300053177	Bacteria	1771
333	Ga0501084_0268822	3300054114	Bacteria	1439
334	Ga0501082_0082551	3300060353	Bacteria	2773
335	Ga0501082_0321624	3300060353	Bacteria	1348
336	Ga0530510_0191112	3300061734	Bacteria	1520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005367	Ga0070667_100023838	Ga0070667_1000238386	194
2	3300005435	Ga0070714_100384999	Ga0070714_1003849992	194
3	3300005841	Ga0068863_100472616	Ga0068863_1004726162	194
4	3300006353	Ga0075370_10176981	Ga0075370_101769812	194
5	3300006353	Ga0075370_10518266	Ga0075370_105182662	194
6	3300025929	Ga0207664_10136854	Ga0207664_101368542	194
7	3300026088	Ga0207641_10338457	Ga0207641_103384572	194
8	3300031548	Ga0307408_100280976	Ga0307408_1002809762	194
9	3300031901	Ga0307406_10299767	Ga0307406_102997671	194
10	3300031911	Ga0307412_10288082	Ga0307412_102880822	194
11	3300031995	Ga0307409_100285775	Ga0307409_1002857751	194
12	3300032002	Ga0307416_100093724	Ga0307416_1000937243	194
13	3300032004	Ga0307414_10535607	Ga0307414_105356072	194
14	3300032126	Ga0307415_100193252	Ga0307415_1001932522	194
15	3300046460	Ga0495638_0057763	Ga0495638_0057763_742_1326	194
16	3300046530	Ga0495654_0039357	Ga0495654_0039357_379_963	194
17	3300046616	Ga0495668_0160999	Ga0495668_0160999_233_856	194
18	3300046660	Ga0495625_0035292	Ga0495625_0035292_2126_2710	194
19	3300053108	Ga0500562_000692	Ga0500562_000692_914_1498	194
20	3300048088	Ga0495602_0014273	Ga0495602_0014273_5442_6077	195
21	3300046463	Ga0495653_0300809	Ga0495653_0300809_191_919	196
22	3300047319	Ga0495674_0261393	Ga0495674_0261393_558_1286	196
23	3300013308	Ga0157375_10000161	Ga0157375_1000016134	197
24	3300046491	Ga0495584_0010563	Ga0495584_0010563_239_859	197
25	3300046674	Ga0495588_0007915	Ga0495588_0007915_910_1527	197
26	3300048089	Ga0495614_0096801	Ga0495614_0096801_573_1190	197
27	3300053161	Ga0500634_0000911	Ga0500634_0000911_2580_3197	197
28	iso_pu_bacteria	2904479285	2904481357	197
29	iso_pu_bacteria	2904504865	2904504953	197
30	3300005458	Ga0070681_10193561	Ga0070681_101935612	198
31	3300005563	Ga0068855_100055538	Ga0068855_1000555383	198
32	3300025949	Ga0207667_10044102	Ga0207667_100441025	198
33	3300046543	Ga0495645_0116415	Ga0495645_0116415_210_809	198
34	3300049161	Ga0501305_024180	Ga0501305_024180_124_732	198
35	3300049744	Ga0501083_0060098	Ga0501083_0060098_1851_2450	198
36	3300002737	JGI25162J39368_1000112	JGI25162J39368_10001127	201
37	3300005467	Ga0070706_100001745	Ga0070706_10000174521	201
38	3300005468	Ga0070707_100269482	Ga0070707_1002694822	201
39	3300005518	Ga0070699_100888093	Ga0070699_1008880931	201
40	3300006178	Ga0075367_10193129	Ga0075367_101931292	201
41	3300006195	Ga0075366_10328028	Ga0075366_103280282	201
42	3300009092	Ga0105250_10000001	Ga0105250_10000001506	201
43	3300013104	Ga0157370_10345627	Ga0157370_103456272	201
44	3300014326	Ga0157380_10007285	Ga0157380_100072854	201
45	3300025910	Ga0207684_10010010	Ga0207684_100100102	201
46	3300027614	Ga0209970_1005609	Ga0209970_10056092	201
47	3300027876	Ga0209974_10013465	Ga0209974_100134653	201
48	3300031548	Ga0307408_100005430	Ga0307408_1000054307	201
49	3300031731	Ga0307405_10012006	Ga0307405_100120062	201
50	3300031731	Ga0307405_10265587	Ga0307405_102655872	201
51	3300031824	Ga0307413_10028050	Ga0307413_100280502	201
52	3300031852	Ga0307410_10054383	Ga0307410_100543831	201
53	3300031901	Ga0307406_10140564	Ga0307406_101405642	201
54	3300031995	Ga0307409_100004689	Ga0307409_1000046892	201
55	3300032002	Ga0307416_100050607	Ga0307416_1000506072	201
56	3300032004	Ga0307414_10370487	Ga0307414_103704872	201
57	3300032005	Ga0307411_10038614	Ga0307411_100386142	201
58	3300032005	Ga0307411_10431571	Ga0307411_104315712	201
59	3300032126	Ga0307415_100001787	Ga0307415_1000017879	201
60	3300042001	Ga0439441_060235	Ga0439441_060235_22_645	201
61	3300042133	Ga0450896_001688	Ga0450896_001688_624_1247	201
62	3300042436	Ga0439435_0001567	Ga0439435_0001567_1503_2126	201
63	3300042531	Ga0450918_047744	Ga0450918_047744_51_674	201
64	3300049570	Ga0501033_0459683	Ga0501033_0459683_233_841	201
65	3300049572	Ga0501036_0027402	Ga0501036_0027402_2138_2746	201
66	3300049573	Ga0501037_0293628	Ga0501037_0293628_455_1063	201
67	3300049574	Ga0501038_0101439	Ga0501038_0101439_1002_1610	201
68	3300049575	Ga0501039_0180379	Ga0501039_0180379_489_1112	201
69	3300049575	Ga0501039_0677873	Ga0501039_0677873_65_688	201
70	3300049576	Ga0501040_0012978	Ga0501040_0012978_2735_3343	201
71	3300049576	Ga0501040_0304362	Ga0501040_0304362_95_718	201
72	3300049577	Ga0501041_0035095	Ga0501041_0035095_370_978	201
73	3300049577	Ga0501041_0234439	Ga0501041_0234439_469_1092	201
74	3300049582	Ga0501048_0148724	Ga0501048_0148724_982_1590	201
75	3300049582	Ga0501048_0558574	Ga0501048_0558574_105_728	201
76	3300049588	Ga0501072_0005305	Ga0501072_0005305_2738_3346	201
77	3300049591	Ga0501075_0100174	Ga0501075_0100174_672_1280	201
78	3300049591	Ga0501075_0832036	Ga0501075_0832036_67_675	201
79	3300049592	Ga0501076_0004572	Ga0501076_0004572_5093_5701	201
80	3300049592	Ga0501076_0266884	Ga0501076_0266884_394_1002	201
81	3300049593	Ga0501077_0066680	Ga0501077_0066680_77_685	201
82	3300049741	Ga0501079_0479404	Ga0501079_0479404_36_674	201
83	3300049742	Ga0501080_0122886	Ga0501080_0122886_42_650	201
84	3300049743	Ga0501081_0238227	Ga0501081_0238227_292_900	201
85	3300049822	Ga0501035_0783202	Ga0501035_0783202_95_718	201
86	3300049822	Ga0501035_0834627	Ga0501035_0834627_97_705	201
87	3300049824	Ga0501045_0003295	Ga0501045_0003295_7366_7974	201
88	3300050493	nmdc:mga0k408_310841_c1	nmdc:mga0k408_310841_c1_309_920	201
89	3300050516	nmdc:mga0sz30_223159_c1	nmdc:mga0sz30_223159_c1_141_749	201
90	3300053094	Ga0500566_0001198	Ga0500566_0001198_7825_8532	201
91	3300053150	Ga0500603_001880	Ga0500603_001880_2481_3188	201
92	3300054114	Ga0501084_0268822	Ga0501084_0268822_483_1091	201
93	3300060353	Ga0501082_0082551	Ga0501082_0082551_204_812	201
94	3300060353	Ga0501082_0321624	Ga0501082_0321624_402_1025	201
95	3300061734	Ga0530510_0191112	Ga0530510_0191112_32_640	201
96	iso_pu_bacteria	2510065045	2510247967	203
97	iso_pu_bacteria	2718217991	2719643601	203
98	3300002773	JGI25152J39213_1001222	JGI25152J39213_100122212	204
99	3300002987	JGI25159J45721_1000153	JGI25159J45721_100015323	204
100	3300003187	JGI25151J46595_10000593	JGI25151J46595_1000059323	204
101	3300003215	JGI25153J46596_10002256	JGI25153J46596_1000225616	204
102	3300003354	JGI25160J50197_1000334	JGI25160J50197_100033423	204
103	3300003771	Ga0055526_1000335	Ga0055526_100033522	204
104	3300003773	Ga0055537_1000435	Ga0055537_100043523	204
105	3300003784	Ga0055534_1000392	Ga0055534_10003928	204
106	3300004625	Ga0055543_1000426	Ga0055543_10004265	204
107	3300005262	Ga0065165_1001099	Ga0065165_100109916	204
108	3300025245	Ga0207425_1001406	Ga0207425_10014062	204
109	3300025245	Ga0207425_1005706	Ga0207425_10057064	204
110	3300025258	Ga0209129_1000398	Ga0209129_100039819	204
111	3300025263	Ga0209565_1000500	Ga0209565_100050022	204
112	3300025273	Ga0209673_1000512	Ga0209673_100051222	204
113	3300025284	Ga0209130_1000275	Ga0209130_100027545	204
114	3300025291	Ga0209675_1000547	Ga0209675_100054722	204
115	3300025292	Ga0209676_1002495	Ga0209676_100249512	204
116	3300025294	Ga0209025_1001040	Ga0209025_100104023	204
117	3300025295	Ga0209564_1000507	Ga0209564_100050745	204
118	3300025297	Ga0209758_1000996	Ga0209758_100099620	204
119	3300025298	Ga0209050_1028773	Ga0209050_10287732	204
120	3300025299	Ga0209256_1009838	Ga0209256_10098386	204
121	3300025302	Ga0207426_1000713	Ga0207426_100071322	204
122	3300025945	Ga0207679_10022035	Ga0207679_100220354	204
123	3300046616	Ga0495668_0421736	Ga0495668_0421736_64_684	204
124	3300048909	Ga0496106_0000038	Ga0496106_0000038_24509_25129	204
125	3300053093	Ga0500651_0111289	Ga0500651_0111289_155_775	204
126	3300053125	Ga0500618_014722	Ga0500618_014722_602_1222	204
127	3300053134	Ga0500658_0013169	Ga0500658_0013169_1708_2328	204
128	3300053139	Ga0500568_0023215	Ga0500568_0023215_1239_1859	204
129	3300053177	Ga0500636_0047631	Ga0500636_0047631_1397_2017	204
130	iso_pu_bacteria	2508501125	2509127358	205
131	iso_pu_bacteria	2510917030	2511196022	205
132	iso_pu_bacteria	2519103095	2519460898	205
133	iso_pu_bacteria	2576861471	2578458063	205
134	iso_pu_bacteria	2582581311	2585293547	205
135	iso_pu_bacteria	2582581316	2585331519	205
136	iso_pu_bacteria	2599185239	2599736008	205
137	iso_pu_bacteria	2599185240	2599743854	205
138	iso_pu_bacteria	2599185355	2600207079	205
139	iso_pu_bacteria	2600255279	2601611902	205
140	iso_pu_bacteria	2600255308	2601748605	205
141	iso_pu_bacteria	2615840698	2616554182	205
142	iso_pu_bacteria	2643221599	2644003226	205
143	iso_pu_bacteria	2643221645	2644251633	205
144	iso_pu_bacteria	2643221664	2644358188	205
145	iso_pu_bacteria	2643221693	2644520490	205
146	iso_pu_bacteria	2675903129	2676742362	205
147	iso_pu_bacteria	2721755523	2722884279	205
148	iso_pu_bacteria	2738541280	2738742462	205
149	iso_pu_bacteria	2738541300	2738845425	205
150	iso_pu_bacteria	2738543018	2739276478	205
151	iso_pu_bacteria	2738543030	2739345522	205
152	iso_pu_bacteria	2775507266	2778175374	205
153	iso_pu_bacteria	2816332253	2817259251	205
154	iso_pu_bacteria	2816332256	2817280339	205
155	iso_pu_bacteria	2816332286	2817456563	205
156	iso_pu_bacteria	2818991452	2819629943	205
157	iso_pu_bacteria	2839138175	2839140443	205
158	iso_pu_bacteria	2842482326	2842484603	205
159	iso_pu_bacteria	2852649853	2852650487	205
160	iso_pu_bacteria	2852684882	2852688029	205
161	iso_pu_bacteria	2863421361	2863423277	205
162	iso_pu_bacteria	2870068957	2870074426	205
163	iso_pu_bacteria	2881412998	2881417785	205
164	iso_pu_bacteria	2899845264	2899846311	205
165	iso_pu_bacteria	2902330777	2902332735	205
166	iso_pu_bacteria	2904483920	2904486031	205
167	iso_pu_bacteria	2904541872	2904545994	205
168	iso_pu_bacteria	2904564687	2904568012	205
169	iso_pu_bacteria	2904571731	2904575262	205
170	iso_pu_bacteria	2919100787	2919106466	205
171	iso_pu_bacteria	2919130084	2919132909	205
172	iso_pu_bacteria	2919527303	2919527376	205
173	iso_pu_bacteria	2926760298	2926765077	205
174	iso_pu_bacteria	2928170801	2928174088	205
175	iso_pu_bacteria	2928536128	2928536775	205
176	iso_pu_bacteria	2929160207	2929161188	205
177	iso_pu_bacteria	2929195423	2929199453	205
178	iso_pu_bacteria	2984587000	2984590604	205
179	iso_pu_bacteria	3005416602	3005419516	205
180	iso_pu_bacteria	8003570095	8003573562	205
181	iso_pu_bacteria	8005314921	8005316807	205
182	iso_pu_bacteria	8005484373	8005485387	205
183	iso_pu_bacteria	8020807995	8020808062	205
184	iso_pu_bacteria	8020938398	8020943155	205
185	iso_pu_bacteria	8020945358	8020949570	205
186	iso_pu_bacteria	8020953355	8020957513	205
187	iso_pu_bacteria	8021120328	8021126342	205
188	iso_pu_bacteria	8040167225	8040171353	205
189	iso_pu_bacteria	8040173305	8040178884	205
190	iso_pu_bacteria	8055431914	8055434683	205
191	2162886007	SwRhRL2b_contig_2459773	SwRhRL2b_0488.00002890	208
192	3300003187	JGI25151J46595_10000437	JGI25151J46595_1000043739	208
193	3300005289	Ga0065704_10073330	Ga0065704_100733308	208
194	3300048925	Ga0496122_0003613	Ga0496122_0003613_8583_9212	208
195	3300048926	Ga0496123_0006891	Ga0496123_0006891_7228_7857	208
196	3300048928	Ga0496125_0000135	Ga0496125_0000135_132041_132670	208
197	2162886007	SwRhRL2b_contig_1447860	SwRhRL2b_0984.00005100	209
198	3300001979	JGI24740J21852_10000239	JGI24740J21852_1000023918	209
199	3300002705	JGI25156J39149_1000001	JGI25156J39149_100000182	209
200	3300002705	JGI25156J39149_1000478	JGI25156J39149_100047820	209
201	3300002737	JGI25162J39368_1000328	JGI25162J39368_100032832	209
202	3300002737	JGI25162J39368_1000568	JGI25162J39368_100056829	209
203	3300002738	JGI25154J39366_1000150	JGI25154J39366_100015017	209
204	3300002741	JGI25157J39369_1000044	JGI25157J39369_100004482	209
205	3300002773	JGI25152J39213_1008643	JGI25152J39213_10086432	209
206	3300002773	JGI25152J39213_1011770	JGI25152J39213_10117702	209
207	3300003187	JGI25151J46595_10005981	JGI25151J46595_100059814	209
208	3300003187	JGI25151J46595_10011170	JGI25151J46595_100111702	209
209	3300003214	JGI25165J46597_1000381	JGI25165J46597_100038117	209
210	3300003214	JGI25165J46597_1000543	JGI25165J46597_100054314	209
211	3300003214	JGI25165J46597_1000979	JGI25165J46597_100097918	209
212	3300003215	JGI25153J46596_10020412	JGI25153J46596_100204122	209
213	3300003756	Ga0055533_1000072	Ga0055533_1000072142	209
214	3300003758	Ga0055532_1000013	Ga0055532_100001378	209
215	3300003760	Ga0055527_1000010	Ga0055527_1000010290	209
216	3300003761	Ga0055535_1000010	Ga0055535_100001078	209
217	3300003761	Ga0055535_1000388	Ga0055535_10003886	209
218	3300003762	Ga0055542_1000016	Ga0055542_100001678	209
219	3300003762	Ga0055542_1000073	Ga0055542_1000073120	209
220	3300003763	Ga0055529_1000012	Ga0055529_100001278	209
221	3300003790	Ga0055528_1005065	Ga0055528_10050653	209
222	3300003856	Ga0058692_1000049	Ga0058692_100004982	209
223	3300005289	Ga0065704_10073285	Ga0065704_100732852	209
224	3300005289	Ga0065704_10129992	Ga0065704_101299922	209
225	3300005327	Ga0070658_10347979	Ga0070658_103479792	209
226	3300005331	Ga0070670_100004373	Ga0070670_1000043732	209
227	3300005353	Ga0070669_100103918	Ga0070669_1001039182	209
228	3300005548	Ga0070665_100985890	Ga0070665_1009858902	209
229	3300006051	Ga0075364_10058186	Ga0075364_100581862	209
230	3300006178	Ga0075367_10037394	Ga0075367_100373943	209
231	3300006186	Ga0075369_10018284	Ga0075369_100182841	209
232	3300006195	Ga0075366_10123550	Ga0075366_101235503	209
233	3300006946	Ga0079104_1000004	Ga0079104_1000004317	209
234	3300006948	Ga0099826_10000043	Ga0099826_1000004370	209
235	3300009011	Ga0105251_10001457	Ga0105251_1000145710	209
236	3300009092	Ga0105250_10008535	Ga0105250_100085354	209
237	3300009093	Ga0105240_10001578	Ga0105240_1000157832	209
238	3300009148	Ga0105243_10000352	Ga0105243_1000035223	209
239	3300009148	Ga0105243_10229894	Ga0105243_102298942	209
240	3300009545	Ga0105237_10377159	Ga0105237_103771591	209
241	3300011119	Ga0105246_10109999	Ga0105246_101099992	209
242	3300013100	Ga0157373_10090558	Ga0157373_100905582	209
243	3300013102	Ga0157371_10000136	Ga0157371_100001364	209
244	3300013105	Ga0157369_10572380	Ga0157369_105723802	209
245	3300013306	Ga0163162_10359157	Ga0163162_103591572	209
246	3300014497	Ga0182008_10257078	Ga0182008_102570781	209
247	3300015265	Ga0182005_1001601	Ga0182005_10016016	209
248	3300017792	Ga0163161_10015798	Ga0163161_100157984	209
249	3300025206	Ga0209435_100012	Ga0209435_100012302	209
250	3300025225	Ga0209566_100331	Ga0209566_10033145	209
251	3300025226	Ga0209674_100011	Ga0209674_100011292	209
252	3300025226	Ga0209674_100945	Ga0209674_1009455	209
253	3300025228	Ga0209672_100002	Ga0209672_100002284	209
254	3300025228	Ga0209672_101562	Ga0209672_1015622	209
255	3300025229	Ga0209147_100003	Ga0209147_100003284	209
256	3300025229	Ga0209147_100271	Ga0209147_10027112	209
257	3300025230	Ga0209563_102121	Ga0209563_1021213	209
258	3300025231	Ga0207427_100907	Ga0207427_1009074	209
259	3300025233	Ga0209437_100051	Ga0209437_100051372	209
260	3300025233	Ga0209437_100098	Ga0209437_100098213	209
261	3300025242	Ga0209258_100042	Ga0209258_10004276	209
262	3300025242	Ga0209258_100069	Ga0209258_100069219	209
263	3300025246	Ga0209646_1000026	Ga0209646_1000026302	209
264	3300025250	Ga0209026_1000014	Ga0209026_1000014302	209
265	3300025250	Ga0209026_1025295	Ga0209026_10252951	209
266	3300025254	Ga0209148_1000006	Ga0209148_1000006284	209
267	3300025254	Ga0209148_1000076	Ga0209148_100007636	209
268	3300025256	Ga0209759_1000012	Ga0209759_1000012302	209
269	3300025256	Ga0209759_1000051	Ga0209759_100005131	209
270	3300025258	Ga0209129_1000161	Ga0209129_100016197	209
271	3300025258	Ga0209129_1000244	Ga0209129_100024468	209
272	3300025261	Ga0209233_1000033	Ga0209233_1000033260	209
273	3300025261	Ga0209233_1000048	Ga0209233_1000048418	209
274	3300025261	Ga0209233_1000069	Ga0209233_100006931	209
275	3300025263	Ga0209565_1005358	Ga0209565_10053584	209
276	3300025272	Ga0209455_1000003	Ga0209455_1000003284	209
277	3300025273	Ga0209673_1000108	Ga0209673_100010834	209
278	3300025291	Ga0209675_1024013	Ga0209675_10240132	209
279	3300025294	Ga0209025_1000521	Ga0209025_100052115	209
280	3300025294	Ga0209025_1003057	Ga0209025_100305715	209
281	3300025294	Ga0209025_1036073	Ga0209025_10360733	209
282	3300025295	Ga0209564_1006397	Ga0209564_10063973	209
283	3300025297	Ga0209758_1001154	Ga0209758_100115415	209
284	3300025299	Ga0209256_1040664	Ga0209256_10406641	209
285	3300025303	Ga0209051_1014661	Ga0209051_10146612	209
286	3300025735	Ga0207713_1000414	Ga0207713_100041421	209
287	3300025913	Ga0207695_10000305	Ga0207695_1000030532	209
288	3300025914	Ga0207671_10293725	Ga0207671_102937251	209
289	3300025925	Ga0207650_10000774	Ga0207650_1000077413	209
290	3300025935	Ga0207709_10000138	Ga0207709_1000013878	209
291	3300025935	Ga0207709_10002596	Ga0207709_1000259610	209
292	3300025972	Ga0207668_10424642	Ga0207668_104246422	209
293	3300027111	Ga0209281_1000005	Ga0209281_1000005523	209
294	3300027312	Ga0209371_1000152	Ga0209371_100015282	209
295	3300027312	Ga0209371_1000515	Ga0209371_100051534	209
296	3300027666	Ga0209282_1000151	Ga0209282_100015117	209
297	3300030500	Ga0268256_1000119	Ga0268256_100011991	209
298	3300030500	Ga0268256_1000127	Ga0268256_100012726	209
299	3300031911	Ga0307412_10279400	Ga0307412_102794001	209
300	3300041498	Ga0451841_1019455	Ga0451841_1019455_260_889	209
301	3300042137	Ga0450902_001163	Ga0450902_001163_596_1225	209
302	3300042137	Ga0450902_009994	Ga0450902_009994_539_1168	209
303	3300042138	Ga0450903_011224	Ga0450903_011224_276_905	209
304	3300046453	Ga0495627_029484	Ga0495627_029484_683_1312	209
305	3300046455	Ga0495603_0012456	Ga0495603_0012456_1106_1741	209
306	3300046472	Ga0495580_0040294	Ga0495580_0040294_2359_2994	209
307	3300046474	Ga0495605_0004035	Ga0495605_0004035_2747_3382	209
308	3300046492	Ga0495585_0000056	Ga0495585_0000056_58685_59314	209
309	3300046492	Ga0495585_0012913	Ga0495585_0012913_4186_4833	209
310	3300046501	Ga0495607_0002936	Ga0495607_0002936_8201_8890	209
311	3300046506	Ga0495583_0025131	Ga0495583_0025131_1052_1687	209
312	3300046507	Ga0495606_0002164	Ga0495606_0002164_20923_21597	209
313	3300046507	Ga0495606_0100149	Ga0495606_0100149_961_1596	209
314	3300046512	Ga0495610_0012911	Ga0495610_0012911_2192_2827	209
315	3300046516	Ga0495628_0076460	Ga0495628_0076460_1699_2427	209
316	3300046517	Ga0495630_0033709	Ga0495630_0033709_1135_1764	209
317	3300046522	Ga0495643_0022814	Ga0495643_0022814_2719_3408	209
318	3300046522	Ga0495643_0110762	Ga0495643_0110762_121_756	209
319	3300046524	Ga0495648_0000392	Ga0495648_0000392_37052_37681	209
320	3300046528	Ga0495642_0145181	Ga0495642_0145181_321_956	209
321	3300046529	Ga0495652_0419177	Ga0495652_0419177_144_779	209
322	3300046530	Ga0495654_0072162	Ga0495654_0072162_337_966	209
323	3300046542	Ga0495597_0004268	Ga0495597_0004268_3747_4436	209
324	3300046542	Ga0495597_0005400	Ga0495597_0005400_699_1328	209
325	3300046557	Ga0495622_0016557	Ga0495622_0016557_2330_2965	209
326	3300046558	Ga0495633_0030540	Ga0495633_0030540_897_1532	209
327	3300046660	Ga0495625_0004405	Ga0495625_0004405_10178_10807	209
328	3300046664	Ga0495659_0000019	Ga0495659_0000019_63431_64060	209
329	3300046665	Ga0495661_0050812	Ga0495661_0050812_404_1033	209
330	3300046665	Ga0495661_0130162	Ga0495661_0130162_531_1199	209
331	3300046692	Ga0495671_0002991	Ga0495671_0002991_6834_7463	209
332	3300046692	Ga0495671_0094377	Ga0495671_0094377_542_1177	209
333	3300046694	Ga0495649_0037766	Ga0495649_0037766_246_881	209
334	3300046694	Ga0495649_0104879	Ga0495649_0104879_313_948	209
335	3300046810	Ga0495660_0066154	Ga0495660_0066154_323_1009	209
336	3300046810	Ga0495660_0079187	Ga0495660_0079187_495_1124	209
337	3300047319	Ga0495674_0004325	Ga0495674_0004325_591_1226	209
338	3300047320	Ga0495672_0000756	Ga0495672_0000756_24534_25163	209
339	3300047320	Ga0495672_0011632	Ga0495672_0011632_2652_3341	209
340	3300047323	Ga0495683_0011688	Ga0495683_0011688_2716_3351	209
341	3300047443	Ga0495687_011542	Ga0495687_011542_1161_1796	209
342	3300047444	Ga0495675_0042974	Ga0495675_0042974_1234_1962	209
343	3300047444	Ga0495675_0301653	Ga0495675_0301653_31_660	209
344	3300047469	Ga0495673_0002431	Ga0495673_0002431_6454_7086	209
345	3300048909	Ga0496106_0000659	Ga0496106_0000659_6772_7407	209
346	3300048913	Ga0496110_0231679	Ga0496110_0231679_689_1318	209
347	3300048919	Ga0496116_0086721	Ga0496116_0086721_640_1275	209
348	3300048920	Ga0496117_0000033	Ga0496117_0000033_304170_304805	209
349	3300048920	Ga0496117_0000766	Ga0496117_0000766_3494_4123	209
350	3300048921	Ga0496118_0011386	Ga0496118_0011386_5280_5915	209
351	3300048921	Ga0496118_0017020	Ga0496118_0017020_2792_3421	209
352	3300048921	Ga0496118_0069231	Ga0496118_0069231_961_1590	209
353	3300048922	Ga0496119_0003641	Ga0496119_0003641_12206_12835	209
354	3300048922	Ga0496119_0026708	Ga0496119_0026708_3215_3862	209
355	3300048923	Ga0496120_0001433	Ga0496120_0001433_24623_25252	209
356	3300048923	Ga0496120_0081214	Ga0496120_0081214_822_1469	209
357	3300048924	Ga0496121_0000001	Ga0496121_0000001_1451719_1452354	209
358	3300048924	Ga0496121_0005561	Ga0496121_0005561_14705_15379	209
359	3300048924	Ga0496121_0051150	Ga0496121_0051150_623_1258	209
360	3300048924	Ga0496121_0057155	Ga0496121_0057155_109_744	209
361	3300048925	Ga0496122_0001314	Ga0496122_0001314_3239_3868	209
362	3300048925	Ga0496122_0010164	Ga0496122_0010164_3267_3902	209
363	3300048925	Ga0496122_0025224	Ga0496122_0025224_429_1076	209
364	3300048925	Ga0496122_0046644	Ga0496122_0046644_200_835	209
365	3300048925	Ga0496122_0090599	Ga0496122_0090599_673_1308	209
366	3300048925	Ga0496122_0138667	Ga0496122_0138667_364_999	209
367	3300048926	Ga0496123_0001741	Ga0496123_0001741_3491_4120	209
368	3300048926	Ga0496123_0039480	Ga0496123_0039480_2378_3013	209
369	3300048926	Ga0496123_0097360	Ga0496123_0097360_29_676	209
370	3300048926	Ga0496123_0161802	Ga0496123_0161802_344_979	209
371	3300048927	Ga0496124_0012623	Ga0496124_0012623_1093_1722	209
372	3300048927	Ga0496124_0023501	Ga0496124_0023501_3275_3904	209
373	3300048927	Ga0496124_0025859	Ga0496124_0025859_4206_4841	209
374	3300048927	Ga0496124_0076855	Ga0496124_0076855_608_1255	209
375	3300048927	Ga0496124_0086300	Ga0496124_0086300_975_1610	209
376	3300048927	Ga0496124_0172931	Ga0496124_0172931_810_1445	209
377	3300048927	Ga0496124_0181404	Ga0496124_0181404_67_702	209
378	3300048927	Ga0496124_0390168	Ga0496124_0390168_252_926	209
379	3300048928	Ga0496125_0000001	Ga0496125_0000001_1612787_1613422	209
380	3300048928	Ga0496125_0101926	Ga0496125_0101926_447_1094	209
381	3300048928	Ga0496125_0273565	Ga0496125_0273565_93_725	209
382	3300048928	Ga0496125_0329983	Ga0496125_0329983_191_826	209
383	3300048929	Ga0496126_0033260	Ga0496126_0033260_2574_3203	209
384	3300048929	Ga0496126_0097832	Ga0496126_0097832_1576_2211	209
385	3300049459	Ga0495678_002806	Ga0495678_002806_2867_3556	209
386	3300049460	Ga0495682_0012117	Ga0495682_0012117_974_1609	209
387	3300049460	Ga0495682_0086255	Ga0495682_0086255_435_1103	209
388	3300050489	nmdc:mga03683_823_c1	nmdc:mga03683_823_c1_2318_2953	209
389	3300050491	nmdc:mga00v17_336882_c1	nmdc:mga00v17_336882_c1_35_670	209
390	3300050491	nmdc:mga00v17_49928_c1	nmdc:mga00v17_49928_c1_486_1121	209
391	3300050493	nmdc:mga0k408_86066_c1	nmdc:mga0k408_86066_c1_542_1177	209
392	3300050494	nmdc:mga06z11_91783_c1	nmdc:mga06z11_91783_c1_904_1539	209
393	3300050516	nmdc:mga0sz30_770_c1	nmdc:mga0sz30_770_c1_9799_10434	209
394	3300053093	Ga0500651_0007277	Ga0500651_0007277_3527_4213	209
395	3300053137	Ga0500561_0001933	Ga0500561_0001933_120_755	209
396	3300053156	Ga0500622_0000367	Ga0500622_0000367_24742_25377	209
397	3300053157	Ga0500624_002622	Ga0500624_002622_1102_1761	209
398	3300053161	Ga0500634_0015808	Ga0500634_0015808_2164_2862	209
399	3300053161	Ga0500634_0050893	Ga0500634_0050893_760_1419	209
400	3300053162	Ga0500638_222097	Ga0500638_222097_66_734	209
401	3300053177	Ga0500636_0088865	Ga0500636_0088865_898_1566	209
402	iso_pu_bacteria	2617270742	2617384759	209
403	iso_pu_bacteria	2667528174	2671111475	209
404	iso_pu_bacteria	2842475841	2842476864	209
405	iso_pu_bacteria	2842502639	2842503379	209
406	iso_pu_bacteria	2919408235	2919409934	209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

8

76

0.96 PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

3

81

0.91 PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

119

192

0.89 PF00043

GST_C

Glutathione S-transferase, C-terminal domain

100

197

0.88 PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

75

0.88 PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

103

206

0.74 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2dsa-assembly2.cif.gz_C	ternary complex of bphk, a bacterial gst	0.9733	1	208
2dsa-assembly2.cif.gz_C	ternary complex of bphk, a bacterial gst	0.9686	1	208
1pmt-assembly1.cif.gz_A	glutathione transferase from proteus mirabilis	0.9667	1	209
4kgi-assembly1.cif.gz_B	crystal structure of a glutathione transferase family member from shigella flexneri, target efi-507258, bound gsh, tev-his-tag linker in active site	0.9627	1	208
1pmt-assembly1.cif.gz_A	glutathione transferase from proteus mirabilis	0.962	1	209

ID	Description	Score	Start	End	Superfamily
af_P0A9D2_1_80_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9865	1	79	3.40.30.10
af_P0A9D2_2_199_3.50.50.60	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain	0.9687	2	207	3.50.50.60
af_P0A9D2_2_199_3.50.50.60	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain	0.9639	2	207	3.50.50.60
af_P0A9D2_1_80_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9624	1	79	3.40.30.10
4gf0B01	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9604	1	81	3.40.30.10

ID	Description	Score	Start	End	GO Terms
AF-A0A4R2VA82-F1-model_v4	deleted	0.9996	1	209
AF-A0A2J4XVA0-F1-model_v4	Glutathione transferase GstA	0.9976	1	108	GO:0016740
AF-A0A485D723-F1-model_v4	Glutathione S-transferase GST-6.0 (EC 2.5.1.18)	0.997	1	112	GO:0004364
AF-A0A1M7JV18-F1-model_v4	Glutathione S-transferase	0.9962	98	209	GO:0016740
AF-A0A7H1MIQ6-F1-model_v4	deleted	0.9957	1	112

Feature Viewer

pLDDT	pTM	Quality
97.27	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F436306

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

8

76

0.96

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

3

81

0.91

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

119

192

0.89

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

100

197

0.88

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

75

0.88

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

103

206

0.74

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map