F436288

General Info

Members Datasets Scaffolds Average Seq Length
406 208 406 184

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0293021|Ga0466966_0293021_203_751
Length 182
Sequence VIQDDVLAECKDKMAKAVSHLQGEFGSIRTGRASPVFVEKLRVDYYGSEVPLQQLAGFSVPEPRLLVISPYDKNAIKAIEKSIQASDLGITPSNDGAVIRLAFPQLTAERRKVVKNRAEEARVAVRNLRRSARHDLEAFEKEGELSQDDLDRAEKDLEKLTHEFVTEIDNLAAHKEQEMLEV

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
51 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
89 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
90 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
91 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
92 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
93 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
107 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
110 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.78
Metatranscriptomes 2.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0
Rhizoplane 3.2
Rhizosphere 92.12
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10013350 3300003911 Bacteria 1592
2 Ga0065712_10187054 3300005290 Bacteria 1165
3 Ga0070658_10634111 3300005327 Bacteria 927
4 Ga0070676_10192628 3300005328 Bacteria 1332
5 Ga0070683_100154110 3300005329 Bacteria 2179
6 Ga0070690_100362411 3300005330 Bacteria 1055
7 Ga0068869_100259815 3300005334 Bacteria 1390
8 Ga0070660_100516872 3300005339 Bacteria 994
9 Ga0070675_100577676 3300005354 Bacteria 1018
10 Ga0070671_100000626 3300005355 Bacteria 25200
11 Ga0070671_100403193 3300005355 Bacteria 1170
12 Ga0070713_100105748 3300005436 Bacteria 2445
13 Ga0070705_100455416 3300005440 Bacteria 961
14 Ga0070708_100003466 3300005445 Bacteria 12345
15 Ga0070708_100043027 3300005445 Bacteria 3968
16 Ga0070663_101108864 3300005455 Bacteria 692
17 Ga0070678_100221529 3300005456 Bacteria 1573
18 Ga0070681_10020546 3300005458 Bacteria 6618
19 Ga0070706_100015312 3300005467 Bacteria 7080
20 Ga0070706_100067943 3300005467 Bacteria 3296
21 Ga0070707_100044729 3300005468 Bacteria 4238
22 Ga0070707_100090502 3300005468 Bacteria 2961
23 Ga0070707_100154415 3300005468 Bacteria 2236
24 Ga0070698_100053278 3300005471 Bacteria 4112
25 Ga0070698_100345169 3300005471 Bacteria 1420
26 Ga0070679_100679814 3300005530 Bacteria 972
27 Ga0070679_101118879 3300005530 Bacteria 732
28 Ga0070684_100268230 3300005535 Bacteria 1562
29 Ga0070684_100709806 3300005535 Bacteria 938
30 Ga0070695_100293377 3300005545 Bacteria 1199
31 Ga0070704_100606434 3300005549 Bacteria 963
32 Ga0068855_100088639 3300005563 Bacteria 3574
33 Ga0068855_100411862 3300005563 Bacteria 1480
34 Ga0068856_100736241 3300005614 Bacteria 1006
35 Ga0068861_100752984 3300005719 Unclassified 910
36 Ga0068858_100140728 3300005842 Bacteria 2265
37 Ga0068858_100193981 3300005842 Bacteria 1919
38 Ga0068860_100282692 3300005843 Bacteria 1622
39 Ga0081455_10006881 3300005937 Bacteria 12112
40 Ga0081455_10076984 3300005937 Bacteria 2746
41 Ga0081455_10246538 3300005937 Bacteria 1309
42 Ga0081538_10000201 3300005981 Bacteria 66216
43 Ga0081538_10003598 3300005981 Bacteria 14562
44 Ga0081538_10017754 3300005981 Bacteria 5382
45 Ga0075365_10069270 3300006038 Bacteria 2371
46 Ga0075368_10084189 3300006042 Bacteria 1296
47 Ga0075364_10266099 3300006051 Bacteria 1166
48 Ga0075367_10073425 3300006178 Bacteria 2061
49 Ga0075428_100000189 3300006844 Bacteria 57957
50 Ga0075428_100004011 3300006844 Bacteria 16164
51 Ga0075428_100038037 3300006844 Bacteria 5295
52 Ga0075428_100047932 3300006844 Bacteria 4692
53 Ga0075428_100159276 3300006844 Bacteria 2450
54 Ga0075428_100661918 3300006844 Bacteria 1113
55 Ga0075428_100760803 3300006844 Bacteria 1030
56 Ga0075430_100000784 3300006846 Bacteria 24572
57 Ga0075430_100000815 3300006846 Bacteria 24283
58 Ga0075430_100064999 3300006846 Bacteria 3065
59 Ga0075430_100593601 3300006846 Bacteria 914
60 Ga0075431_100000453 3300006847 Bacteria 33729
61 Ga0075431_100003166 3300006847 Bacteria 15921
62 Ga0075431_100036821 3300006847 Bacteria 5040
63 Ga0075431_100087624 3300006847 Bacteria 3212
64 Ga0075431_100118869 3300006847 Bacteria 2727
65 Ga0075429_100000313 3300006880 Bacteria 34623
66 Ga0075429_100002652 3300006880 Bacteria 15050
67 Ga0075429_100016238 3300006880 Bacteria 6451
68 Ga0075429_100052174 3300006880 Bacteria 3558
69 Ga0075429_100294325 3300006880 Bacteria 1421
70 Ga0075436_100515436 3300006914 Bacteria 876
71 Ga0111539_10016491 3300009094 Bacteria 9159
72 Ga0111539_10096101 3300009094 Bacteria 3480
73 Ga0111539_10271109 3300009094 Bacteria 1975
74 Ga0111539_10447876 3300009094 Bacteria 1503
75 Ga0111539_10504833 3300009094 Bacteria 1409
76 Ga0111539_10728360 3300009094 Bacteria 1154
77 Ga0111539_11681480 3300009094 Bacteria 736
78 Ga0105245_10010815 3300009098 Bacteria 7940
79 Ga0105245_10176686 3300009098 Bacteria 2037
80 Ga0105245_10422461 3300009098 Bacteria 1336
81 Ga0105245_10457019 3300009098 Bacteria 1286
82 Ga0105245_10538604 3300009098 Bacteria 1188
83 Ga0105245_10572696 3300009098 Bacteria 1153
84 Ga0114129_10000719 3300009147 Bacteria 41930
85 Ga0114129_10021773 3300009147 Bacteria 9098
86 Ga0114129_10033851 3300009147 Bacteria 7218
87 Ga0114129_10149719 3300009147 Bacteria 3194
88 Ga0114129_10204753 3300009147 Bacteria 2670
89 Ga0114129_10214720 3300009147 Bacteria 2598
90 Ga0114129_10800662 3300009147 Bacteria 1202
91 Ga0114129_11013075 3300009147 Unclassified 1045
92 Ga0114129_11209350 3300009147 Bacteria 941
93 Ga0105243_10981974 3300009148 Unclassified 846
94 Ga0105239_10910792 3300010375 Bacteria 1009
95 Ga0105246_10369506 3300011119 Bacteria 1181
96 Ga0157378_11168405 3300013297 Unclassified 808
97 Ga0157380_10700390 3300014326 Bacteria 1018
98 Ga0182008_10088833 3300014497 Bacteria 1523
99 Ga0206356_11544518 3300020070 Bacteria 1359
100 Ga0206356_11643384 3300020070 Bacteria 1151
101 Ga0206355_1019885 3300020076 Bacteria 843
102 Ga0206352_10619523 3300020078 Bacteria 1033
103 Ga0206350_11116413 3300020080 Bacteria 1099
104 Ga0213876_10002211 3300021384 Bacteria 11487
105 Ga0213876_10016061 3300021384 Bacteria 3960
106 Ga0224712_10007022 3300022467 Bacteria 3253
107 Ga0224712_10191718 3300022467 Unclassified 925
108 Ga0207705_10399729 3300025909 Bacteria 1063
109 Ga0207684_10015391 3300025910 Bacteria 6585
110 Ga0207707_10037947 3300025912 Bacteria 4209
111 Ga0207646_10038175 3300025922 Bacteria 4328
112 Ga0207646_10261387 3300025922 Unclassified 1564
113 Ga0207646_10288633 3300025922 Bacteria 1482
114 Ga0207646_10308610 3300025922 Bacteria 1429
115 Ga0207687_10004285 3300025927 Bacteria 9527
116 Ga0207687_10086627 3300025927 Bacteria 2275
117 Ga0207687_10280847 3300025927 Bacteria 1334
118 Ga0207687_10303793 3300025927 Bacteria 1286
119 Ga0207700_10813762 3300025928 Bacteria 836
120 Ga0207644_10007731 3300025931 Bacteria 7016
121 Ga0207644_10310644 3300025931 Bacteria 1273
122 Ga0207709_10188727 3300025935 Bacteria 1462
123 Ga0207691_10253235 3300025940 Bacteria 1519
124 Ga0207689_10491892 3300025942 Bacteria 1027
125 Ga0207661_10172651 3300025944 Bacteria 1883
126 Ga0207667_10069245 3300025949 Bacteria 3673
127 Ga0207667_10111100 3300025949 Bacteria 2827
128 Ga0207703_10196370 3300026035 Bacteria 1791
129 Ga0207648_10245038 3300026089 Bacteria 1597
130 Ga0207675_100199442 3300026118 Bacteria 1922
131 Ga0207683_10174852 3300026121 Bacteria 1946
132 Ga0207698_10763534 3300026142 Bacteria 966
133 Ga0209974_10001535 3300027876 Bacteria 8382
134 Ga0207428_10368719 3300027907 Bacteria 1055
135 Ga0265334_10076520 3300028573 Bacteria 1239
136 Ga0265770_1015053 3300030878 Unclassified 1173
137 Ga0265327_10147434 3300031251 Bacteria 1095
138 Ga0307408_100143822 3300031548 Bacteria 1875
139 Ga0307408_100863569 3300031548 Bacteria 826
140 Ga0265314_10276614 3300031711 Unclassified 952
141 Ga0316578_10019594 3300031728 Bacteria 3727
142 Ga0316578_10173877 3300031728 Bacteria 1298
143 Ga0316577_10029999 3300031733 Bacteria 3035
144 Ga0307413_10041447 3300031824 Bacteria 2696
145 Ga0307413_11109621 3300031824 Bacteria 684
146 Ga0307410_10015468 3300031852 Bacteria 4527
147 Ga0307407_10260748 3300031903 Bacteria 1192
148 Ga0307407_10463595 3300031903 Bacteria 922
149 Ga0307412_10063237 3300031911 Bacteria 2496
150 Ga0307412_10156707 3300031911 Bacteria 1687
151 Ga0307409_100049249 3300031995 Bacteria 3211
152 Ga0307416_100488938 3300032002 Bacteria 1292
153 Ga0307414_10086145 3300032004 Bacteria 2317
154 Ga0316580_10112770 3300032139 Bacteria 832
155 Ga0373930_0000888 3300034816 Bacteria 4273
156 Ga0373948_0003206 3300034817 Bacteria 2495
157 Ga0373929_0009142 3300035085 Bacteria 1833
158 Ga0373932_0000370 3300035112 Bacteria 13862
159 Ga0373957_0074547 3300035120 Bacteria 1332
160 Ga0373946_0150200 3300035171 Bacteria 1086
161 Ga0373955_0052093 3300035172 Bacteria 2232
162 Ga0316574_0033911 3300035398 Bacteria 3109
163 Ga0316574_0034796 3300035398 Bacteria 3074
164 Ga0316574_0109829 3300035398 Bacteria 1767
165 Ga0316574_0201452 3300035398 Bacteria 1278
166 Ga0316574_0706351 3300035398 Bacteria 618
167 Ga0373931_0000010 3300035691 Bacteria 334069
168 Ga0373931_0011259 3300035691 Bacteria 4320
169 Ga0373935_0183482 3300035692 Bacteria 1438
170 Ga0373947_0193069 3300035725 Bacteria 1329
171 Ga0373947_0349403 3300035725 Bacteria 992
172 Ga0373937_0010033 3300036401 Bacteria 8258
173 Ga0316584_0073878 3300036712 Bacteria 2556
174 Ga0316584_0442526 3300036712 Bacteria 920
175 Ga0373925_0019804 3300037068 Bacteria 4897
176 Ga0373925_0486126 3300037068 Bacteria 1013
177 Ga0436365_0061287 3300039437 Bacteria 19683
178 Ga0436365_0603553 3300039437 Bacteria 1024
179 Ga0436365_1001352 3300039437 Bacteria 8242
180 Ga0436365_1864542 3300039437 Bacteria 2091
181 Ga0436360_0697423 3300039438 Bacteria 1095
182 Ga0436363_1148704 3300039450 Bacteria 782
183 Ga0439439_0052206 3300041406 Bacteria 1073
184 Ga0439461_0018832 3300041410 Bacteria 1355
185 Ga0439465_0213250 3300041413 Bacteria 706
186 Ga0439465_0242671 3300041413 Bacteria 665
187 Ga0451837_0225214 3300041494 Bacteria 2655
188 Ga0439443_001740 3300042003 Bacteria 2481
189 Ga0439448_0002605 3300042005 Bacteria 4914
190 Ga0439450_000812 3300042008 Bacteria 4299
191 Ga0439462_0087723 3300042015 Bacteria 852
192 Ga0439463_012748 3300042016 Bacteria 2066
193 Ga0439434_0011137 3300042435 Bacteria 2656
194 Ga0439444_0008361 3300042437 Bacteria 1612
195 Ga0439464_0000404 3300042439 Bacteria 8490
196 Ga0439460_0012702 3300042461 Bacteria 2190
197 Ga0439440_0001877 3300042993 Bacteria 3898
198 Ga0466969_0296919 3300044656 Bacteria 731
199 Ga0466966_0045974 3300044684 Bacteria 2789
200 Ga0466966_0293021 3300044684 Unclassified 978
201 Ga0466963_0336803 3300044694 Bacteria 1062
202 Ga0466968_0094377 3300044735 Bacteria 1330
203 Ga0466968_0316656 3300044735 Bacteria 753
204 Ga0466960_0109962 3300044901 Bacteria 1430
205 Ga0466959_0139810 3300045049 Bacteria 1712
206 Ga0466959_0192445 3300045049 Bacteria 1423
207 Ga0466958_0276401 3300045836 Bacteria 1076
208 Ga0466967_0299217 3300045976 Bacteria 1548
209 Ga0466967_0779374 3300045976 Bacteria 949
210 Ga0495592_0178211 3300046454 Bacteria 1450
211 Ga0495592_0510069 3300046454 Bacteria 745
212 Ga0495629_0403368 3300046459 Bacteria 929
213 Ga0495629_0605233 3300046459 Bacteria 733
214 Ga0495629_0698164 3300046459 Bacteria 674
215 Ga0495629_0787176 3300046459 Bacteria 628
216 Ga0495641_0228509 3300046461 Bacteria 835
217 Ga0495641_0237299 3300046461 Bacteria 819
218 Ga0495651_0001305 3300046462 Bacteria 19295
219 Ga0495653_0110905 3300046463 Bacteria 1971
220 Ga0495582_0211477 3300046473 Unclassified 1109
221 Ga0495664_0203375 3300046477 Bacteria 1200
222 Ga0495584_0035704 3300046491 Bacteria 2512
223 Ga0495642_0134451 3300046528 Bacteria 1066
224 Ga0495652_0211404 3300046529 Bacteria 1464
225 Ga0495667_0010641 3300046559 Bacteria 6219
226 Ga0495667_0096450 3300046559 Bacteria 1914
227 Ga0495634_0159518 3300046642 Bacteria 1423
228 Ga0495635_0117368 3300046663 Bacteria 1816
229 Ga0495599_0112089 3300046678 Bacteria 1699
230 Ga0495599_0154251 3300046678 Bacteria 1421
231 Ga0495623_0023220 3300046679 Bacteria 4003
232 Ga0495613_0143951 3300046689 Bacteria 1702
233 Ga0495600_0053632 3300046809 Bacteria 2633
234 Ga0495604_0019491 3300047317 Bacteria 5430
235 Ga0495674_0408129 3300047319 Bacteria 1096
236 Ga0495674_0547826 3300047319 Bacteria 921
237 Ga0495672_0004154 3300047320 Bacteria 12029
238 Ga0495676_0046825 3300047321 Bacteria 3505
239 Ga0495676_0267390 3300047321 Bacteria 1161
240 Ga0495676_0546421 3300047321 Bacteria 757
241 Ga0495680_0028847 3300047322 Bacteria 4548
242 Ga0495680_0258403 3300047322 Bacteria 1232
243 Ga0495680_0550068 3300047322 Bacteria 778
244 Ga0495675_0017043 3300047444 Bacteria 4599
245 Ga0496104_0371421 3300048907 Bacteria 1343
246 Ga0496104_0828369 3300048907 Bacteria 831
247 Ga0496106_0777876 3300048909 Bacteria 760
248 Ga0496109_0122723 3300048912 Bacteria 2421
249 Ga0496109_1000085 3300048912 Bacteria 774
250 Ga0496110_0050551 3300048913 Bacteria 3650
251 Ga0496110_0915123 3300048913 Bacteria 783
252 Ga0496112_0738809 3300048915 Bacteria 911
253 Ga0496113_0690836 3300048916 Bacteria 815
254 Ga0496114_0728467 3300048917 Unclassified 868
255 Ga0496114_1247172 3300048917 Bacteria 630
256 Ga0496115_0091794 3300048918 Bacteria 2482
257 Ga0496115_0924265 3300048918 Unclassified 671
258 Ga0501310_000025 3300049130 Bacteria 15159
259 Ga0501031_0014411 3300049568 Bacteria 5139
260 Ga0501032_0088035 3300049569 Bacteria 2062
261 Ga0501033_0002020 3300049570 Bacteria 17656
262 Ga0501033_0008325 3300049570 Bacteria 8032
263 Ga0501034_0000602 3300049571 Bacteria 56640
264 Ga0501034_0000814 3300049571 Bacteria 46426
265 Ga0501034_0002714 3300049571 Bacteria 20855
266 Ga0501034_0105000 3300049571 Bacteria 2818
267 Ga0501034_0889291 3300049571 Bacteria 779
268 Ga0501036_0046151 3300049572 Bacteria 3689
269 Ga0501036_0148002 3300049572 Bacteria 1981
270 Ga0501036_0404960 3300049572 Bacteria 1138
271 Ga0501037_0064463 3300049573 Bacteria 2670
272 Ga0501037_0074219 3300049573 Bacteria 2472
273 Ga0501039_0060043 3300049575 Bacteria 2944
274 Ga0501039_0060372 3300049575 Bacteria 2937
275 Ga0501040_0003138 3300049576 Bacteria 10725
276 Ga0501040_0670597 3300049576 Bacteria 750
277 Ga0501040_0723594 3300049576 Bacteria 720
278 Ga0501041_0039197 3300049577 Bacteria 2875
279 Ga0501041_0132212 3300049577 Bacteria 1554
280 Ga0501042_0015645 3300049578 Bacteria 5195
281 Ga0501042_0351601 3300049578 Bacteria 1066
282 Ga0501042_0628597 3300049578 Bacteria 781
283 Ga0501043_0405930 3300049579 Bacteria 1029
284 Ga0501046_0077848 3300049580 Bacteria 2566
285 Ga0501046_0475355 3300049580 Bacteria 897
286 Ga0501047_0317188 3300049581 Bacteria 1399
287 Ga0501048_0009929 3300049582 Bacteria 7129
288 Ga0501048_0253054 3300049582 Bacteria 1251
289 Ga0501048_0408972 3300049582 Unclassified 970
290 Ga0501067_0056612 3300049583 Bacteria 2172
291 Ga0501067_0106105 3300049583 Bacteria 1561
292 Ga0501067_0217136 3300049583 Bacteria 1065
293 Ga0501068_0002355 3300049584 Bacteria 10054
294 Ga0501068_0083024 3300049584 Bacteria 1969
295 Ga0501068_0098278 3300049584 Bacteria 1812
296 Ga0501068_0154133 3300049584 Bacteria 1445
297 Ga0501069_0032516 3300049585 Bacteria 2871
298 Ga0501069_0040415 3300049585 Bacteria 2578
299 Ga0501069_0413758 3300049585 Bacteria 799
300 Ga0501070_0061515 3300049586 Bacteria 3110
301 Ga0501070_0165885 3300049586 Bacteria 1820
302 Ga0501071_0009311 3300049587 Bacteria 6538
303 Ga0501071_0093576 3300049587 Bacteria 2210
304 Ga0501071_0375147 3300049587 Unclassified 1084
305 Ga0501071_0605911 3300049587 Bacteria 842
306 Ga0501072_0005428 3300049588 Bacteria 9706
307 Ga0501072_0006484 3300049588 Bacteria 8912
308 Ga0501072_0017307 3300049588 Bacteria 5539
309 Ga0501072_0052430 3300049588 Bacteria 3212
310 Ga0501072_0535367 3300049588 Bacteria 926
311 Ga0501073_0000162 3300049589 Bacteria 43603
312 Ga0501073_0005085 3300049589 Bacteria 9864
313 Ga0501073_0254353 3300049589 Bacteria 1213
314 Ga0501074_0002803 3300049590 Bacteria 12197
315 Ga0501074_0062565 3300049590 Bacteria 2681
316 Ga0501074_0354754 3300049590 Bacteria 1041
317 Ga0501075_0004687 3300049591 Bacteria 9283
318 Ga0501075_0253887 3300049591 Bacteria 1340
319 Ga0501076_0001570 3300049592 Bacteria 15333
320 Ga0501076_0089525 3300049592 Bacteria 2474
321 Ga0501077_0004142 3300049593 Bacteria 8766
322 Ga0501077_0252160 3300049593 Bacteria 1122
323 Ga0501079_0017106 3300049741 Bacteria 5538
324 Ga0501079_0031747 3300049741 Bacteria 4058
325 Ga0501079_0034270 3300049741 Bacteria 3906
326 Ga0501080_0001710 3300049742 Bacteria 18740
327 Ga0501080_0022694 3300049742 Bacteria 5814
328 Ga0501080_0087469 3300049742 Bacteria 2895
329 Ga0501080_0663027 3300049742 Bacteria 922
330 Ga0501080_0726023 3300049742 Bacteria 875
331 Ga0501081_0007708 3300049743 Bacteria 6981
332 Ga0501083_0018631 3300049744 Bacteria 4836
333 Ga0501083_0030516 3300049744 Bacteria 3703
334 Ga0501083_0030688 3300049744 Bacteria 3691
335 Ga0501083_0093873 3300049744 Bacteria 1981
336 Ga0501083_0527112 3300049744 Bacteria 769
337 Ga0501044_0001520 3300049823 Bacteria 27213
338 Ga0501044_0009597 3300049823 Bacteria 10532
339 Ga0501045_0002564 3300049824 Bacteria 12389
340 Ga0501045_0062002 3300049824 Bacteria 2744
341 nmdc:mga03683_131425_c1 3300050489 Bacteria 1120
342 nmdc:mga00v17_74355_c1 3300050491 Bacteria 2111
343 nmdc:mga00v17_83581_c1 3300050491 Bacteria 1997
344 nmdc:mga0yw44_15388_c1 3300050492 Bacteria 4096
345 nmdc:mga0yw44_161127_c1 3300050492 Bacteria 1468
346 nmdc:mga0k408_289815_c1 3300050493 Bacteria 977
347 nmdc:mga05p37_15109_c1 3300050507 Bacteria 9271
348 nmdc:mga05p37_1575_c1 3300050507 Bacteria 26515
349 nmdc:mga05p37_208611_c1 3300050507 Bacteria 2362
350 nmdc:mga05p37_289951_c1 3300050507 Bacteria 1948
351 nmdc:mga05p37_333492_c1 3300050507 Bacteria 1791
352 nmdc:mga05p37_56832_c1 3300050507 Bacteria 4818
353 nmdc:mga05p37_598886_c1 3300050507 Bacteria 1245
354 nmdc:mga05p37_80368_c1 3300050507 Bacteria 4016
355 nmdc:mga09592_2750_c1 3300050508 Bacteria 14214
356 nmdc:mga09592_3880_c1 3300050508 Bacteria 12044
357 nmdc:mga09592_417117_c1 3300050508 Bacteria 1160
358 nmdc:mga09592_444793_c1 3300050508 Bacteria 1118
359 nmdc:mga09592_55809_c1 3300050508 Bacteria 3338
360 nmdc:mga0qj67_143392_c1 3300050509 Bacteria 1937
361 nmdc:mga0qj67_19463_c1 3300050509 Bacteria 5186
362 nmdc:mga0qj67_232906_c1 3300050509 Unclassified 1494
363 nmdc:mga0qj67_389_c1 3300050509 Bacteria 30374
364 nmdc:mga0qj67_437682_c1 3300050509 Bacteria 1054
365 nmdc:mga0qj67_543049_c1 3300050509 Bacteria 932
366 nmdc:mga0qj67_63537_c1 3300050509 Bacteria 2935
367 nmdc:mga0qj67_861_c1 3300050509 Bacteria 20820
368 nmdc:mga06r32_1907_c1 3300050510 Bacteria 18577
369 nmdc:mga06r32_258358_c1 3300050510 Bacteria 1729
370 nmdc:mga06r32_36705_c1 3300050510 Bacteria 4634
371 nmdc:mga06r32_38325_c1 3300050510 Bacteria 4541
372 nmdc:mga06r32_410066_c1 3300050510 Bacteria 1337
373 nmdc:mga06r32_431_c1 3300050510 Bacteria 35382
374 nmdc:mga08y16_271713_c1 3300050511 Bacteria 1750
375 nmdc:mga08y16_334978_c1 3300050511 Bacteria 1556
376 nmdc:mga08y16_341067_c1 3300050511 Bacteria 1540
377 nmdc:mga08y16_82380_c1 3300050511 Bacteria 3354
378 nmdc:mga08y16_91563_c1 3300050511 Bacteria 3169
379 nmdc:mga0rr50_151314_c1 3300050513 Bacteria 1875
380 Ga0495601_0067101 3300053077 Bacteria 2285
381 Ga0495601_0117018 3300053077 Bacteria 1729
382 Ga0495601_0328648 3300053077 Unclassified 995
383 Ga0495655_0229568 3300053083 Bacteria 617
384 Ga0495595_0007317 3300053084 Bacteria 4518
385 Ga0495595_0065879 3300053084 Bacteria 1704
386 Ga0495619_0007696 3300053085 Bacteria 6820
387 Ga0495619_0101995 3300053085 Bacteria 1954
388 Ga0495619_0396018 3300053085 Bacteria 954
389 Ga0495619_0553812 3300053085 Bacteria 789
390 Ga0495619_0562500 3300053085 Bacteria 782
391 Ga0500616_0002217 3300053153 Bacteria 16615
392 Ga0501084_0004238 3300054114 Bacteria 11684
393 Ga0501084_0004361 3300054114 Bacteria 11529
394 Ga0501084_0082861 3300054114 Bacteria 2692
395 Ga0501084_0299528 3300054114 Bacteria 1358
396 Ga0501084_1597818 3300054114 Bacteria 545
397 Ga0501082_0129824 3300060353 Bacteria 2186
398 Ga0501082_0199631 3300060353 Bacteria 1740
399 Ga0501082_0257287 3300060353 Bacteria 1519
400 Ga0501082_0410996 3300060353 Bacteria 1181
401 Ga0501082_0637272 3300060353 Unclassified 933
402 Ga0501082_0993796 3300060353 Bacteria 734
403 Ga0530510_0016395 3300061734 Bacteria 5244
404 Ga0530510_0019871 3300061734 Bacteria 4773
405 Ga0530510_0042495 3300061734 Bacteria 3284
406 Ga0530510_0090833 3300061734 Bacteria 2228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025931 Ga0207644_10310644 Ga0207644_103106442 152
2 3300005471 Ga0070698_100345169 Ga0070698_1003451692 153
3 3300046459 Ga0495629_0403368 Ga0495629_0403368_203_766 155
4 3300046459 Ga0495629_0605233 Ga0495629_0605233_121_678 156
5 3300005937 Ga0081455_10246538 Ga0081455_102465382 158
6 3300048917 Ga0496114_1247172 Ga0496114_1247172_22_585 158
7 3300053077 Ga0495601_0328648 Ga0495601_0328648_68_646 159
8 3300009098 Ga0105245_10457019 Ga0105245_104570192 160
9 3300014326 Ga0157380_10700390 Ga0157380_107003902 160
10 3300034816 Ga0373930_0000888 Ga0373930_0000888_1063_1632 160
11 3300035085 Ga0373929_0009142 Ga0373929_0009142_86_655 160
12 3300035112 Ga0373932_0000370 Ga0373932_0000370_11237_11806 160
13 3300035691 Ga0373931_0000010 Ga0373931_0000010_130833_131402 160
14 3300009147 Ga0114129_10214720 Ga0114129_102147203 161
15 3300035398 Ga0316574_0201452 Ga0316574_0201452_539_1108 162
16 3300047319 Ga0495674_0547826 Ga0495674_0547826_175_732 162
17 3300053077 Ga0495601_0067101 Ga0495601_0067101_65_622 162
18 3300053085 Ga0495619_0396018 Ga0495619_0396018_173_730 162
19 3300005843 Ga0068860_100282692 Ga0068860_1002826922 165
20 3300009098 Ga0105245_10176686 Ga0105245_101766863 165
21 3300010375 Ga0105239_10910792 Ga0105239_109107921 165
22 3300020070 Ga0206356_11544518 Ga0206356_115445182 165
23 3300044735 Ga0466968_0316656 Ga0466968_0316656_25_546 165
24 3300025927 Ga0207687_10086627 Ga0207687_100866273 166
25 3300047319 Ga0495674_0408129 Ga0495674_0408129_584_1084 166
26 3300048907 Ga0496104_0828369 Ga0496104_0828369_123_680 166
27 3300048909 Ga0496106_0777876 Ga0496106_0777876_174_731 166
28 3300048912 Ga0496109_0122723 Ga0496109_0122723_434_991 166
29 3300048913 Ga0496110_0050551 Ga0496110_0050551_2560_3117 166
30 3300049584 Ga0501068_0083024 Ga0501068_0083024_229_786 168
31 3300005530 Ga0070679_101118879 Ga0070679_1011188791 169
32 3300050509 nmdc:mga0qj67_543049_c1 nmdc:mga0qj67_543049_c1_57_635 169
33 3300054114 Ga0501084_1597818 Ga0501084_1597818_12_521 169
34 3300050509 nmdc:mga0qj67_232906_c1 nmdc:mga0qj67_232906_c1_168_746 170
35 3300041413 Ga0439465_0242671 Ga0439465_0242671_136_651 171
36 3300009098 Ga0105245_10572696 Ga0105245_105726962 172
37 3300049578 Ga0501042_0628597 Ga0501042_0628597_64_618 172
38 3300049744 Ga0501083_0527112 Ga0501083_0527112_97_651 172
39 3300006844 Ga0075428_100661918 Ga0075428_1006619182 173
40 3300031728 Ga0316578_10019594 Ga0316578_100195942 173
41 3300031733 Ga0316577_10029999 Ga0316577_100299994 173
42 3300032139 Ga0316580_10112770 Ga0316580_101127702 173
43 3300035398 Ga0316574_0109829 Ga0316574_0109829_542_1111 173
44 3300036712 Ga0316584_0442526 Ga0316584_0442526_258_827 173
45 3300047320 Ga0495672_0004154 Ga0495672_0004154_11300_11878 173
46 3300049578 Ga0501042_0351601 Ga0501042_0351601_526_1047 173
47 3300049581 Ga0501047_0317188 Ga0501047_0317188_855_1376 173
48 3300050507 nmdc:mga05p37_333492_c1 nmdc:mga05p37_333492_c1_844_1422 173
49 3300053083 Ga0495655_0229568 Ga0495655_0229568_21_542 173
50 3300053085 Ga0495619_0553812 Ga0495619_0553812_123_680 173
51 3300053085 Ga0495619_0562500 Ga0495619_0562500_27_548 173
52 3300009147 Ga0114129_11013075 Ga0114129_110130752 174
53 3300035398 Ga0316574_0706351 Ga0316574_0706351_21_590 174
54 3300042015 Ga0439462_0087723 Ga0439462_0087723_145_705 175
55 3300044656 Ga0466969_0296919 Ga0466969_0296919_149_706 176
56 3300044684 Ga0466966_0045974 Ga0466966_0045974_1229_1786 176
57 3300045049 Ga0466959_0139810 Ga0466959_0139810_617_1174 176
58 3300046459 Ga0495629_0787176 Ga0495629_0787176_51_608 176
59 3300054114 Ga0501084_0082861 Ga0501084_0082861_1899_2477 176
60 3300049571 Ga0501034_0000602 Ga0501034_0000602_27832_28383 177
61 3300049573 Ga0501037_0064463 Ga0501037_0064463_507_1058 177
62 3300049584 Ga0501068_0002355 Ga0501068_0002355_2444_2995 177
63 3300049586 Ga0501070_0165885 Ga0501070_0165885_1095_1646 177
64 3300049588 Ga0501072_0017307 Ga0501072_0017307_3683_4234 177
65 3300049589 Ga0501073_0000162 Ga0501073_0000162_36713_37264 177
66 3300049590 Ga0501074_0002803 Ga0501074_0002803_2457_3008 177
67 3300049592 Ga0501076_0089525 Ga0501076_0089525_1412_1963 177
68 3300049742 Ga0501080_0001710 Ga0501080_0001710_10859_11410 177
69 3300049744 Ga0501083_0030688 Ga0501083_0030688_1497_2048 177
70 3300060353 Ga0501082_0637272 Ga0501082_0637272_123_674 177
71 3300021384 Ga0213876_10002211 Ga0213876_100022112 178
72 3300039437 Ga0436365_0061287 Ga0436365_0061287_8799_9356 178
73 3300046461 Ga0495641_0237299 Ga0495641_0237299_83_646 178
74 3300047321 Ga0495676_0046825 Ga0495676_0046825_306_869 178
75 3300050510 nmdc:mga06r32_258358_c1 nmdc:mga06r32_258358_c1_259_837 178
76 3300006844 Ga0075428_100159276 Ga0075428_1001592763 179
77 3300006847 Ga0075431_100036821 Ga0075431_1000368213 179
78 3300049583 Ga0501067_0106105 Ga0501067_0106105_576_1133 179
79 3300049587 Ga0501071_0093576 Ga0501071_0093576_431_988 179
80 3300049588 Ga0501072_0006484 Ga0501072_0006484_6554_7111 179
81 3300049742 Ga0501080_0663027 Ga0501080_0663027_192_749 179
82 3300050507 nmdc:mga05p37_56832_c1 nmdc:mga05p37_56832_c1_2456_3034 179
83 3300050509 nmdc:mga0qj67_19463_c1 nmdc:mga0qj67_19463_c1_3538_4116 179
84 3300050510 nmdc:mga06r32_38325_c1 nmdc:mga06r32_38325_c1_2506_3084 179
85 3300060353 Ga0501082_0410996 Ga0501082_0410996_404_961 179
86 3300009147 Ga0114129_10204753 Ga0114129_102047532 180
87 3300044684 Ga0466966_0293021 Ga0466966_0293021_203_751 180
88 3300046528 Ga0495642_0134451 Ga0495642_0134451_403_981 180
89 3300048912 Ga0496109_1000085 Ga0496109_1000085_114_671 180
90 3300005436 Ga0070713_100105748 Ga0070713_1001057482 181
91 3300005445 Ga0070708_100003466 Ga0070708_1000034668 181
92 3300005467 Ga0070706_100015312 Ga0070706_1000153126 181
93 3300005468 Ga0070707_100090502 Ga0070707_1000905022 181
94 3300005471 Ga0070698_100053278 Ga0070698_1000532782 181
95 3300025910 Ga0207684_10015391 Ga0207684_100153913 181
96 3300025922 Ga0207646_10308610 Ga0207646_103086102 181
97 3300025928 Ga0207700_10813762 Ga0207700_108137622 181
98 3300035692 Ga0373935_0183482 Ga0373935_0183482_815_1393 181
99 3300035725 Ga0373947_0193069 Ga0373947_0193069_212_790 181
100 3300041413 Ga0439465_0213250 Ga0439465_0213250_13_582 181
101 3300046473 Ga0495582_0211477 Ga0495582_0211477_337_915 181
102 3300049582 Ga0501048_0253054 Ga0501048_0253054_112_657 181
103 3300005328 Ga0070676_10192628 Ga0070676_101926282 182
104 3300005354 Ga0070675_100577676 Ga0070675_1005776762 182
105 3300005456 Ga0070678_100221529 Ga0070678_1002215292 182
106 3300006051 Ga0075364_10266099 Ga0075364_102660992 182
107 3300025935 Ga0207709_10188727 Ga0207709_101887272 182
108 3300025940 Ga0207691_10253235 Ga0207691_102532352 182
109 3300025942 Ga0207689_10491892 Ga0207689_104918922 182
110 3300026121 Ga0207683_10174852 Ga0207683_101748522 182
111 3300049575 Ga0501039_0060372 Ga0501039_0060372_1795_2343 182
112 3300049577 Ga0501041_0132212 Ga0501041_0132212_730_1278 182
113 3300049587 Ga0501071_0375147 Ga0501071_0375147_195_743 182
114 3300049589 Ga0501073_0254353 Ga0501073_0254353_283_831 182
115 3300049593 Ga0501077_0252160 Ga0501077_0252160_546_1094 182
116 3300049741 Ga0501079_0017106 Ga0501079_0017106_2856_3404 182
117 3300050489 nmdc:mga03683_131425_c1 nmdc:mga03683_131425_c1_516_1085 182
118 3300050491 nmdc:mga00v17_83581_c1 nmdc:mga00v17_83581_c1_875_1444 182
119 3300050492 nmdc:mga0yw44_15388_c1 nmdc:mga0yw44_15388_c1_2294_2863 182
120 3300060353 Ga0501082_0199631 Ga0501082_0199631_720_1268 182
121 3300061734 Ga0530510_0016395 Ga0530510_0016395_1815_2363 182
122 3300060353 Ga0501082_0993796 Ga0501082_0993796_138_692 183
123 3300005290 Ga0065712_10187054 Ga0065712_101870542 184
124 3300005329 Ga0070683_100154110 Ga0070683_1001541102 184
125 3300005339 Ga0070660_100516872 Ga0070660_1005168722 184
126 3300005355 Ga0070671_100403193 Ga0070671_1004031932 184
127 3300005445 Ga0070708_100043027 Ga0070708_1000430271 184
128 3300005458 Ga0070681_10020546 Ga0070681_100205466 184
129 3300005467 Ga0070706_100067943 Ga0070706_1000679434 184
130 3300005535 Ga0070684_100268230 Ga0070684_1002682302 184
131 3300005545 Ga0070695_100293377 Ga0070695_1002933772 184
132 3300005563 Ga0068855_100411862 Ga0068855_1004118622 184
133 3300006042 Ga0075368_10084189 Ga0075368_100841891 184
134 3300009094 Ga0111539_11681480 Ga0111539_116814802 184
135 3300009098 Ga0105245_10010815 Ga0105245_100108154 184
136 3300020080 Ga0206350_11116413 Ga0206350_111164132 184
137 3300022467 Ga0224712_10007022 Ga0224712_100070224 184
138 3300025912 Ga0207707_10037947 Ga0207707_100379472 184
139 3300025922 Ga0207646_10288633 Ga0207646_102886332 184
140 3300025927 Ga0207687_10004285 Ga0207687_100042856 184
141 3300025944 Ga0207661_10172651 Ga0207661_101726512 184
142 3300025949 Ga0207667_10111100 Ga0207667_101111002 184
143 3300027876 Ga0209974_10001535 Ga0209974_100015353 184
144 3300031251 Ga0265327_10147434 Ga0265327_101474342 184
145 3300039437 Ga0436365_1864542 Ga0436365_1864542_1269_1823 184
146 3300041406 Ga0439439_0052206 Ga0439439_0052206_370_933 184
147 3300041410 Ga0439461_0018832 Ga0439461_0018832_637_1197 184
148 3300044735 Ga0466968_0094377 Ga0466968_0094377_40_600 184
149 3300044901 Ga0466960_0109962 Ga0466960_0109962_495_1055 184
150 3300045049 Ga0466959_0192445 Ga0466959_0192445_663_1223 184
151 3300045836 Ga0466958_0276401 Ga0466958_0276401_136_696 184
152 3300045976 Ga0466967_0779374 Ga0466967_0779374_176_733 184
153 3300046491 Ga0495584_0035704 Ga0495584_0035704_63_626 184
154 3300048907 Ga0496104_0371421 Ga0496104_0371421_10_564 184
155 3300049130 Ga0501310_000025 Ga0501310_000025_4351_4905 184
156 3300050493 nmdc:mga0k408_289815_c1 nmdc:mga0k408_289815_c1_361_921 184
157 3300005330 Ga0070690_100362411 Ga0070690_1003624112 185
158 3300005440 Ga0070705_100455416 Ga0070705_1004554161 185
159 3300005468 Ga0070707_100044729 Ga0070707_1000447295 185
160 3300005468 Ga0070707_100154415 Ga0070707_1001544153 185
161 3300005549 Ga0070704_100606434 Ga0070704_1006064342 185
162 3300006914 Ga0075436_100515436 Ga0075436_1005154362 185
163 3300009094 Ga0111539_10447876 Ga0111539_104478762 185
164 3300009094 Ga0111539_10504833 Ga0111539_105048332 185
165 3300009098 Ga0105245_10538604 Ga0105245_105386042 185
166 3300009147 Ga0114129_10149719 Ga0114129_101497193 185
167 3300009147 Ga0114129_11209350 Ga0114129_112093502 185
168 3300009148 Ga0105243_10981974 Ga0105243_109819741 185
169 3300013297 Ga0157378_11168405 Ga0157378_111684052 185
170 3300014497 Ga0182008_10088833 Ga0182008_100888332 185
171 3300020076 Ga0206355_1019885 Ga0206355_10198852 185
172 3300025922 Ga0207646_10038175 Ga0207646_100381756 185
173 3300025922 Ga0207646_10261387 Ga0207646_102613871 185
174 3300026089 Ga0207648_10245038 Ga0207648_102450382 185
175 3300026142 Ga0207698_10763534 Ga0207698_107635341 185
176 3300031548 Ga0307408_100863569 Ga0307408_1008635692 185
177 3300031824 Ga0307413_10041447 Ga0307413_100414473 185
178 3300031824 Ga0307413_11109621 Ga0307413_111096211 185
179 3300031852 Ga0307410_10015468 Ga0307410_100154684 185
180 3300031911 Ga0307412_10156707 Ga0307412_101567072 185
181 3300031995 Ga0307409_100049249 Ga0307409_1000492492 185
182 3300032004 Ga0307414_10086145 Ga0307414_100861452 185
183 3300035398 Ga0316574_0033911 Ga0316574_0033911_323_880 185
184 3300041494 Ga0451837_0225214 Ga0451837_0225214_960_1517 185
185 3300042003 Ga0439443_001740 Ga0439443_001740_472_1029 185
186 3300042005 Ga0439448_0002605 Ga0439448_0002605_1759_2316 185
187 3300042008 Ga0439450_000812 Ga0439450_000812_1929_2486 185
188 3300042016 Ga0439463_012748 Ga0439463_012748_1255_1812 185
189 3300042437 Ga0439444_0008361 Ga0439444_0008361_215_772 185
190 3300042439 Ga0439464_0000404 Ga0439464_0000404_6876_7433 185
191 3300042461 Ga0439460_0012702 Ga0439460_0012702_108_665 185
192 3300042993 Ga0439440_0001877 Ga0439440_0001877_1526_2083 185
193 3300044694 Ga0466963_0336803 Ga0466963_0336803_76_633 185
194 3300046454 Ga0495592_0510069 Ga0495592_0510069_176_733 185
195 3300046461 Ga0495641_0228509 Ga0495641_0228509_66_623 185
196 3300047321 Ga0495676_0267390 Ga0495676_0267390_220_777 185
197 3300047322 Ga0495680_0550068 Ga0495680_0550068_88_645 185
198 3300049571 Ga0501034_0002714 Ga0501034_0002714_17891_18448 185
199 3300049576 Ga0501040_0723594 Ga0501040_0723594_29_586 185
200 3300049580 Ga0501046_0475355 Ga0501046_0475355_14_571 185
201 3300049582 Ga0501048_0408972 Ga0501048_0408972_281_838 185
202 3300049585 Ga0501069_0413758 Ga0501069_0413758_191_748 185
203 3300049587 Ga0501071_0605911 Ga0501071_0605911_113_670 185
204 3300049588 Ga0501072_0052430 Ga0501072_0052430_1962_2519 185
205 3300049588 Ga0501072_0535367 Ga0501072_0535367_226_783 185
206 3300049590 Ga0501074_0354754 Ga0501074_0354754_291_848 185
207 3300049591 Ga0501075_0253887 Ga0501075_0253887_522_1079 185
208 3300049823 Ga0501044_0009597 Ga0501044_0009597_3868_4425 185
209 3300049824 Ga0501045_0062002 Ga0501045_0062002_1361_1918 185
210 3300050507 nmdc:mga05p37_289951_c1 nmdc:mga05p37_289951_c1_983_1540 185
211 3300050508 nmdc:mga09592_2750_c1 nmdc:mga09592_2750_c1_12619_13176 185
212 3300050508 nmdc:mga09592_417117_c1 nmdc:mga09592_417117_c1_154_711 185
213 3300050509 nmdc:mga0qj67_389_c1 nmdc:mga0qj67_389_c1_14144_14701 185
214 3300050510 nmdc:mga06r32_1907_c1 nmdc:mga06r32_1907_c1_5965_6522 185
215 3300050511 nmdc:mga08y16_341067_c1 nmdc:mga08y16_341067_c1_483_1040 185
216 3300050513 nmdc:mga0rr50_151314_c1 nmdc:mga0rr50_151314_c1_527_1084 185
217 3300054114 Ga0501084_0299528 Ga0501084_0299528_399_956 185
218 3300060353 Ga0501082_0257287 Ga0501082_0257287_416_973 185
219 3300061734 Ga0530510_0019871 Ga0530510_0019871_2693_3250 185
220 3300005455 Ga0070663_101108864 Ga0070663_1011088641 187
221 3300005530 Ga0070679_100679814 Ga0070679_1006798142 187
222 3300005535 Ga0070684_100709806 Ga0070684_1007098061 187
223 3300021384 Ga0213876_10016061 Ga0213876_100160614 187
224 3300031548 Ga0307408_100143822 Ga0307408_1001438222 187
225 3300031903 Ga0307407_10260748 Ga0307407_102607482 187
226 3300031911 Ga0307412_10063237 Ga0307412_100632373 187
227 3300032002 Ga0307416_100488938 Ga0307416_1004889382 187
228 3300039437 Ga0436365_1001352 Ga0436365_1001352_3983_4552 187
229 3300042435 Ga0439434_0011137 Ga0439434_0011137_783_1346 187
230 3300045976 Ga0466967_0299217 Ga0466967_0299217_524_1087 187
231 3300048913 Ga0496110_0915123 Ga0496110_0915123_92_655 187
232 3300048915 Ga0496112_0738809 Ga0496112_0738809_24_587 187
233 3300048916 Ga0496113_0690836 Ga0496113_0690836_135_698 187
234 3300048918 Ga0496115_0091794 Ga0496115_0091794_991_1554 187
235 3300049576 Ga0501040_0670597 Ga0501040_0670597_31_594 187
236 3300049583 Ga0501067_0056612 Ga0501067_0056612_973_1536 187
237 3300049583 Ga0501067_0217136 Ga0501067_0217136_45_608 187
238 3300049584 Ga0501068_0098278 Ga0501068_0098278_498_1061 187
239 3300049585 Ga0501069_0032516 Ga0501069_0032516_191_754 187
240 3300049586 Ga0501070_0061515 Ga0501070_0061515_156_719 187
241 3300049589 Ga0501073_0005085 Ga0501073_0005085_5990_6553 187
242 3300049741 Ga0501079_0034270 Ga0501079_0034270_3136_3699 187
243 3300049742 Ga0501080_0022694 Ga0501080_0022694_3633_4196 187
244 3300049744 Ga0501083_0018631 Ga0501083_0018631_2501_3064 187
245 3300049744 Ga0501083_0030516 Ga0501083_0030516_1287_1850 187
246 3300053077 Ga0495601_0117018 Ga0495601_0117018_133_702 187
247 3300053153 Ga0500616_0002217 Ga0500616_0002217_14278_14841 187
248 3300054114 Ga0501084_0004238 Ga0501084_0004238_6785_7348 187
249 3300005327 Ga0070658_10634111 Ga0070658_106341111 188
250 3300005563 Ga0068855_100088639 Ga0068855_1000886392 188
251 3300005614 Ga0068856_100736241 Ga0068856_1007362412 188
252 3300009098 Ga0105245_10422461 Ga0105245_104224611 188
253 3300020070 Ga0206356_11643384 Ga0206356_116433841 188
254 3300020078 Ga0206352_10619523 Ga0206352_106195232 188
255 3300022467 Ga0224712_10191718 Ga0224712_101917182 188
256 3300025909 Ga0207705_10399729 Ga0207705_103997292 188
257 3300025927 Ga0207687_10280847 Ga0207687_102808472 188
258 3300025949 Ga0207667_10069245 Ga0207667_100692454 188
259 3300030878 Ga0265770_1015053 Ga0265770_10150532 188
260 3300031711 Ga0265314_10276614 Ga0265314_102766141 188
261 3300039437 Ga0436365_0603553 Ga0436365_0603553_79_648 188
262 3300039438 Ga0436360_0697423 Ga0436360_0697423_35_604 188
263 3300048918 Ga0496115_0924265 Ga0496115_0924265_39_608 188
264 3300049570 Ga0501033_0002020 Ga0501033_0002020_9474_10040 188
265 3300049572 Ga0501036_0148002 Ga0501036_0148002_1290_1856 188
266 3300049579 Ga0501043_0405930 Ga0501043_0405930_285_851 188
267 3300049585 Ga0501069_0040415 Ga0501069_0040415_1457_2023 188
268 3300049823 Ga0501044_0001520 Ga0501044_0001520_24222_24788 188
269 3300050491 nmdc:mga00v17_74355_c1 nmdc:mga00v17_74355_c1_634_1200 188
270 3300050492 nmdc:mga0yw44_161127_c1 nmdc:mga0yw44_161127_c1_146_712 188
271 3300061734 Ga0530510_0090833 Ga0530510_0090833_117_686 188
272 3300003911 JGI25405J52794_10013350 JGI25405J52794_100133502 189
273 3300005334 Ga0068869_100259815 Ga0068869_1002598152 189
274 3300005355 Ga0070671_100000626 Ga0070671_1000006265 189
275 3300005719 Ga0068861_100752984 Ga0068861_1007529842 189
276 3300005842 Ga0068858_100140728 Ga0068858_1001407283 189
277 3300005842 Ga0068858_100193981 Ga0068858_1001939812 189
278 3300005937 Ga0081455_10006881 Ga0081455_100068814 189
279 3300005937 Ga0081455_10076984 Ga0081455_100769842 189
280 3300005981 Ga0081538_10000201 Ga0081538_1000020136 189
281 3300005981 Ga0081538_10003598 Ga0081538_1000359818 189
282 3300005981 Ga0081538_10017754 Ga0081538_100177545 189
283 3300006038 Ga0075365_10069270 Ga0075365_100692702 189
284 3300006178 Ga0075367_10073425 Ga0075367_100734252 189
285 3300006844 Ga0075428_100000189 Ga0075428_10000018942 189
286 3300006844 Ga0075428_100004011 Ga0075428_1000040115 189
287 3300006844 Ga0075428_100038037 Ga0075428_1000380373 189
288 3300006844 Ga0075428_100047932 Ga0075428_1000479323 189
289 3300006844 Ga0075428_100760803 Ga0075428_1007608032 189
290 3300006846 Ga0075430_100000784 Ga0075430_1000007843 189
291 3300006846 Ga0075430_100000815 Ga0075430_10000081522 189
292 3300006846 Ga0075430_100064999 Ga0075430_1000649992 189
293 3300006846 Ga0075430_100593601 Ga0075430_1005936012 189
294 3300006847 Ga0075431_100000453 Ga0075431_10000045322 189
295 3300006847 Ga0075431_100003166 Ga0075431_10000316615 189
296 3300006847 Ga0075431_100087624 Ga0075431_1000876243 189
297 3300006847 Ga0075431_100118869 Ga0075431_1001188693 189
298 3300006880 Ga0075429_100000313 Ga0075429_1000003138 189
299 3300006880 Ga0075429_100002652 Ga0075429_1000026523 189
300 3300006880 Ga0075429_100016238 Ga0075429_1000162385 189
301 3300006880 Ga0075429_100052174 Ga0075429_1000521742 189
302 3300006880 Ga0075429_100294325 Ga0075429_1002943252 189
303 3300009094 Ga0111539_10016491 Ga0111539_100164915 189
304 3300009094 Ga0111539_10096101 Ga0111539_100961014 189
305 3300009094 Ga0111539_10271109 Ga0111539_102711092 189
306 3300009094 Ga0111539_10728360 Ga0111539_107283602 189
307 3300009147 Ga0114129_10000719 Ga0114129_1000071938 189
308 3300009147 Ga0114129_10021773 Ga0114129_100217735 189
309 3300009147 Ga0114129_10033851 Ga0114129_100338514 189
310 3300009147 Ga0114129_10800662 Ga0114129_108006622 189
311 3300011119 Ga0105246_10369506 Ga0105246_103695062 189
312 3300025927 Ga0207687_10303793 Ga0207687_103037932 189
313 3300025931 Ga0207644_10007731 Ga0207644_100077314 189
314 3300026035 Ga0207703_10196370 Ga0207703_101963702 189
315 3300026118 Ga0207675_100199442 Ga0207675_1001994422 189
316 3300027907 Ga0207428_10368719 Ga0207428_103687191 189
317 3300028573 Ga0265334_10076520 Ga0265334_100765202 189
318 3300031728 Ga0316578_10173877 Ga0316578_101738771 189
319 3300031903 Ga0307407_10463595 Ga0307407_104635952 189
320 3300034817 Ga0373948_0003206 Ga0373948_0003206_512_1081 189
321 3300035120 Ga0373957_0074547 Ga0373957_0074547_706_1275 189
322 3300035171 Ga0373946_0150200 Ga0373946_0150200_487_1059 189
323 3300035172 Ga0373955_0052093 Ga0373955_0052093_1261_1830 189
324 3300035398 Ga0316574_0034796 Ga0316574_0034796_1770_2339 189
325 3300035691 Ga0373931_0011259 Ga0373931_0011259_2334_2903 189
326 3300035725 Ga0373947_0349403 Ga0373947_0349403_326_898 189
327 3300036401 Ga0373937_0010033 Ga0373937_0010033_5165_5734 189
328 3300036712 Ga0316584_0073878 Ga0316584_0073878_907_1476 189
329 3300037068 Ga0373925_0019804 Ga0373925_0019804_445_1017 189
330 3300037068 Ga0373925_0486126 Ga0373925_0486126_369_938 189
331 3300039450 Ga0436363_1148704 Ga0436363_1148704_161_754 189
332 3300046454 Ga0495592_0178211 Ga0495592_0178211_306_875 189
333 3300046459 Ga0495629_0698164 Ga0495629_0698164_29_598 189
334 3300046462 Ga0495651_0001305 Ga0495651_0001305_5124_5693 189
335 3300046463 Ga0495653_0110905 Ga0495653_0110905_1327_1896 189
336 3300046477 Ga0495664_0203375 Ga0495664_0203375_323_892 189
337 3300046529 Ga0495652_0211404 Ga0495652_0211404_746_1315 189
338 3300046559 Ga0495667_0010641 Ga0495667_0010641_2804_3373 189
339 3300046559 Ga0495667_0096450 Ga0495667_0096450_586_1161 189
340 3300046642 Ga0495634_0159518 Ga0495634_0159518_697_1266 189
341 3300046663 Ga0495635_0117368 Ga0495635_0117368_172_741 189
342 3300046678 Ga0495599_0112089 Ga0495599_0112089_1025_1600 189
343 3300046678 Ga0495599_0154251 Ga0495599_0154251_386_955 189
344 3300046679 Ga0495623_0023220 Ga0495623_0023220_2985_3554 189
345 3300046689 Ga0495613_0143951 Ga0495613_0143951_196_771 189
346 3300046809 Ga0495600_0053632 Ga0495600_0053632_440_1009 189
347 3300047317 Ga0495604_0019491 Ga0495604_0019491_3438_4007 189
348 3300047321 Ga0495676_0546421 Ga0495676_0546421_102_671 189
349 3300047322 Ga0495680_0028847 Ga0495680_0028847_2683_3252 189
350 3300047322 Ga0495680_0258403 Ga0495680_0258403_500_1075 189
351 3300047444 Ga0495675_0017043 Ga0495675_0017043_3063_3632 189
352 3300048917 Ga0496114_0728467 Ga0496114_0728467_285_854 189
353 3300049568 Ga0501031_0014411 Ga0501031_0014411_1893_2465 189
354 3300049569 Ga0501032_0088035 Ga0501032_0088035_371_943 189
355 3300049570 Ga0501033_0008325 Ga0501033_0008325_3578_4150 189
356 3300049571 Ga0501034_0000814 Ga0501034_0000814_19638_20207 189
357 3300049571 Ga0501034_0105000 Ga0501034_0105000_1965_2534 189
358 3300049571 Ga0501034_0889291 Ga0501034_0889291_156_725 189
359 3300049572 Ga0501036_0046151 Ga0501036_0046151_2034_2606 189
360 3300049572 Ga0501036_0404960 Ga0501036_0404960_393_962 189
361 3300049573 Ga0501037_0074219 Ga0501037_0074219_869_1441 189
362 3300049575 Ga0501039_0060043 Ga0501039_0060043_1910_2482 189
363 3300049576 Ga0501040_0003138 Ga0501040_0003138_7298_7870 189
364 3300049577 Ga0501041_0039197 Ga0501041_0039197_502_1074 189
365 3300049578 Ga0501042_0015645 Ga0501042_0015645_3838_4410 189
366 3300049580 Ga0501046_0077848 Ga0501046_0077848_1775_2347 189
367 3300049582 Ga0501048_0009929 Ga0501048_0009929_2353_2925 189
368 3300049584 Ga0501068_0154133 Ga0501068_0154133_133_705 189
369 3300049587 Ga0501071_0009311 Ga0501071_0009311_2074_2646 189
370 3300049588 Ga0501072_0005428 Ga0501072_0005428_1852_2424 189
371 3300049590 Ga0501074_0062565 Ga0501074_0062565_497_1069 189
372 3300049591 Ga0501075_0004687 Ga0501075_0004687_1285_1857 189
373 3300049592 Ga0501076_0001570 Ga0501076_0001570_9697_10269 189
374 3300049593 Ga0501077_0004142 Ga0501077_0004142_2534_3106 189
375 3300049741 Ga0501079_0031747 Ga0501079_0031747_449_1021 189
376 3300049742 Ga0501080_0087469 Ga0501080_0087469_480_1052 189
377 3300049742 Ga0501080_0726023 Ga0501080_0726023_85_654 189
378 3300049743 Ga0501081_0007708 Ga0501081_0007708_3772_4344 189
379 3300049744 Ga0501083_0093873 Ga0501083_0093873_343_915 189
380 3300049824 Ga0501045_0002564 Ga0501045_0002564_7300_7872 189
381 3300050507 nmdc:mga05p37_15109_c1 nmdc:mga05p37_15109_c1_6089_6661 189
382 3300050507 nmdc:mga05p37_1575_c1 nmdc:mga05p37_1575_c1_10710_11285 189
383 3300050507 nmdc:mga05p37_208611_c1 nmdc:mga05p37_208611_c1_725_1297 189
384 3300050507 nmdc:mga05p37_598886_c1 nmdc:mga05p37_598886_c1_488_1060 189
385 3300050507 nmdc:mga05p37_80368_c1 nmdc:mga05p37_80368_c1_2082_2651 189
386 3300050508 nmdc:mga09592_3880_c1 nmdc:mga09592_3880_c1_10745_11320 189
387 3300050508 nmdc:mga09592_444793_c1 nmdc:mga09592_444793_c1_317_889 189
388 3300050508 nmdc:mga09592_55809_c1 nmdc:mga09592_55809_c1_96_665 189
389 3300050509 nmdc:mga0qj67_143392_c1 nmdc:mga0qj67_143392_c1_733_1302 189
390 3300050509 nmdc:mga0qj67_437682_c1 nmdc:mga0qj67_437682_c1_170_742 189
391 3300050509 nmdc:mga0qj67_63537_c1 nmdc:mga0qj67_63537_c1_533_1105 189
392 3300050509 nmdc:mga0qj67_861_c1 nmdc:mga0qj67_861_c1_853_1428 189
393 3300050510 nmdc:mga06r32_36705_c1 nmdc:mga06r32_36705_c1_870_1439 189
394 3300050510 nmdc:mga06r32_410066_c1 nmdc:mga06r32_410066_c1_563_1135 189
395 3300050510 nmdc:mga06r32_431_c1 nmdc:mga06r32_431_c1_1708_2283 189
396 3300050511 nmdc:mga08y16_271713_c1 nmdc:mga08y16_271713_c1_1134_1706 189
397 3300050511 nmdc:mga08y16_334978_c1 nmdc:mga08y16_334978_c1_736_1314 189
398 3300050511 nmdc:mga08y16_82380_c1 nmdc:mga08y16_82380_c1_1610_2182 189
399 3300050511 nmdc:mga08y16_91563_c1 nmdc:mga08y16_91563_c1_2022_2594 189
400 3300053084 Ga0495595_0007317 Ga0495595_0007317_2279_2848 189
401 3300053084 Ga0495595_0065879 Ga0495595_0065879_302_877 189
402 3300053085 Ga0495619_0007696 Ga0495619_0007696_3322_3891 189
403 3300053085 Ga0495619_0101995 Ga0495619_0101995_422_997 189
404 3300054114 Ga0501084_0004361 Ga0501084_0004361_9712_10284 189
405 3300060353 Ga0501082_0129824 Ga0501082_0129824_786_1358 189
406 3300061734 Ga0530510_0042495 Ga0530510_0042495_1085_1657 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

21

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vud-assembly1.cif.gz_B crystal structure of a ribosome recycling factor from ehrlichia chaffeensis 0.9507 6 186
3lf9-assembly1.cif.gz_A crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c 0.9378 6 188
6vud-assembly1.cif.gz_B crystal structure of a ribosome recycling factor from ehrlichia chaffeensis 0.9261 6 186
5mlc-assembly1.cif.gz_9 cryo-em structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions 0.9218 107 188
4woi-assembly1.cif.gz_AV 4,5-linked aminoglycoside antibiotics regulate the bacterial ribosome by targeting dynamic conformational processes within intersubunit bridge b2 0.9166 6 186
ID Description Score Start End Superfamily
4kc6A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9797 7 181 1.10.132.20
1ek8A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9705 7 188 1.10.132.20
4kb2A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9688 6 187 1.10.132.20
af_B6TAV8_107_177_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9661 35 104 3.30.1360.40
af_P0A805_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9651 35 109 3.30.1360.40
ID Description Score Start End GO Terms
AF-A0A350AKP6-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9862 6 188 GO:0005737
GO:0006415
GO:0043023
AF-A0A3T0RVF0-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9859 6 188 GO:0005737
GO:0006415
GO:0043023
AF-K7LH22-F1-model_v4 Ribosome-recycling factor, chloroplastic (Ribosome-releasing factor, chloroplastic) 0.9856 2 188 GO:0009507
GO:0032544
GO:0043023
AF-A0A7C6N339-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9845 6 188 GO:0005737
GO:0006415
GO:0043023
AF-A0A287HR89-F1-model_v4 deleted 0.9808 18 188

Feature Viewer

pLDDT pTM Quality
91.41 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map