F436271

General Info

Members Datasets Scaffolds Average Seq Length
406 247 812 168

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0064021|Ga0395899_0064021_1464_2036
Length 190
Sequence MAEFGHRRRLTSNTSAGTVPPVRTIILLRHAKSSWSDPTLADLDRPLAPRGERASRSIAKYIRRKKIHPALVLCSPSLRTRQTLEAIESSLGKRSAVELVPALYGASETELLEQLQALPESIGSVMLIGHNPGLQDLARVLASRDADLRQLEEKFPTGALVTLVVDSNSWAALRPGNAKLIDYVVPKQLG

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
143 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
154 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
158 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
245 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
246 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
247 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.49
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 5.17
Rhizosphere 93.84
Stem 0
Stem Tuber 0
Unclassified 18.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0064021 3300037312 Bacteria 2704
2 JGI24743J22301_10025025 3300001991 Bacteria 1155
3 Ga0070658_10004578 3300005327 Bacteria 11236
4 Ga0070658_10407419 3300005327 Bacteria 1168
5 Ga0070666_10120304 3300005335 Bacteria 1821
6 Ga0070680_100005348 3300005336 Bacteria 9712
7 Ga0070682_100276339 3300005337 Bacteria 1222
8 Ga0068868_100120300 3300005338 Bacteria 2141
9 Ga0068868_100162428 3300005338 Bacteria 1845
10 Ga0068868_100418490 3300005338 Unclassified 1160
11 Ga0070660_100202601 3300005339 Bacteria 1610
12 Ga0070660_100295772 3300005339 Unclassified 1326
13 Ga0070692_10102054 3300005345 Bacteria 1574
14 Ga0070669_100690695 3300005353 Bacteria 861
15 Ga0070675_101444464 3300005354 Unclassified 634
16 Ga0070659_100118069 3300005366 Bacteria 2146
17 Ga0070659_100269204 3300005366 Bacteria 1415
18 Ga0070667_100079583 3300005367 Bacteria 2802
19 Ga0070709_10029447 3300005434 Bacteria 3284
20 Ga0070709_10694045 3300005434 Unclassified 791
21 Ga0070714_100014098 3300005435 Bacteria 6415
22 Ga0070714_100815508 3300005435 Bacteria 904
23 Ga0070714_101222481 3300005435 Bacteria 733
24 Ga0070710_10104313 3300005437 Bacteria 1693
25 Ga0070701_10127887 3300005438 Unclassified 1440
26 Ga0070711_100004096 3300005439 Bacteria 8571
27 Ga0070711_100350834 3300005439 Unclassified 1186
28 Ga0070711_100358582 3300005439 Unclassified 1174
29 Ga0070711_100685244 3300005439 Bacteria 862
30 Ga0070705_100031785 3300005440 Bacteria 2926
31 Ga0070705_100147703 3300005440 Unclassified 1556
32 Ga0070700_100108121 3300005441 Bacteria 1844
33 Ga0070700_100112313 3300005441 Bacteria 1814
34 Ga0070700_100334370 3300005441 Bacteria 1117
35 Ga0070700_100716421 3300005441 Bacteria 797
36 Ga0070694_100077820 3300005444 Bacteria 2299
37 Ga0070708_100014484 3300005445 Bacteria 6490
38 Ga0070708_100398057 3300005445 Unclassified 1298
39 Ga0070708_101079492 3300005445 Bacteria 752
40 Ga0070663_100108563 3300005455 Bacteria 2082
41 Ga0070678_100190389 3300005456 Bacteria 1686
42 Ga0070662_100053037 3300005457 Bacteria 2934
43 Ga0070681_10013739 3300005458 Bacteria 8060
44 Ga0070681_10086330 3300005458 Bacteria 3091
45 Ga0070685_10127209 3300005466 Bacteria 1589
46 Ga0070706_100096916 3300005467 Bacteria 2739
47 Ga0070706_100099003 3300005467 Bacteria 2709
48 Ga0070706_100705124 3300005467 Bacteria 936
49 Ga0070707_100054169 3300005468 Bacteria 3845
50 Ga0070707_100675896 3300005468 Bacteria 995
51 Ga0070707_101182012 3300005468 Bacteria 731
52 Ga0070698_100017945 3300005471 Bacteria 7452
53 Ga0070698_100072480 3300005471 Bacteria 3452
54 Ga0070698_100314949 3300005471 Bacteria 1495
55 Ga0070699_100056611 3300005518 Bacteria 3396
56 Ga0070679_100003135 3300005530 Bacteria 15116
57 Ga0070679_100043791 3300005530 Bacteria 4457
58 Ga0070679_100124954 3300005530 Bacteria 2555
59 Ga0070684_100507522 3300005535 Bacteria 1117
60 Ga0070684_100634432 3300005535 Bacteria 994
61 Ga0070697_100123580 3300005536 Bacteria 2166
62 Ga0070697_100666279 3300005536 Unclassified 917
63 Ga0068853_100026966 3300005539 Bacteria 4828
64 Ga0070672_101127983 3300005543 Unclassified 697
65 Ga0070686_100149982 3300005544 Bacteria 1632
66 Ga0070695_100038562 3300005545 Bacteria 3016
67 Ga0070696_100003272 3300005546 Bacteria 10807
68 Ga0070693_100026690 3300005547 Bacteria 3120
69 Ga0070693_100031096 3300005547 Bacteria 2924
70 Ga0070693_100891541 3300005547 Bacteria 666
71 Ga0070665_100834316 3300005548 Unclassified 935
72 Ga0070704_100029399 3300005549 Bacteria 3669
73 Ga0070704_100287218 3300005549 Bacteria 1365
74 Ga0068855_100017461 3300005563 Bacteria 8631
75 Ga0068855_100093282 3300005563 Bacteria 3472
76 Ga0068855_100408217 3300005563 Bacteria 1487
77 Ga0068855_100429154 3300005563 Bacteria 1445
78 Ga0068856_100050529 3300005614 Bacteria 4099
79 Ga0068856_100435393 3300005614 Unclassified 1331
80 Ga0068856_101377539 3300005614 Bacteria 720
81 Ga0068856_101479464 3300005614 Bacteria 693
82 Ga0070702_100264270 3300005615 Bacteria 1173
83 Ga0070702_100374233 3300005615 Unclassified 1011
84 Ga0070702_100495935 3300005615 Bacteria 896
85 Ga0068852_100680155 3300005616 Bacteria 1038
86 Ga0068859_100200429 3300005617 Unclassified 2080
87 Ga0068864_100951046 3300005618 Bacteria 850
88 Ga0068870_10940518 3300005840 Unclassified 613
89 Ga0068862_100635202 3300005844 Unclassified 1028
90 Ga0068862_100694725 3300005844 Bacteria 985
91 Ga0081455_10009272 3300005937 Bacteria 10136
92 Ga0081455_10022010 3300005937 Bacteria 5967
93 Ga0081455_10038232 3300005937 Bacteria 4251
94 Ga0081455_10105175 3300005937 Unclassified 2256
95 Ga0081538_10010717 3300005981 Bacteria 7502
96 Ga0081538_10019919 3300005981 Bacteria 4962
97 Ga0081540_1001966 3300005983 Bacteria 17151
98 Ga0070717_10203357 3300006028 Unclassified 1735
99 Ga0075363_100034507 3300006048 Bacteria 2642
100 Ga0075432_10064384 3300006058 Bacteria 1309
101 Ga0070715_10006018 3300006163 Bacteria 4092
102 Ga0070716_100624754 3300006173 Unclassified 813
103 Ga0070712_100017481 3300006175 Bacteria 4643
104 Ga0070712_100067297 3300006175 Bacteria 2548
105 Ga0097621_100085278 3300006237 Bacteria 2634
106 Ga0075428_100044325 3300006844 Bacteria 4888
107 Ga0075428_100277332 3300006844 Bacteria 1804
108 Ga0075430_100598455 3300006846 Bacteria 910
109 Ga0075431_100843237 3300006847 Bacteria 888
110 Ga0075433_10021234 3300006852 Bacteria 5443
111 Ga0075433_10171457 3300006852 Bacteria 1931
112 Ga0075433_10520678 3300006852 Bacteria 1046
113 Ga0075434_100151602 3300006871 Bacteria 2338
114 Ga0097620_100200429 3300006931 Unclassified 2080
115 Ga0075435_100206711 3300007076 Unclassified 1664
116 Ga0105240_10261124 3300009093 Bacteria 1998
117 Ga0105240_10469028 3300009093 Bacteria 1405
118 Ga0111539_10054963 3300009094 Bacteria 4734
119 Ga0111539_10122888 3300009094 Unclassified 3043
120 Ga0111539_10272920 3300009094 Unclassified 1968
121 Ga0111539_11000038 3300009094 Unclassified 972
122 Ga0111539_11029963 3300009094 Unclassified 957
123 Ga0105245_10013645 3300009098 Bacteria 7078
124 Ga0105245_10062442 3300009098 Unclassified 3361
125 Ga0105245_10450854 3300009098 Bacteria 1295
126 Ga0105245_10532905 3300009098 Bacteria 1194
127 Ga0105245_10788554 3300009098 Unclassified 988
128 Ga0105247_10043532 3300009101 Bacteria 2751
129 Ga0114129_10195728 3300009147 Bacteria 2741
130 Ga0105243_10498882 3300009148 Unclassified 1153
131 Ga0105243_10637591 3300009148 Bacteria 1031
132 Ga0105243_11435518 3300009148 Unclassified 712
133 Ga0105242_10363613 3300009176 Bacteria 1340
134 Ga0105248_10065244 3300009177 Bacteria 4088
135 Ga0105248_10604891 3300009177 Bacteria 1237
136 Ga0105248_10617742 3300009177 Bacteria 1223
137 Ga0105237_10170491 3300009545 Bacteria 2176
138 Ga0105237_10506382 3300009545 Bacteria 1214
139 Ga0105238_10282109 3300009551 Bacteria 1642
140 Ga0105238_10507412 3300009551 Bacteria 1207
141 Ga0105238_10968607 3300009551 Bacteria 871
142 Ga0105249_10575943 3300009553 Bacteria 1178
143 Ga0105249_10762845 3300009553 Bacteria 1030
144 Ga0105249_11261095 3300009553 Unclassified 810
145 Ga0105239_10187385 3300010375 Bacteria 2316
146 Ga0105239_10372108 3300010375 Bacteria 1615
147 Ga0105239_10549676 3300010375 Bacteria 1315
148 Ga0105239_10643986 3300010375 Unclassified 1210
149 Ga0105239_11220699 3300010375 Bacteria 867
150 Ga0105246_10728618 3300011119 Bacteria 872
151 Ga0157373_10022382 3300013100 Bacteria 4585
152 Ga0157371_10002661 3300013102 Bacteria 16890
153 Ga0157370_10011419 3300013104 Bacteria 9289
154 Ga0157370_10292208 3300013104 Bacteria 1505
155 Ga0157369_10013070 3300013105 Bacteria 9401
156 Ga0157374_10096311 3300013296 Bacteria 2831
157 Ga0157378_10071970 3300013297 Bacteria 3106
158 Ga0157372_10346181 3300013307 Bacteria 1732
159 Ga0157380_10025897 3300014326 Bacteria 4450
160 Ga0157380_10232124 3300014326 Bacteria 1658
161 Ga0157380_10590231 3300014326 Unclassified 1097
162 Ga0182008_10066925 3300014497 Bacteria 1768
163 Ga0157377_10147320 3300014745 Bacteria 1452
164 Ga0157377_10856215 3300014745 Unclassified 675
165 Ga0157379_10470670 3300014968 Unclassified 1162
166 Ga0157379_10576008 3300014968 Bacteria 1049
167 Ga0157376_10104992 3300014969 Bacteria 2477
168 Ga0163161_10003917 3300017792 Bacteria 10441
169 Ga0163161_10683310 3300017792 Unclassified 853
170 Ga0206354_11335426 3300020081 Bacteria 1770
171 Ga0206353_10236700 3300020082 Bacteria 908
172 Ga0207653_10005636 3300025885 Bacteria 3909
173 Ga0207653_10052238 3300025885 Bacteria 1362
174 Ga0207692_10092772 3300025898 Bacteria 1641
175 Ga0207710_10051583 3300025900 Bacteria 1848
176 Ga0207680_10262748 3300025903 Unclassified 1195
177 Ga0207685_10031310 3300025905 Bacteria 1903
178 Ga0207699_10021475 3300025906 Bacteria 3480
179 Ga0207699_10135647 3300025906 Bacteria 1611
180 Ga0207705_10001810 3300025909 Bacteria 16853
181 Ga0207705_10670462 3300025909 Bacteria 806
182 Ga0207684_10151540 3300025910 Bacteria 1995
183 Ga0207684_10405267 3300025910 Unclassified 1172
184 Ga0207654_10292757 3300025911 Unclassified 1105
185 Ga0207707_10013934 3300025912 Bacteria 7011
186 Ga0207707_10038293 3300025912 Bacteria 4190
187 Ga0207695_10180615 3300025913 Bacteria 2031
188 Ga0207695_10205165 3300025913 Bacteria 1884
189 Ga0207671_10449881 3300025914 Bacteria 1026
190 Ga0207693_10004357 3300025915 Bacteria 11970
191 Ga0207693_10006371 3300025915 Bacteria 9779
192 Ga0207693_10057964 3300025915 Bacteria 3034
193 Ga0207663_10042045 3300025916 Bacteria 2790
194 Ga0207663_10115836 3300025916 Bacteria 1826
195 Ga0207660_10001941 3300025917 Bacteria 13795
196 Ga0207660_10183191 3300025917 Bacteria 1627
197 Ga0207657_10015898 3300025919 Bacteria 7270
198 Ga0207657_11015416 3300025919 Bacteria 636
199 Ga0207652_10023476 3300025921 Bacteria 5110
200 Ga0207652_10141938 3300025921 Bacteria 2148
201 Ga0207646_10008409 3300025922 Bacteria 10348
202 Ga0207694_10222761 3300025924 Bacteria 1539
203 Ga0207694_10223783 3300025924 Bacteria 1535
204 Ga0207687_10065412 3300025927 Unclassified 2582
205 Ga0207687_10126078 3300025927 Bacteria 1922
206 Ga0207687_10287562 3300025927 Bacteria 1320
207 Ga0207687_10595567 3300025927 Unclassified 931
208 Ga0207664_10073093 3300025929 Bacteria 2766
209 Ga0207664_11159756 3300025929 Bacteria 690
210 Ga0207690_10023173 3300025932 Bacteria 3873
211 Ga0207690_10305401 3300025932 Bacteria 1246
212 Ga0207706_10013207 3300025933 Bacteria 7513
213 Ga0207686_10043082 3300025934 Bacteria 2763
214 Ga0207709_10820086 3300025935 Bacteria 752
215 Ga0207704_10418236 3300025938 Unclassified 1062
216 Ga0207704_10740648 3300025938 Bacteria 817
217 Ga0207711_10326954 3300025941 Bacteria 1418
218 Ga0207711_10356293 3300025941 Bacteria 1355
219 Ga0207711_10906021 3300025941 Bacteria 820
220 Ga0207689_10075014 3300025942 Unclassified 2780
221 Ga0207667_10010827 3300025949 Bacteria 10636
222 Ga0207667_10169986 3300025949 Bacteria 2240
223 Ga0207651_10058528 3300025960 Bacteria 2664
224 Ga0207651_11177736 3300025960 Bacteria 688
225 Ga0207668_10121200 3300025972 Bacteria 1981
226 Ga0207668_10477358 3300025972 Bacteria 1069
227 Ga0207658_10057147 3300025986 Bacteria 2898
228 Ga0207658_10815825 3300025986 Unclassified 847
229 Ga0207677_10539755 3300026023 Unclassified 1015
230 Ga0207677_10910379 3300026023 Unclassified 793
231 Ga0207678_10049641 3300026067 Unclassified 3626
232 Ga0207708_10204225 3300026075 Bacteria 1577
233 Ga0207708_10246334 3300026075 Bacteria 1439
234 Ga0207708_10320519 3300026075 Bacteria 1265
235 Ga0207702_10499462 3300026078 Bacteria 1186
236 Ga0207702_11370027 3300026078 Bacteria 701
237 Ga0207641_10051262 3300026088 Bacteria 3495
238 Ga0207648_11276691 3300026089 Bacteria 690
239 Ga0207676_10773189 3300026095 Bacteria 935
240 Ga0207675_100008083 3300026118 Bacteria 9908
241 Ga0207683_10154423 3300026121 Bacteria 2073
242 Ga0207698_11017534 3300026142 Bacteria 840
243 Ga0207428_10187575 3300027907 Unclassified 1560
244 Ga0268266_10442981 3300028379 Bacteria 1234
245 Ga0268265_11526606 3300028380 Unclassified 672
246 Ga0268264_10302563 3300028381 Bacteria 1506
247 Ga0316575_10015016 3300031665 Bacteria 2916
248 Ga0316575_10214017 3300031665 Unclassified 804
249 Ga0316576_10014417 3300031727 Bacteria 5281
250 Ga0316576_10179382 3300031727 Bacteria 1597
251 Ga0316578_10058028 3300031728 Bacteria 2275
252 Ga0316578_10088984 3300031728 Bacteria 1842
253 Ga0316577_10219788 3300031733 Bacteria 1074
254 Ga0307413_10141688 3300031824 Bacteria 1662
255 Ga0307413_11395969 3300031824 Bacteria 616
256 Ga0307410_11600241 3300031852 Bacteria 576
257 Ga0307406_10228569 3300031901 Unclassified 1388
258 Ga0307406_10476779 3300031901 Unclassified 1007
259 Ga0307409_100033454 3300031995 Bacteria 3741
260 Ga0307416_100057263 3300032002 Bacteria 3152
261 Ga0307416_100093732 3300032002 Bacteria 2588
262 Ga0307414_10763416 3300032004 Bacteria 880
263 Ga0307415_100026283 3300032126 Bacteria 3669
264 Ga0316585_10016121 3300032137 Bacteria 2248
265 Ga0316580_10005826 3300032139 Bacteria 3617
266 Ga0373938_0007310 3300034957 Bacteria 1939
267 Ga0373926_0077372 3300035083 Bacteria 1227
268 Ga0373949_0002804 3300035090 Bacteria 4337
269 Ga0373949_0275002 3300035090 Unclassified 528
270 Ga0373952_0003269 3300035092 Bacteria 2918
271 Ga0373932_0011731 3300035112 Bacteria 2146
272 Ga0373939_0092717 3300035114 Bacteria 1023
273 Ga0373941_0002276 3300035115 Bacteria 4199
274 Ga0373960_0000378 3300035121 Bacteria 8629
275 Ga0373946_0058625 3300035171 Bacteria 1632
276 Ga0373946_0534809 3300035171 Bacteria 603
277 Ga0373942_0002949 3300035207 Bacteria 4035
278 Ga0373961_0016235 3300035241 Bacteria 1916
279 Ga0373962_0004663 3300035242 Bacteria 3308
280 Ga0316574_0084213 3300035398 Bacteria 2022
281 Ga0316574_0143170 3300035398 Bacteria 1540
282 Ga0316574_0168002 3300035398 Bacteria 1412
283 Ga0373931_0044356 3300035691 Bacteria 2344
284 Ga0373947_0046537 3300035725 Bacteria 2598
285 Ga0316582_0016510 3300036647 Bacteria 4247
286 Ga0316584_0091934 3300036712 Bacteria 2272
287 Ga0373925_0047154 3300037068 Bacteria 3207
288 Ga0373925_0121809 3300037068 Bacteria 2025
289 Ga0395899_0036474 3300037312 Bacteria 3688
290 Ga0395900_0006083 3300037418 Bacteria 12586
291 Ga0395900_0023439 3300037418 Bacteria 6317
292 Ga0395900_0232628 3300037418 Unclassified 1853
293 Ga0395900_0642523 3300037418 Bacteria 998
294 Ga0395898_0003618 3300037466 Bacteria 17207
295 Ga0395898_0090514 3300037466 Unclassified 2944
296 Ga0395898_0126707 3300037466 Bacteria 2446
297 Ga0395898_0163493 3300037466 Bacteria 2129
298 Ga0395898_0287007 3300037466 Bacteria 1570
299 Ga0395905_0004370 3300037471 Bacteria 14713
300 Ga0395905_0037945 3300037471 Bacteria 4521
301 Ga0395905_0048472 3300037471 Bacteria 3981
302 Ga0395905_0099939 3300037471 Bacteria 2724
303 Ga0395905_1139574 3300037471 Unclassified 683
304 Ga0395901_0010913 3300038443 Bacteria 9205
305 Ga0395901_0062155 3300038443 Bacteria 3886
306 Ga0395901_0495558 3300038443 Bacteria 1244
307 Ga0242420_000347 3300038996 Bacteria 5142
308 Ga0436360_1256040 3300039438 Bacteria 1088
309 Ga0436362_0593504 3300039453 Unclassified 583
310 Ga0451577_0051600 3300042876 Bacteria 3672
311 Ga0453683_0249510 3300044673 Unclassified 1131
312 Ga0451576_0302795 3300045051 Bacteria 1672
313 Ga0466967_0045233 3300045976 Bacteria 3824
314 Ga0495592_0046228 3300046454 Bacteria 3245
315 Ga0495651_0700389 3300046462 Bacteria 631
316 Ga0495640_0163031 3300046533 Unclassified 1427
317 Ga0495586_0001602 3300046535 Bacteria 12439
318 Ga0495586_0602927 3300046535 Unclassified 634
319 Ga0495667_0007190 3300046559 Bacteria 7553
320 Ga0495667_0199625 3300046559 Bacteria 1280
321 Ga0495656_0384756 3300046615 Unclassified 732
322 Ga0495634_0076671 3300046642 Bacteria 2194
323 Ga0495634_0086290 3300046642 Bacteria 2044
324 Ga0495599_0115034 3300046678 Bacteria 1674
325 Ga0495646_0351852 3300046680 Bacteria 772
326 Ga0495658_0069438 3300046683 Bacteria 2042
327 Ga0495613_0225851 3300046689 Bacteria 1313
328 Ga0495624_0653805 3300046690 Bacteria 625
329 Ga0495600_0024077 3300046809 Bacteria 3919
330 Ga0495604_0027877 3300047317 Bacteria 4492
331 Ga0495674_0034739 3300047319 Bacteria 4555
332 Ga0495676_0024130 3300047321 Bacteria 5269
333 Ga0495680_0014563 3300047322 Bacteria 6808
334 Ga0495680_0059482 3300047322 Bacteria 2950
335 Ga0495684_0009701 3300047471 Bacteria 7426
336 Ga0496101_0088187 3300048904 Bacteria 2304
337 Ga0496102_0059073 3300048905 Bacteria 3506
338 Ga0496104_0047192 3300048907 Bacteria 4059
339 Ga0496104_0057385 3300048907 Bacteria 3683
340 Ga0496105_0005385 3300048908 Bacteria 9705
341 Ga0496105_0083529 3300048908 Bacteria 2637
342 Ga0496105_0115934 3300048908 Bacteria 2209
343 Ga0496105_0958560 3300048908 Unclassified 642
344 Ga0496108_1254198 3300048911 Bacteria 625
345 Ga0496109_0066843 3300048912 Bacteria 3292
346 Ga0496110_0126609 3300048913 Bacteria 2305
347 Ga0496110_0153623 3300048913 Unclassified 2084
348 Ga0496110_0247127 3300048913 Bacteria 1624
349 Ga0496111_0140789 3300048914 Bacteria 1787
350 Ga0496111_0409581 3300048914 Bacteria 1002
351 Ga0496111_0482048 3300048914 Bacteria 914
352 Ga0496113_0094524 3300048916 Unclassified 2309
353 Ga0496114_0008882 3300048917 Bacteria 7966
354 Ga0496114_0014401 3300048917 Bacteria 6348
355 Ga0496114_0536396 3300048917 Unclassified 1034
356 Ga0496115_0255772 3300048918 Unclassified 1441
357 Ga0501031_0026715 3300049568 Bacteria 3763
358 Ga0501034_0042353 3300049571 Bacteria 4609
359 Ga0501034_0221123 3300049571 Bacteria 1846
360 Ga0501034_0466291 3300049571 Unclassified 1179
361 Ga0501036_0049870 3300049572 Bacteria 3546
362 Ga0501036_0589051 3300049572 Bacteria 923
363 Ga0501036_0806459 3300049572 Bacteria 773
364 Ga0501037_0030843 3300049573 Bacteria 3960
365 Ga0501037_0245172 3300049573 Bacteria 1255
366 Ga0501038_0569161 3300049574 Unclassified 860
367 Ga0501039_0057236 3300049575 Bacteria 3019
368 Ga0501039_0218999 3300049575 Bacteria 1497
369 Ga0501040_0064221 3300049576 Bacteria 2527
370 Ga0501040_0595338 3300049576 Bacteria 799
371 Ga0501041_0069681 3300049577 Bacteria 2158
372 Ga0501043_0873205 3300049579 Unclassified 647
373 Ga0501067_0598370 3300049583 Bacteria 618
374 Ga0501068_0737107 3300049584 Bacteria 645
375 Ga0501069_0594399 3300049585 Unclassified 664
376 Ga0501070_0020611 3300049586 Bacteria 5529
377 Ga0501070_0203864 3300049586 Bacteria 1624
378 Ga0501072_0037984 3300049588 Bacteria 3779
379 Ga0501075_0021923 3300049591 Bacteria 4662
380 Ga0501076_0034697 3300049592 Bacteria 3945
381 Ga0501077_0064147 3300049593 Bacteria 2330
382 Ga0501079_0112074 3300049741 Bacteria 2120
383 Ga0501044_0039712 3300049823 Bacteria 4908
384 Ga0501044_0369113 3300049823 Bacteria 1352
385 Ga0501045_0210453 3300049824 Bacteria 1448
386 Ga0501045_0485457 3300049824 Bacteria 918
387 nmdc:mga05p37_832026_c1 3300050507 Bacteria 1005
388 nmdc:mga06r32_160065_c1 3300050510 Bacteria 2233
389 nmdc:mga08y16_108072_c1 3300050511 Unclassified 2896
390 nmdc:mga08y16_1486092_c1 3300050511 Bacteria 638
391 nmdc:mga0rr50_142903_c1 3300050513 Unclassified 1927
392 nmdc:mga0rr50_816332_c1 3300050513 Unclassified 796
393 nmdc:mga08x19_670719_c1 3300050514 Unclassified 736
394 nmdc:mga0a205_178962_c1 3300050515 Bacteria 2015
395 Ga0495601_0004660 3300053077 Bacteria 7936
396 Ga0495601_0022133 3300053077 Bacteria 3901
397 Ga0495595_0038696 3300053084 Bacteria 2174
398 Ga0495619_0010800 3300053085 Bacteria 5746
399 Ga0495619_0018730 3300053085 Bacteria 4395
400 Ga0501084_0049507 3300054114 Bacteria 3518
401 Ga0501084_0715539 3300054114 Unclassified 844
402 Ga0501082_0180453 3300060353 Bacteria 1836
403 Ga0530510_0010235 3300061734 Bacteria 6570
404 2643896305 2643221577 Bacteria 3710843
405 2644478520 2643221685 Bacteria 3673288
406 2895397834 2895395659 Bacteria 3983269
407 Ga0395899_0064021
408 JGI24743J22301_10025025
409 Ga0070658_10004578
410 Ga0070658_10407419
411 Ga0070666_10120304
412 Ga0070680_100005348
413 Ga0070682_100276339
414 Ga0068868_100120300
415 Ga0068868_100162428
416 Ga0068868_100418490
417 Ga0070660_100202601
418 Ga0070660_100295772
419 Ga0070692_10102054
420 Ga0070669_100690695
421 Ga0070675_101444464
422 Ga0070659_100118069
423 Ga0070659_100269204
424 Ga0070667_100079583
425 Ga0070709_10029447
426 Ga0070709_10694045
427 Ga0070714_100014098
428 Ga0070714_100815508
429 Ga0070714_101222481
430 Ga0070710_10104313
431 Ga0070701_10127887
432 Ga0070711_100004096
433 Ga0070711_100350834
434 Ga0070711_100358582
435 Ga0070711_100685244
436 Ga0070705_100031785
437 Ga0070705_100147703
438 Ga0070700_100108121
439 Ga0070700_100112313
440 Ga0070700_100334370
441 Ga0070700_100716421
442 Ga0070694_100077820
443 Ga0070708_100014484
444 Ga0070708_100398057
445 Ga0070708_101079492
446 Ga0070663_100108563
447 Ga0070678_100190389
448 Ga0070662_100053037
449 Ga0070681_10013739
450 Ga0070681_10086330
451 Ga0070685_10127209
452 Ga0070706_100096916
453 Ga0070706_100099003
454 Ga0070706_100705124
455 Ga0070707_100054169
456 Ga0070707_100675896
457 Ga0070707_101182012
458 Ga0070698_100017945
459 Ga0070698_100072480
460 Ga0070698_100314949
461 Ga0070699_100056611
462 Ga0070679_100003135
463 Ga0070679_100043791
464 Ga0070679_100124954
465 Ga0070684_100507522
466 Ga0070684_100634432
467 Ga0070697_100123580
468 Ga0070697_100666279
469 Ga0068853_100026966
470 Ga0070672_101127983
471 Ga0070686_100149982
472 Ga0070695_100038562
473 Ga0070696_100003272
474 Ga0070693_100026690
475 Ga0070693_100031096
476 Ga0070693_100891541
477 Ga0070665_100834316
478 Ga0070704_100029399
479 Ga0070704_100287218
480 Ga0068855_100017461
481 Ga0068855_100093282
482 Ga0068855_100408217
483 Ga0068855_100429154
484 Ga0068856_100050529
485 Ga0068856_100435393
486 Ga0068856_101377539
487 Ga0068856_101479464
488 Ga0070702_100264270
489 Ga0070702_100374233
490 Ga0070702_100495935
491 Ga0068852_100680155
492 Ga0068859_100200429
493 Ga0068864_100951046
494 Ga0068870_10940518
495 Ga0068862_100635202
496 Ga0068862_100694725
497 Ga0081455_10009272
498 Ga0081455_10022010
499 Ga0081455_10038232
500 Ga0081455_10105175
501 Ga0081538_10010717
502 Ga0081538_10019919
503 Ga0081540_1001966
504 Ga0070717_10203357
505 Ga0075363_100034507
506 Ga0075432_10064384
507 Ga0070715_10006018
508 Ga0070716_100624754
509 Ga0070712_100017481
510 Ga0070712_100067297
511 Ga0097621_100085278
512 Ga0075428_100044325
513 Ga0075428_100277332
514 Ga0075430_100598455
515 Ga0075431_100843237
516 Ga0075433_10021234
517 Ga0075433_10171457
518 Ga0075433_10520678
519 Ga0075434_100151602
520 Ga0097620_100200429
521 Ga0075435_100206711
522 Ga0105240_10261124
523 Ga0105240_10469028
524 Ga0111539_10054963
525 Ga0111539_10122888
526 Ga0111539_10272920
527 Ga0111539_11000038
528 Ga0111539_11029963
529 Ga0105245_10013645
530 Ga0105245_10062442
531 Ga0105245_10450854
532 Ga0105245_10532905
533 Ga0105245_10788554
534 Ga0105247_10043532
535 Ga0114129_10195728
536 Ga0105243_10498882
537 Ga0105243_10637591
538 Ga0105243_11435518
539 Ga0105242_10363613
540 Ga0105248_10065244
541 Ga0105248_10604891
542 Ga0105248_10617742
543 Ga0105237_10170491
544 Ga0105237_10506382
545 Ga0105238_10282109
546 Ga0105238_10507412
547 Ga0105238_10968607
548 Ga0105249_10575943
549 Ga0105249_10762845
550 Ga0105249_11261095
551 Ga0105239_10187385
552 Ga0105239_10372108
553 Ga0105239_10549676
554 Ga0105239_10643986
555 Ga0105239_11220699
556 Ga0105246_10728618
557 Ga0157373_10022382
558 Ga0157371_10002661
559 Ga0157370_10011419
560 Ga0157370_10292208
561 Ga0157369_10013070
562 Ga0157374_10096311
563 Ga0157378_10071970
564 Ga0157372_10346181
565 Ga0157380_10025897
566 Ga0157380_10232124
567 Ga0157380_10590231
568 Ga0182008_10066925
569 Ga0157377_10147320
570 Ga0157377_10856215
571 Ga0157379_10470670
572 Ga0157379_10576008
573 Ga0157376_10104992
574 Ga0163161_10003917
575 Ga0163161_10683310
576 Ga0206354_11335426
577 Ga0206353_10236700
578 Ga0207653_10005636
579 Ga0207653_10052238
580 Ga0207692_10092772
581 Ga0207710_10051583
582 Ga0207680_10262748
583 Ga0207685_10031310
584 Ga0207699_10021475
585 Ga0207699_10135647
586 Ga0207705_10001810
587 Ga0207705_10670462
588 Ga0207684_10151540
589 Ga0207684_10405267
590 Ga0207654_10292757
591 Ga0207707_10013934
592 Ga0207707_10038293
593 Ga0207695_10180615
594 Ga0207695_10205165
595 Ga0207671_10449881
596 Ga0207693_10004357
597 Ga0207693_10006371
598 Ga0207693_10057964
599 Ga0207663_10042045
600 Ga0207663_10115836
601 Ga0207660_10001941
602 Ga0207660_10183191
603 Ga0207657_10015898
604 Ga0207657_11015416
605 Ga0207652_10023476
606 Ga0207652_10141938
607 Ga0207646_10008409
608 Ga0207694_10222761
609 Ga0207694_10223783
610 Ga0207687_10065412
611 Ga0207687_10126078
612 Ga0207687_10287562
613 Ga0207687_10595567
614 Ga0207664_10073093
615 Ga0207664_11159756
616 Ga0207690_10023173
617 Ga0207690_10305401
618 Ga0207706_10013207
619 Ga0207686_10043082
620 Ga0207709_10820086
621 Ga0207704_10418236
622 Ga0207704_10740648
623 Ga0207711_10326954
624 Ga0207711_10356293
625 Ga0207711_10906021
626 Ga0207689_10075014
627 Ga0207667_10010827
628 Ga0207667_10169986
629 Ga0207651_10058528
630 Ga0207651_11177736
631 Ga0207668_10121200
632 Ga0207668_10477358
633 Ga0207658_10057147
634 Ga0207658_10815825
635 Ga0207677_10539755
636 Ga0207677_10910379
637 Ga0207678_10049641
638 Ga0207708_10204225
639 Ga0207708_10246334
640 Ga0207708_10320519
641 Ga0207702_10499462
642 Ga0207702_11370027
643 Ga0207641_10051262
644 Ga0207648_11276691
645 Ga0207676_10773189
646 Ga0207675_100008083
647 Ga0207683_10154423
648 Ga0207698_11017534
649 Ga0207428_10187575
650 Ga0268266_10442981
651 Ga0268265_11526606
652 Ga0268264_10302563
653 Ga0316575_10015016
654 Ga0316575_10214017
655 Ga0316576_10014417
656 Ga0316576_10179382
657 Ga0316578_10058028
658 Ga0316578_10088984
659 Ga0316577_10219788
660 Ga0307413_10141688
661 Ga0307413_11395969
662 Ga0307410_11600241
663 Ga0307406_10228569
664 Ga0307406_10476779
665 Ga0307409_100033454
666 Ga0307416_100057263
667 Ga0307416_100093732
668 Ga0307414_10763416
669 Ga0307415_100026283
670 Ga0316585_10016121
671 Ga0316580_10005826
672 Ga0373938_0007310
673 Ga0373926_0077372
674 Ga0373949_0002804
675 Ga0373949_0275002
676 Ga0373952_0003269
677 Ga0373932_0011731
678 Ga0373939_0092717
679 Ga0373941_0002276
680 Ga0373960_0000378
681 Ga0373946_0058625
682 Ga0373946_0534809
683 Ga0373942_0002949
684 Ga0373961_0016235
685 Ga0373962_0004663
686 Ga0316574_0084213
687 Ga0316574_0143170
688 Ga0316574_0168002
689 Ga0373931_0044356
690 Ga0373947_0046537
691 Ga0316582_0016510
692 Ga0316584_0091934
693 Ga0373925_0047154
694 Ga0373925_0121809
695 Ga0395899_0036474
696 Ga0395900_0006083
697 Ga0395900_0023439
698 Ga0395900_0232628
699 Ga0395900_0642523
700 Ga0395898_0003618
701 Ga0395898_0090514
702 Ga0395898_0126707
703 Ga0395898_0163493
704 Ga0395898_0287007
705 Ga0395905_0004370
706 Ga0395905_0037945
707 Ga0395905_0048472
708 Ga0395905_0099939
709 Ga0395905_1139574
710 Ga0395901_0010913
711 Ga0395901_0062155
712 Ga0395901_0495558
713 Ga0242420_000347
714 Ga0436360_1256040
715 Ga0436362_0593504
716 Ga0451577_0051600
717 Ga0453683_0249510
718 Ga0451576_0302795
719 Ga0466967_0045233
720 Ga0495592_0046228
721 Ga0495651_0700389
722 Ga0495640_0163031
723 Ga0495586_0001602
724 Ga0495586_0602927
725 Ga0495667_0007190
726 Ga0495667_0199625
727 Ga0495656_0384756
728 Ga0495634_0076671
729 Ga0495634_0086290
730 Ga0495599_0115034
731 Ga0495646_0351852
732 Ga0495658_0069438
733 Ga0495613_0225851
734 Ga0495624_0653805
735 Ga0495600_0024077
736 Ga0495604_0027877
737 Ga0495674_0034739
738 Ga0495676_0024130
739 Ga0495680_0014563
740 Ga0495680_0059482
741 Ga0495684_0009701
742 Ga0496101_0088187
743 Ga0496102_0059073
744 Ga0496104_0047192
745 Ga0496104_0057385
746 Ga0496105_0005385
747 Ga0496105_0083529
748 Ga0496105_0115934
749 Ga0496105_0958560
750 Ga0496108_1254198
751 Ga0496109_0066843
752 Ga0496110_0126609
753 Ga0496110_0153623
754 Ga0496110_0247127
755 Ga0496111_0140789
756 Ga0496111_0409581
757 Ga0496111_0482048
758 Ga0496113_0094524
759 Ga0496114_0008882
760 Ga0496114_0014401
761 Ga0496114_0536396
762 Ga0496115_0255772
763 Ga0501031_0026715
764 Ga0501034_0042353
765 Ga0501034_0221123
766 Ga0501034_0466291
767 Ga0501036_0049870
768 Ga0501036_0589051
769 Ga0501036_0806459
770 Ga0501037_0030843
771 Ga0501037_0245172
772 Ga0501038_0569161
773 Ga0501039_0057236
774 Ga0501039_0218999
775 Ga0501040_0064221
776 Ga0501040_0595338
777 Ga0501041_0069681
778 Ga0501043_0873205
779 Ga0501067_0598370
780 Ga0501068_0737107
781 Ga0501069_0594399
782 Ga0501070_0020611
783 Ga0501070_0203864
784 Ga0501072_0037984
785 Ga0501075_0021923
786 Ga0501076_0034697
787 Ga0501077_0064147
788 Ga0501079_0112074
789 Ga0501044_0039712
790 Ga0501044_0369113
791 Ga0501045_0210453
792 Ga0501045_0485457
793 nmdc:mga05p37_832026_c1
794 nmdc:mga06r32_160065_c1
795 nmdc:mga08y16_108072_c1
796 nmdc:mga08y16_1486092_c1
797 nmdc:mga0rr50_142903_c1
798 nmdc:mga0rr50_816332_c1
799 nmdc:mga08x19_670719_c1
800 nmdc:mga0a205_178962_c1
801 Ga0495601_0004660
802 Ga0495601_0022133
803 Ga0495595_0038696
804 Ga0495619_0010800
805 Ga0495619_0018730
806 Ga0501084_0049507
807 Ga0501084_0715539
808 Ga0501082_0180453
809 Ga0530510_0010235
810 2643896305
811 2644478520
812 2895397834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

25

111

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hbz-assembly1.cif.gz_A the structure of putative phosphohistidine phosphatase sixa from nakamurella multipartitia. 0.9014 14 171
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8873 13 169
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8855 16 169
2rfl-assembly3.cif.gz_C crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8802 15 169
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8709 13 169
ID Description Score Start End Superfamily
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.937 12 170 3.40.50.1240
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9147 21 170 3.40.50.1240
4hbzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8929 14 171 3.40.50.1240
af_A4I981_30_194_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8928 21 93 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8689 16 169 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A4R8WCH6-F1-model_v4 Histidine phosphatase family protein 0.9934 15 170
AF-A0A853CSE9-F1-model_v4 Phosphohistidine phosphatase (EC 3.1.3.-) 0.992 15 170 GO:0016787
AF-A0A7V9KUI4-F1-model_v4 Histidine phosphatase family protein 0.9865 12 172
AF-A0A3C1DYC3-F1-model_v4 Histidine phosphatase family protein 0.9854 39 170
AF-A0A7J9W5D9-F1-model_v4 Histidine phosphatase family protein 0.9852 12 168

Map