F436262

General Info

Members Datasets Scaffolds Average Seq Length
406 283 812 427

Family's Representative Sequence

Representative Sequence 3300035117|Ga0373953_0001225|Ga0373953_0001225_1349_2827
Length 487
Sequence VRTDFTEQQLADPDTNESEKILRKCTHCGFCTATCPTYLLLSDELDSPRGRIYLIKDMLASNAAPSADTVKHIDRCLSTTCPSGVNYMHLVDHGRRWIEEKYRRPWAERAVRRMLGTVLPRPWLFRMALHGAALARPFARSLXXHLAPMMALAPATIPRASATDNRRVFPAEGERRMRVALLPSCAQRVLMPEINEATIRLLTRHGCEVVLAPGSGCCGSLNHHLGQEESALAFARGNIAAWERERLVGGLDAIVINASGCGTTVKDYGFMLREDPVYAEKAARISSLARDVTEVIGQLGLRTPPAENAAQGLRVAYHSACSMQHGQQLHRVPKALLTAAGFETIEVPEGHICCGSAGTYNLLQPEIASRLRDRKLANIAKTRPDVVATGNIGCITQLMLGSDVPVVHTVELLDWATGGPEPTAMRSDYPARWRARAGISKVSPNAAAPITVGVSQPVRPKANCSPAAPRSTQAIVIGNWPISDPNA

Samples

Sample ID Description Type Environment
1 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
212 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
215 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
216 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
219 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
224 2516143018 Ensifer sp. BR816 Isolate Nodule
225 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
226 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
227 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
228 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
229 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
230 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
231 2643221736 Bosea sp. Root483D1 Isolate Unclassified
232 2718217927 Rhizobium sp. N324 Isolate Nodule
233 2718218423 Rhizobium sp. N941 Isolate Nodule
234 2721755809 Rhizobium sp. N541 Isolate Nodule
235 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
236 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
237 2791355256 Rhizobium sp. M10 Isolate Nodule
238 2791355262 Rhizobium sp. M1 Isolate Nodule
239 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
240 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
241 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
242 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
243 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
244 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
245 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
246 2841760612 Bosea sp. Tri-49 Isolate Nodule
247 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
248 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
249 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
250 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
251 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
252 2842694124 Methylopila sp. R-72369 Isolate Unclassified
253 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
254 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
255 2851182111 Bosea sp. Tri-44 Isolate Nodule
256 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
257 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
258 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
259 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
260 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
261 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
262 2902330777 Methylobacterium sp. 2A Isolate Unclassified
263 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
264 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
265 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
266 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
267 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
268 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
269 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
270 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
271 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
272 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
273 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
274 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
275 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
276 641522639 Methylobacterium sp. 4-46 Isolate Nodule
277 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
278 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
279 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
280 8005275841 Rhizobium sp. N4311 Isolate Nodule
281 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
282 8018176218 Rhizobium sp. N122 Isolate Nodule
283 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.73
Metatranscriptomes 0
Isolates 15.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.85
Nodule 9.61
Rhizoplane 5.17
Rhizosphere 63.55
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373953_0001225 3300035117 Bacteria 7318
2 JGI25159J45721_1004048 3300002987 Bacteria 4984
3 JGI25151J46595_10034827 3300003187 Bacteria 1920
4 JGI25406J46586_10019667 3300003203 Bacteria 2745
5 Ga0055536_1007330 3300003781 Bacteria 4959
6 Ga0055531_10002864 3300003794 Bacteria 11242
7 Ga0055531_10009385 3300003794 Bacteria 5001
8 Ga0065165_1000577 3300005262 Bacteria 54256
9 Ga0070658_10004576 3300005327 Bacteria 11239
10 Ga0070676_10047800 3300005328 Bacteria 2500
11 Ga0070670_100016187 3300005331 Bacteria 6401
12 Ga0070670_100034525 3300005331 Bacteria 4352
13 Ga0070670_100251401 3300005331 Bacteria 1540
14 Ga0068869_100019342 3300005334 Bacteria 4651
15 Ga0070689_100076013 3300005340 Bacteria 2630
16 Ga0070691_10008828 3300005341 Bacteria 4614
17 Ga0070687_100100034 3300005343 Bacteria 1622
18 Ga0070661_100000041 3300005344 Bacteria 99916
19 Ga0070668_100003127 3300005347 Bacteria 12231
20 Ga0070668_100010721 3300005347 Bacteria 6815
21 Ga0070669_100059372 3300005353 Bacteria 2808
22 Ga0070669_100108458 3300005353 Bacteria 2104
23 Ga0070675_100011721 3300005354 Bacteria 6868
24 Ga0070675_100100816 3300005354 Bacteria 2432
25 Ga0070671_100026930 3300005355 Bacteria 4729
26 Ga0070674_100064774 3300005356 Bacteria 2563
27 Ga0070667_100070511 3300005367 Bacteria 2975
28 Ga0070714_100022279 3300005435 Bacteria 5193
29 Ga0070713_100142880 3300005436 Bacteria 2121
30 Ga0070700_100069314 3300005441 Bacteria 2245
31 Ga0070678_100044305 3300005456 Bacteria 3176
32 Ga0070678_100242438 3300005456 Bacteria 1508
33 Ga0068867_100066332 3300005459 Bacteria 2688
34 Ga0070698_100041262 3300005471 Bacteria 4738
35 Ga0070698_100070719 3300005471 Bacteria 3501
36 Ga0070699_100028774 3300005518 Bacteria 4791
37 Ga0070679_100014296 3300005530 Bacteria 7623
38 Ga0070684_100056243 3300005535 Bacteria 3433
39 Ga0070697_100063109 3300005536 Bacteria 3025
40 Ga0070672_100062558 3300005543 Bacteria 2937
41 Ga0070665_100004651 3300005548 Bacteria 14331
42 Ga0070665_100042135 3300005548 Bacteria 4589
43 Ga0068859_100067000 3300005617 Bacteria 3625
44 Ga0068859_100158244 3300005617 Bacteria 2344
45 Ga0068864_100005347 3300005618 Bacteria 10520
46 Ga0068864_100098507 3300005618 Bacteria 2589
47 Ga0068864_100265825 3300005618 Bacteria 1597
48 Ga0068861_100076610 3300005719 Bacteria 2607
49 Ga0068870_10015445 3300005840 Bacteria 3622
50 Ga0068863_100002025 3300005841 Bacteria 20082
51 Ga0068863_100073327 3300005841 Bacteria 3238
52 Ga0068858_100148321 3300005842 Bacteria 2204
53 Ga0068860_100000165 3300005843 Bacteria 108321
54 Ga0068860_100013897 3300005843 Bacteria 7893
55 Ga0068860_100158740 3300005843 Bacteria 2180
56 Ga0068860_100175985 3300005843 Bacteria 2068
57 Ga0068862_100014854 3300005844 Bacteria 6468
58 Ga0068862_100028621 3300005844 Bacteria 4693
59 Ga0068862_100061248 3300005844 Bacteria 3234
60 Ga0081455_10000017 3300005937 Bacteria 174550
61 Ga0081455_10000192 3300005937 Bacteria 77713
62 Ga0081540_1000059 3300005983 Bacteria 120226
63 Ga0081539_10000011 3300005985 Bacteria 461887
64 Ga0075365_10019308 3300006038 Bacteria 4206
65 Ga0075365_10052613 3300006038 Bacteria 2694
66 Ga0075368_10003458 3300006042 Bacteria 5273
67 Ga0075364_10067349 3300006051 Bacteria 2353
68 Ga0070716_100073314 3300006173 Bacteria 2019
69 Ga0070712_100013961 3300006175 Bacteria 5145
70 Ga0070712_100128013 3300006175 Bacteria 1921
71 Ga0075367_10001562 3300006178 Bacteria 9899
72 Ga0068871_100061810 3300006358 Bacteria 3060
73 Ga0075430_100150089 3300006846 Bacteria 1941
74 Ga0075433_10009266 3300006852 Bacteria 7872
75 Ga0075433_10066380 3300006852 Bacteria 3166
76 Ga0075434_100005898 3300006871 Bacteria 11199
77 Ga0075434_100012708 3300006871 Bacteria 7987
78 Ga0075434_100246338 3300006871 Bacteria 1807
79 Ga0068865_100024823 3300006881 Bacteria 3937
80 Ga0068865_100037869 3300006881 Bacteria 3260
81 Ga0097620_100066999 3300006931 Bacteria 3625
82 Ga0097620_100158234 3300006931 Bacteria 2344
83 Ga0079104_1000069 3300006946 Bacteria 153993
84 Ga0079104_1000874 3300006946 Bacteria 24733
85 Ga0075435_100014687 3300007076 Bacteria 5868
86 Ga0075435_100050485 3300007076 Bacteria 3348
87 Ga0105240_10159542 3300009093 Bacteria 2680
88 Ga0111539_10000501 3300009094 Bacteria 49848
89 Ga0111539_10014479 3300009094 Bacteria 9845
90 Ga0111539_10020568 3300009094 Bacteria 8128
91 Ga0111539_10102937 3300009094 Bacteria 3351
92 Ga0114129_10058393 3300009147 Bacteria 5396
93 Ga0105248_10081030 3300009177 Bacteria 3649
94 Ga0105238_10117314 3300009551 Bacteria 2642
95 Ga0105249_10089499 3300009553 Bacteria 2877
96 Ga0099796_10001667 3300010159 Bacteria 4600
97 Ga0157378_10055650 3300013297 Bacteria 3524
98 Ga0163162_10336721 3300013306 Bacteria 1641
99 Ga0157375_10015533 3300013308 Bacteria 6818
100 Ga0157375_10075172 3300013308 Bacteria 3402
101 Ga0163163_10014707 3300014325 Bacteria 7198
102 Ga0157379_10080811 3300014968 Bacteria 2912
103 Ga0157379_10308427 3300014968 Bacteria 1443
104 Ga0157376_10029956 3300014969 Bacteria 4338
105 Ga0157376_10110579 3300014969 Bacteria 2418
106 Ga0157376_10268835 3300014969 Bacteria 1600
107 Ga0213873_10011844 3300021358 Bacteria 1878
108 Ga0213874_10003829 3300021377 Bacteria 3379
109 Ga0213876_10000761 3300021384 Bacteria 22250
110 Ga0213875_10000091 3300021388 Bacteria 104903
111 Ga0209677_100207 3300025253 Bacteria 46814
112 Ga0209148_1000485 3300025254 Bacteria 41112
113 Ga0209455_1000721 3300025272 Bacteria 19164
114 Ga0209130_1000348 3300025284 Bacteria 53200
115 Ga0209675_1001492 3300025291 Bacteria 13423
116 Ga0209676_1000026 3300025292 Bacteria 574599
117 Ga0209676_1005383 3300025292 Bacteria 6716
118 Ga0209025_1000753 3300025294 Bacteria 54198
119 Ga0209025_1003376 3300025294 Bacteria 15258
120 Ga0209758_1000602 3300025297 Bacteria 55848
121 Ga0209758_1013635 3300025297 Bacteria 4406
122 Ga0209758_1018438 3300025297 Bacteria 3419
123 Ga0209051_1001336 3300025303 Bacteria 21465
124 Ga0209257_1003961 3300025304 Bacteria 12012
125 Ga0207643_10008046 3300025908 Bacteria 5655
126 Ga0207705_10041848 3300025909 Bacteria 3287
127 Ga0207684_10125040 3300025910 Bacteria 2206
128 Ga0207693_10005024 3300025915 Bacteria 11103
129 Ga0207693_10110703 3300025915 Bacteria 2153
130 Ga0207662_10062425 3300025918 Bacteria 2239
131 Ga0207657_10048261 3300025919 Bacteria 3718
132 Ga0207649_10000053 3300025920 Bacteria 104949
133 Ga0207650_10005890 3300025925 Bacteria 8368
134 Ga0207650_10015745 3300025925 Bacteria 5272
135 Ga0207659_10003230 3300025926 Bacteria 9749
136 Ga0207659_10088253 3300025926 Bacteria 2310
137 Ga0207700_10204062 3300025928 Bacteria 1667
138 Ga0207700_10245790 3300025928 Bacteria 1527
139 Ga0207664_10002065 3300025929 Bacteria 13222
140 Ga0207644_10119939 3300025931 Bacteria 2001
141 Ga0207691_10003024 3300025940 Bacteria 16412
142 Ga0207691_10012414 3300025940 Bacteria 8166
143 Ga0207679_10163696 3300025945 Bacteria 1824
144 Ga0207651_10103682 3300025960 Bacteria 2117
145 Ga0207668_10009080 3300025972 Bacteria 5942
146 Ga0207668_10009839 3300025972 Bacteria 5747
147 Ga0207668_10019453 3300025972 Bacteria 4293
148 Ga0207658_10037235 3300025986 Bacteria 3494
149 Ga0207703_10154142 3300026035 Bacteria 2006
150 Ga0207702_10025488 3300026078 Bacteria 4908
151 Ga0207641_10003711 3300026088 Bacteria 13451
152 Ga0207641_10149339 3300026088 Bacteria 2115
153 Ga0207641_10225365 3300026088 Bacteria 1740
154 Ga0207648_10043954 3300026089 Bacteria 3920
155 Ga0207676_10002368 3300026095 Bacteria 13463
156 Ga0207676_10072470 3300026095 Bacteria 2769
157 Ga0207676_10120409 3300026095 Bacteria 2212
158 Ga0207675_100017582 3300026118 Bacteria 6672
159 Ga0207683_10012312 3300026121 Bacteria 7300
160 Ga0207683_10259655 3300026121 Bacteria 1586
161 Ga0209281_1000192 3300027111 Bacteria 140252
162 Ga0209281_1001202 3300027111 Bacteria 17603
163 Ga0207428_10019225 3300027907 Bacteria 5825
164 Ga0207428_10021085 3300027907 Bacteria 5521
165 Ga0268266_10019229 3300028379 Bacteria 5817
166 Ga0268266_10112390 3300028379 Bacteria 2415
167 Ga0268265_10046249 3300028380 Bacteria 3252
168 Ga0268264_10000021 3300028381 Bacteria 481580
169 Ga0268264_10013425 3300028381 Bacteria 6743
170 Ga0307517_10032600 3300028786 Bacteria 6015
171 Ga0265332_10059586 3300031238 Bacteria 1634
172 Ga0265328_10000012 3300031239 Bacteria 157661
173 Ga0265328_10000019 3300031239 Bacteria 130536
174 Ga0265328_10000351 3300031239 Bacteria 21676
175 Ga0265328_10003980 3300031239 Bacteria 6484
176 Ga0265328_10004115 3300031239 Bacteria 6350
177 Ga0265328_10012558 3300031239 Bacteria 3369
178 Ga0265340_10045236 3300031247 Bacteria 2151
179 Ga0265339_10030353 3300031249 Bacteria 3061
180 Ga0265331_10000020 3300031250 Bacteria 258149
181 Ga0265331_10000733 3300031250 Bacteria 27661
182 Ga0265331_10000975 3300031250 Bacteria 22731
183 Ga0265331_10006010 3300031250 Bacteria 7241
184 Ga0265327_10000105 3300031251 Bacteria 185022
185 Ga0265327_10002694 3300031251 Bacteria 18246
186 Ga0265316_10000429 3300031344 Bacteria 47829
187 Ga0265316_10045570 3300031344 Bacteria 3480
188 Ga0307513_10001351 3300031456 Bacteria 35442
189 Ga0307513_10167265 3300031456 Bacteria 2081
190 Ga0307408_100192837 3300031548 Bacteria 1643
191 Ga0265313_10014597 3300031595 Bacteria 4631
192 Ga0316579_10097911 3300031691 Bacteria 1403
193 Ga0265314_10028553 3300031711 Bacteria 4158
194 Ga0265314_10047470 3300031711 Bacteria 3021
195 Ga0316576_10066109 3300031727 Bacteria 2658
196 Ga0307516_10000042 3300031730 Bacteria 142687
197 Ga0307510_10001071 3300033180 Bacteria 29132
198 Ga0307510_10095690 3300033180 Bacteria 2788
199 Ga0373926_0023311 3300035083 Bacteria 2150
200 Ga0373949_0034387 3300035090 Bacteria 1221
201 Ga0373932_0006386 3300035112 Bacteria 2787
202 Ga0373939_0014752 3300035114 Bacteria 2033
203 Ga0373953_0004202 3300035117 Bacteria 4570
204 Ga0373956_0007253 3300035119 Bacteria 4464
205 Ga0373960_0010335 3300035121 Bacteria 2278
206 Ga0373943_0057490 3300035170 Bacteria 1933
207 Ga0373961_0034466 3300035241 Bacteria 1431
208 Ga0373962_0002349 3300035242 Bacteria 4514
209 Ga0373962_0003414 3300035242 Bacteria 3817
210 Ga0316574_0092291 3300035398 Bacteria 1932
211 Ga0373931_0019788 3300035691 Bacteria 3363
212 Ga0373935_0026793 3300035692 Bacteria 3562
213 Ga0373927_0064266 3300035695 Bacteria 2374
214 Ga0373933_0029248 3300035724 Bacteria 3184
215 Ga0373933_0075051 3300035724 Bacteria 2064
216 Ga0373937_0019276 3300036401 Bacteria 6105
217 Ga0373937_0080736 3300036401 Bacteria 3008
218 Ga0373937_0094853 3300036401 Bacteria 2766
219 Ga0316584_0031170 3300036712 Bacteria 3942
220 Ga0373925_0032140 3300037068 Bacteria 3861
221 Ga0373925_0189110 3300037068 Bacteria 1633
222 Ga0395899_0048473 3300037312 Bacteria 3161
223 Ga0395900_0008878 3300037418 Bacteria 10320
224 Ga0395900_0135330 3300037418 Bacteria 2524
225 Ga0395898_0017077 3300037466 Bacteria 7412
226 Ga0436364_0063767 3300037853 Bacteria 1379
227 Ga0436364_0305762 3300037853 Bacteria 8161
228 Ga0436364_0739979 3300037853 Bacteria 1363
229 Ga0436364_1288607 3300037853 Bacteria 1776
230 Ga0395901_0032763 3300038443 Bacteria 5361
231 Ga0395901_0052767 3300038443 Bacteria 4226
232 Ga0436365_0114960 3300039437 Bacteria 2031
233 Ga0436365_0634586 3300039437 Bacteria 17727
234 Ga0436365_0672708 3300039437 Bacteria 25339
235 Ga0436360_0005204 3300039438 Bacteria 2713
236 Ga0436360_0147615 3300039438 Bacteria 3202
237 Ga0436360_0225321 3300039438 Bacteria 2690
238 Ga0436360_1108815 3300039438 Bacteria 1931
239 Ga0436361_0690471 3300039447 Bacteria 3943
240 Ga0436363_0874280 3300039450 Bacteria 11837
241 Ga0436363_1554709 3300039450 Bacteria 4055
242 Ga0436362_0209881 3300039453 Bacteria 5750
243 Ga0436362_0533926 3300039453 Bacteria 7253
244 Ga0466968_0000967 3300044735 Bacteria 10091
245 Ga0466968_0032675 3300044735 Bacteria 2165
246 Ga0466959_0097615 3300045049 Bacteria 2105
247 Ga0451576_0006708 3300045051 Bacteria 14034
248 Ga0495583_0091218 3300046506 Bacteria 1311
249 Ga0495654_0002878 3300046530 Bacteria 10802
250 Ga0495640_0032082 3300046533 Bacteria 3744
251 Ga0495634_0102651 3300046642 Bacteria 1847
252 Ga0496104_0043476 3300048907 Bacteria 4220
253 Ga0496104_0236755 3300048907 Bacteria 1737
254 Ga0496105_0090679 3300048908 Bacteria 2524
255 Ga0496105_0185321 3300048908 Bacteria 1703
256 Ga0496106_0021696 3300048909 Bacteria 4769
257 Ga0496107_0086459 3300048910 Bacteria 2289
258 Ga0496107_0113005 3300048910 Bacteria 1997
259 Ga0496108_0104945 3300048911 Bacteria 2412
260 Ga0496109_0092823 3300048912 Bacteria 2792
261 Ga0496110_0070972 3300048913 Bacteria 3087
262 Ga0496110_0077365 3300048913 Bacteria 2960
263 Ga0496111_0003317 3300048914 Bacteria 9952
264 Ga0496111_0042230 3300048914 Bacteria 3274
265 Ga0496111_0076147 3300048914 Bacteria 2445
266 Ga0496112_0052448 3300048915 Bacteria 4003
267 Ga0496112_0173763 3300048915 Bacteria 2120
268 Ga0496113_0144393 3300048916 Bacteria 1874
269 Ga0496114_0185450 3300048917 Bacteria 1818
270 Ga0496114_0234422 3300048917 Bacteria 1613
271 Ga0496115_0021529 3300048918 Bacteria 4983
272 Ga0496115_0153469 3300048918 Bacteria 1902
273 Ga0496121_0004716 3300048924 Bacteria 18021
274 Ga0496121_0009856 3300048924 Bacteria 10901
275 Ga0496122_0000009 3300048925 Bacteria 584024
276 Ga0496122_0010110 3300048925 Bacteria 9790
277 Ga0496123_0000020 3300048926 Bacteria 388748
278 Ga0496123_0020699 3300048926 Bacteria 5138
279 Ga0496124_0015396 3300048927 Bacteria 7331
280 Ga0496125_0089762 3300048928 Bacteria 2310
281 Ga0496126_0015877 3300048929 Bacteria 7561
282 Ga0501031_0011569 3300049568 Bacteria 5755
283 Ga0501032_0015919 3300049569 Bacteria 5297
284 Ga0501032_0049723 3300049569 Bacteria 2828
285 Ga0501034_0057224 3300049571 Bacteria 3920
286 Ga0501034_0100882 3300049571 Bacteria 2880
287 Ga0501034_0186518 3300049571 Bacteria 2037
288 Ga0501034_0215885 3300049571 Bacteria 1872
289 Ga0501038_0099954 3300049574 Bacteria 2417
290 Ga0501038_0165857 3300049574 Bacteria 1792
291 Ga0501039_0062695 3300049575 Bacteria 2880
292 Ga0501040_0028861 3300049576 Bacteria 3742
293 Ga0501040_0091287 3300049576 Bacteria 2117
294 Ga0501042_0032013 3300049578 Bacteria 3722
295 Ga0501042_0033322 3300049578 Bacteria 3652
296 Ga0501043_0061705 3300049579 Unclassified 2943
297 Ga0501046_0069627 3300049580 Bacteria 2737
298 Ga0501047_0005005 3300049581 Bacteria 12437
299 Ga0501047_0065343 3300049581 Bacteria 3507
300 Ga0501047_0131079 3300049581 Bacteria 2388
301 Ga0501067_0001936 3300049583 Bacteria 11390
302 Ga0501067_0054977 3300049583 Bacteria 2206
303 Ga0501070_0098618 3300049586 Bacteria 2417
304 Ga0501071_0008118 3300049587 Bacteria 6925
305 Ga0501072_0014604 3300049588 Bacteria 6019
306 Ga0501072_0023505 3300049588 Bacteria 4788
307 Ga0501076_0007395 3300049592 Bacteria 7993
308 Ga0501079_0012358 3300049741 Bacteria 6515
309 Ga0501080_0030099 3300049742 Bacteria 5056
310 Ga0501080_0150581 3300049742 Bacteria 2151
311 Ga0501035_0030006 3300049822 Bacteria 4958
312 Ga0501035_0048859 3300049822 Bacteria 3792
313 Ga0501044_0022959 3300049823 Bacteria 6641
314 Ga0501044_0073053 3300049823 Bacteria 3486
315 Ga0501045_0014611 3300049824 Bacteria 5567
316 nmdc:mga0yw44_14660_c1 3300050492 Bacteria 4170
317 nmdc:mga05p37_102140_c1 3300050507 Bacteria 3531
318 nmdc:mga08y16_5033_c1 3300050511 Bacteria 13813
319 nmdc:mga08y16_76613_c1 3300050511 Bacteria 3486
320 nmdc:mga0n895_3148_c1 3300050512 Bacteria 13170
321 nmdc:mga0n895_87553_c1 3300050512 Bacteria 3112
322 nmdc:mga08x19_132181_c1 3300050514 Bacteria 1679
323 nmdc:mga08x19_94647_c1 3300050514 Bacteria 1975
324 nmdc:mga0a205_10447_c1 3300050515 Bacteria 8528
325 nmdc:mga0sz30_2420_c1 3300050516 Bacteria 6651
326 Ga0495619_0030089 3300053085 Bacteria 3513
327 Ga0500644_0020070 3300053088 Bacteria 1982
328 Ga0500641_0007047 3300053096 Bacteria 4004
329 Ga0500595_000214 3300053119 Bacteria 39457
330 Ga0500595_021717 3300053119 Bacteria 2286
331 Ga0500618_000046 3300053125 Bacteria 109891
332 Ga0500652_000488 3300053131 Bacteria 13946
333 Ga0500658_0014104 3300053134 Bacteria 2957
334 Ga0500616_0000042 3300053153 Bacteria 351293
335 Ga0500616_0019889 3300053153 Bacteria 3777
336 Ga0500616_0046326 3300053153 Bacteria 2312
337 Ga0500636_0002700 3300053177 Bacteria 9869
338 Ga0500636_0004938 3300053177 Bacteria 7576
339 Ga0500637_0002479 3300053178 Bacteria 8215
340 Ga0501084_0002665 3300054114 Bacteria 14367
341 Ga0501082_0077059 3300060353 Bacteria 2874
342 Ga0501082_0145808 3300060353 Bacteria 2055
343 Ga0501082_0346678 3300060353 Bacteria 1294
344 Ga0530510_0058903 3300061734 Bacteria 2777
345 2509112158 2508501122 Bacteria 6292184
346 2516207635 2516143018 Bacteria 6951533
347 2524453831 2524023207 Bacteria 6813453
348 2545673810 2545555834 Bacteria 8130841
349 2596372984 2595698237 Bacteria 6712432
350 2596376529 2595698237 Bacteria 6712432
351 2644001108 2643221598 Bacteria 4578346
352 2644087707 2643221614 Bacteria 4260023
353 2644130377 2643221623 Bacteria 5239945
354 2644741922 2643221736 Bacteria 6608466
355 2719389259 2718217927 Bacteria 6972593
356 2721402024 2718218423 Bacteria 6438183
357 2724035857 2721755809 Bacteria 6438790
358 2738743875 2738541281 Bacteria 5112672
359 2739353105 2738543032 Bacteria 5115625
360 2793298996 2791355256 Bacteria 6798008
361 2793338439 2791355262 Bacteria 6774204
362 2821123699 2821123053 Bacteria 7836056
363 2829750652 2829745981 Bacteria 5406054
364 2834578702 2834578030 Bacteria 3530182
365 2835313913 2835312727 Bacteria 7413381
366 2838674849 2838668709 Bacteria 6671819
367 2838707173 2838701080 Bacteria 6669771
368 2838739270 2838736955 Bacteria 5760694
369 2841763337 2841760612 Bacteria 6454112
370 2841843168 2841840854 Bacteria 5761912
371 2842142950 2842140634 Bacteria 5759631
372 2842151796 2842146304 Bacteria 5957337
373 2842257011 2842250916 Bacteria 6579627
374 2842402052 2842395702 Bacteria 6780583
375 2842696358 2842694124 Bacteria 4063419
376 2842700366 2842698319 Bacteria 5190321
377 2848998627 2848992105 Bacteria 6810864
378 2851182579 2851182111 Bacteria 6047226
379 2855876022 2855872281 Bacteria 6964271
380 2857531261 2857531043 Bacteria 6754041
381 2861693677 2861691609 Bacteria 5628931
382 2889309949 2889306138 Bacteria 6358934
383 2891091164 2891088606 Bacteria 4762464
384 2899260660 2899259804 Bacteria 3320927
385 2902330792 2902330777 Bacteria 6395352
386 2902406491 2902405164 Bacteria 6784948
387 2919172003 2919171160 Bacteria 6499771
388 2921262216 2921257292 Bacteria 6808382
389 2928125653 2928125067 Bacteria 5937560
390 2937027225 2937023124 Bacteria 6815156
391 2957385536 2957382221 Bacteria 6737050
392 2957398972 2957395598 Bacteria 6822399
393 2957405033 2957402308 Bacteria 6741770
394 2964620577 2964615318 Bacteria 6809089
395 2967759950 2967755722 Bacteria 6814706
396 2970107329 2970102677 Bacteria 6812532
397 3000406654 3000405567 Bacteria 3779330
398 3003670680 3003665799 Bacteria 7279786
399 641642016 641522639 Bacteria 7737025
400 643598450 643348564 Bacteria 8839022
401 643823809 643692032 Bacteria 6891900
402 8002062441 8002060224 Bacteria 4026565
403 8005277600 8005275841 Bacteria 6929066
404 8005621052 8005619151 Bacteria 7030230
405 8018182132 8018176218 Bacteria 6896178
406 8023683427 8023680758 Bacteria 7729763
407 Ga0373953_0001225
408 JGI25159J45721_1004048
409 JGI25151J46595_10034827
410 JGI25406J46586_10019667
411 Ga0055536_1007330
412 Ga0055531_10002864
413 Ga0055531_10009385
414 Ga0065165_1000577
415 Ga0070658_10004576
416 Ga0070676_10047800
417 Ga0070670_100016187
418 Ga0070670_100034525
419 Ga0070670_100251401
420 Ga0068869_100019342
421 Ga0070689_100076013
422 Ga0070691_10008828
423 Ga0070687_100100034
424 Ga0070661_100000041
425 Ga0070668_100003127
426 Ga0070668_100010721
427 Ga0070669_100059372
428 Ga0070669_100108458
429 Ga0070675_100011721
430 Ga0070675_100100816
431 Ga0070671_100026930
432 Ga0070674_100064774
433 Ga0070667_100070511
434 Ga0070714_100022279
435 Ga0070713_100142880
436 Ga0070700_100069314
437 Ga0070678_100044305
438 Ga0070678_100242438
439 Ga0068867_100066332
440 Ga0070698_100041262
441 Ga0070698_100070719
442 Ga0070699_100028774
443 Ga0070679_100014296
444 Ga0070684_100056243
445 Ga0070697_100063109
446 Ga0070672_100062558
447 Ga0070665_100004651
448 Ga0070665_100042135
449 Ga0068859_100067000
450 Ga0068859_100158244
451 Ga0068864_100005347
452 Ga0068864_100098507
453 Ga0068864_100265825
454 Ga0068861_100076610
455 Ga0068870_10015445
456 Ga0068863_100002025
457 Ga0068863_100073327
458 Ga0068858_100148321
459 Ga0068860_100000165
460 Ga0068860_100013897
461 Ga0068860_100158740
462 Ga0068860_100175985
463 Ga0068862_100014854
464 Ga0068862_100028621
465 Ga0068862_100061248
466 Ga0081455_10000017
467 Ga0081455_10000192
468 Ga0081540_1000059
469 Ga0081539_10000011
470 Ga0075365_10019308
471 Ga0075365_10052613
472 Ga0075368_10003458
473 Ga0075364_10067349
474 Ga0070716_100073314
475 Ga0070712_100013961
476 Ga0070712_100128013
477 Ga0075367_10001562
478 Ga0068871_100061810
479 Ga0075430_100150089
480 Ga0075433_10009266
481 Ga0075433_10066380
482 Ga0075434_100005898
483 Ga0075434_100012708
484 Ga0075434_100246338
485 Ga0068865_100024823
486 Ga0068865_100037869
487 Ga0097620_100066999
488 Ga0097620_100158234
489 Ga0079104_1000069
490 Ga0079104_1000874
491 Ga0075435_100014687
492 Ga0075435_100050485
493 Ga0105240_10159542
494 Ga0111539_10000501
495 Ga0111539_10014479
496 Ga0111539_10020568
497 Ga0111539_10102937
498 Ga0114129_10058393
499 Ga0105248_10081030
500 Ga0105238_10117314
501 Ga0105249_10089499
502 Ga0099796_10001667
503 Ga0157378_10055650
504 Ga0163162_10336721
505 Ga0157375_10015533
506 Ga0157375_10075172
507 Ga0163163_10014707
508 Ga0157379_10080811
509 Ga0157379_10308427
510 Ga0157376_10029956
511 Ga0157376_10110579
512 Ga0157376_10268835
513 Ga0213873_10011844
514 Ga0213874_10003829
515 Ga0213876_10000761
516 Ga0213875_10000091
517 Ga0209677_100207
518 Ga0209148_1000485
519 Ga0209455_1000721
520 Ga0209130_1000348
521 Ga0209675_1001492
522 Ga0209676_1000026
523 Ga0209676_1005383
524 Ga0209025_1000753
525 Ga0209025_1003376
526 Ga0209758_1000602
527 Ga0209758_1013635
528 Ga0209758_1018438
529 Ga0209051_1001336
530 Ga0209257_1003961
531 Ga0207643_10008046
532 Ga0207705_10041848
533 Ga0207684_10125040
534 Ga0207693_10005024
535 Ga0207693_10110703
536 Ga0207662_10062425
537 Ga0207657_10048261
538 Ga0207649_10000053
539 Ga0207650_10005890
540 Ga0207650_10015745
541 Ga0207659_10003230
542 Ga0207659_10088253
543 Ga0207700_10204062
544 Ga0207700_10245790
545 Ga0207664_10002065
546 Ga0207644_10119939
547 Ga0207691_10003024
548 Ga0207691_10012414
549 Ga0207679_10163696
550 Ga0207651_10103682
551 Ga0207668_10009080
552 Ga0207668_10009839
553 Ga0207668_10019453
554 Ga0207658_10037235
555 Ga0207703_10154142
556 Ga0207702_10025488
557 Ga0207641_10003711
558 Ga0207641_10149339
559 Ga0207641_10225365
560 Ga0207648_10043954
561 Ga0207676_10002368
562 Ga0207676_10072470
563 Ga0207676_10120409
564 Ga0207675_100017582
565 Ga0207683_10012312
566 Ga0207683_10259655
567 Ga0209281_1000192
568 Ga0209281_1001202
569 Ga0207428_10019225
570 Ga0207428_10021085
571 Ga0268266_10019229
572 Ga0268266_10112390
573 Ga0268265_10046249
574 Ga0268264_10000021
575 Ga0268264_10013425
576 Ga0307517_10032600
577 Ga0265332_10059586
578 Ga0265328_10000012
579 Ga0265328_10000019
580 Ga0265328_10000351
581 Ga0265328_10003980
582 Ga0265328_10004115
583 Ga0265328_10012558
584 Ga0265340_10045236
585 Ga0265339_10030353
586 Ga0265331_10000020
587 Ga0265331_10000733
588 Ga0265331_10000975
589 Ga0265331_10006010
590 Ga0265327_10000105
591 Ga0265327_10002694
592 Ga0265316_10000429
593 Ga0265316_10045570
594 Ga0307513_10001351
595 Ga0307513_10167265
596 Ga0307408_100192837
597 Ga0265313_10014597
598 Ga0316579_10097911
599 Ga0265314_10028553
600 Ga0265314_10047470
601 Ga0316576_10066109
602 Ga0307516_10000042
603 Ga0307510_10001071
604 Ga0307510_10095690
605 Ga0373926_0023311
606 Ga0373949_0034387
607 Ga0373932_0006386
608 Ga0373939_0014752
609 Ga0373953_0004202
610 Ga0373956_0007253
611 Ga0373960_0010335
612 Ga0373943_0057490
613 Ga0373961_0034466
614 Ga0373962_0002349
615 Ga0373962_0003414
616 Ga0316574_0092291
617 Ga0373931_0019788
618 Ga0373935_0026793
619 Ga0373927_0064266
620 Ga0373933_0029248
621 Ga0373933_0075051
622 Ga0373937_0019276
623 Ga0373937_0080736
624 Ga0373937_0094853
625 Ga0316584_0031170
626 Ga0373925_0032140
627 Ga0373925_0189110
628 Ga0395899_0048473
629 Ga0395900_0008878
630 Ga0395900_0135330
631 Ga0395898_0017077
632 Ga0436364_0063767
633 Ga0436364_0305762
634 Ga0436364_0739979
635 Ga0436364_1288607
636 Ga0395901_0032763
637 Ga0395901_0052767
638 Ga0436365_0114960
639 Ga0436365_0634586
640 Ga0436365_0672708
641 Ga0436360_0005204
642 Ga0436360_0147615
643 Ga0436360_0225321
644 Ga0436360_1108815
645 Ga0436361_0690471
646 Ga0436363_0874280
647 Ga0436363_1554709
648 Ga0436362_0209881
649 Ga0436362_0533926
650 Ga0466968_0000967
651 Ga0466968_0032675
652 Ga0466959_0097615
653 Ga0451576_0006708
654 Ga0495583_0091218
655 Ga0495654_0002878
656 Ga0495640_0032082
657 Ga0495634_0102651
658 Ga0496104_0043476
659 Ga0496104_0236755
660 Ga0496105_0090679
661 Ga0496105_0185321
662 Ga0496106_0021696
663 Ga0496107_0086459
664 Ga0496107_0113005
665 Ga0496108_0104945
666 Ga0496109_0092823
667 Ga0496110_0070972
668 Ga0496110_0077365
669 Ga0496111_0003317
670 Ga0496111_0042230
671 Ga0496111_0076147
672 Ga0496112_0052448
673 Ga0496112_0173763
674 Ga0496113_0144393
675 Ga0496114_0185450
676 Ga0496114_0234422
677 Ga0496115_0021529
678 Ga0496115_0153469
679 Ga0496121_0004716
680 Ga0496121_0009856
681 Ga0496122_0000009
682 Ga0496122_0010110
683 Ga0496123_0000020
684 Ga0496123_0020699
685 Ga0496124_0015396
686 Ga0496125_0089762
687 Ga0496126_0015877
688 Ga0501031_0011569
689 Ga0501032_0015919
690 Ga0501032_0049723
691 Ga0501034_0057224
692 Ga0501034_0100882
693 Ga0501034_0186518
694 Ga0501034_0215885
695 Ga0501038_0099954
696 Ga0501038_0165857
697 Ga0501039_0062695
698 Ga0501040_0028861
699 Ga0501040_0091287
700 Ga0501042_0032013
701 Ga0501042_0033322
702 Ga0501043_0061705
703 Ga0501046_0069627
704 Ga0501047_0005005
705 Ga0501047_0065343
706 Ga0501047_0131079
707 Ga0501067_0001936
708 Ga0501067_0054977
709 Ga0501070_0098618
710 Ga0501071_0008118
711 Ga0501072_0014604
712 Ga0501072_0023505
713 Ga0501076_0007395
714 Ga0501079_0012358
715 Ga0501080_0030099
716 Ga0501080_0150581
717 Ga0501035_0030006
718 Ga0501035_0048859
719 Ga0501044_0022959
720 Ga0501044_0073053
721 Ga0501045_0014611
722 nmdc:mga0yw44_14660_c1
723 nmdc:mga05p37_102140_c1
724 nmdc:mga08y16_5033_c1
725 nmdc:mga08y16_76613_c1
726 nmdc:mga0n895_3148_c1
727 nmdc:mga0n895_87553_c1
728 nmdc:mga08x19_132181_c1
729 nmdc:mga08x19_94647_c1
730 nmdc:mga0a205_10447_c1
731 nmdc:mga0sz30_2420_c1
732 Ga0495619_0030089
733 Ga0500644_0020070
734 Ga0500641_0007047
735 Ga0500595_000214
736 Ga0500595_021717
737 Ga0500618_000046
738 Ga0500652_000488
739 Ga0500658_0014104
740 Ga0500616_0000042
741 Ga0500616_0019889
742 Ga0500616_0046326
743 Ga0500636_0002700
744 Ga0500636_0004938
745 Ga0500637_0002479
746 Ga0501084_0002665
747 Ga0501082_0077059
748 Ga0501082_0145808
749 Ga0501082_0346678
750 Ga0530510_0058903
751 2509112158
752 2516207635
753 2524453831
754 2545673810
755 2596372984
756 2596376529
757 2644001108
758 2644087707
759 2644130377
760 2644741922
761 2719389259
762 2721402024
763 2724035857
764 2738743875
765 2739353105
766 2793298996
767 2793338439
768 2821123699
769 2829750652
770 2834578702
771 2835313913
772 2838674849
773 2838707173
774 2838739270
775 2841763337
776 2841843168
777 2842142950
778 2842151796
779 2842257011
780 2842402052
781 2842696358
782 2842700366
783 2848998627
784 2851182579
785 2855876022
786 2857531261
787 2861693677
788 2889309949
789 2891091164
790 2899260660
791 2902330792
792 2902406491
793 2919172003
794 2921262216
795 2928125653
796 2937027225
797 2957385536
798 2957398972
799 2957405033
800 2964620577
801 2967759950
802 2970107329
803 3000406654
804 3003670680
805 641642016
806 643598450
807 643823809
808 8002062441
809 8005277600
810 8005621052
811 8018182132
812 8023683427

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02754

CCG

Cysteine-rich domain

179

266

0.95

PF13534

Fer4_17

4Fe-4S dicluster domain

24

86

0.91

PF02754

CCG

Cysteine-rich domain

315

399

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.8218 181 432
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.7925 183 432
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.7061 181 432
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.6873 183 432
1iu9-assembly1.cif.gz_A crystal structure of the c-terminal domain of aspartate racemase from pyrococcus horikoshii ot3 0.6113 313 414
ID Description Score Start End Superfamily
af_P52074_302_386_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9644 317 400 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9555 185 269 3.40.30.10
af_P52074_302_386_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9427 317 400 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9414 317 399 3.40.30.10
af_P0A996_163_249_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9282 185 269 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A356HVX6-F1-model_v4 Cysteine-rich domain-containing protein 0.9692 316 419 GO:0016491
GO:0046872
GO:0051539
AF-A0A527ZBM6-F1-model_v4 Glycolate oxidase iron-sulfur subunit 0.9675 153 269 GO:0016491
GO:0046872
GO:0051539
AF-A0A536S712-F1-model_v4 (Fe-S)-binding protein 0.9671 316 422 GO:0005829
GO:0016491
AF-A0A531KV32-F1-model_v4 Glycolate oxidase iron-sulfur subunit 0.9656 240 428 GO:0016491
GO:0046872
GO:0051539
AF-A0A848YA01-F1-model_v4 Glycolate oxidase iron-sulfur subunit (EC 1.1.99.14) 0.9654 1 431 GO:0016491
GO:0046872
GO:0051539

Map