F436219

General Info

Members Datasets Scaffolds Average Seq Length
406 244 812 120

Family's Representative Sequence

Representative Sequence 3300025905|Ga0207685_10425200|Ga0207685_104252002
Length 136
Sequence MPNLMKFDHLNLPVSNLERSRDWYVGALGLKVEFEVPDTRTVALNDGEGFAIFLQEKPGAAPNGVALWFQVDDVDAAYAQWQARGVAFAHGPRKNFWGYGPELADPDGYLVRLWDERSMKEKCIPSVESRDRQGVP

Samples

Sample ID Description Type Environment
1 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
238 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
239 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.4
Nodule 0
Rhizoplane 0.74
Rhizosphere 92.36
Stem 0
Stem Tuber 0
Unclassified 25.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207685_10425200 3300025905 Bacteria 686
2 Ga0065707_11048108 3300005295 Unclassified 527
3 Ga0070683_101319036 3300005329 Unclassified 694
4 Ga0068868_101931038 3300005338 Unclassified 559
5 Ga0070691_10013368 3300005341 Bacteria 3760
6 Ga0070692_10037075 3300005345 Bacteria 2477
7 Ga0070668_100917452 3300005347 Unclassified 784
8 Ga0070669_100024804 3300005353 Bacteria 4303
9 Ga0070669_101036970 3300005353 Unclassified 705
10 Ga0070669_101053575 3300005353 Bacteria 699
11 Ga0070675_100457770 3300005354 Bacteria 1145
12 Ga0070673_101335103 3300005364 Bacteria 674
13 Ga0070688_101608468 3300005365 Bacteria 530
14 Ga0070659_101311891 3300005366 Unclassified 642
15 Ga0070703_10226625 3300005406 Bacteria 747
16 Ga0070709_10599158 3300005434 Bacteria 848
17 Ga0070714_101335451 3300005435 Bacteria 700
18 Ga0070713_100011746 3300005436 Bacteria 6394
19 Ga0070710_10436928 3300005437 Bacteria 884
20 Ga0070701_10207888 3300005438 Bacteria 1160
21 Ga0070711_100018695 3300005439 Bacteria 4430
22 Ga0070711_100147717 3300005439 Bacteria 1770
23 Ga0070705_100037925 3300005440 Bacteria 2722
24 Ga0070705_100197418 3300005440 Unclassified 1377
25 Ga0070705_100244906 3300005440 Bacteria 1255
26 Ga0070705_100499029 3300005440 Bacteria 923
27 Ga0070700_100848134 3300005441 Bacteria 740
28 Ga0070700_100935006 3300005441 Bacteria 708
29 Ga0070694_100056849 3300005444 Bacteria 2658
30 Ga0070694_100089678 3300005444 Bacteria 2155
31 Ga0070694_100101215 3300005444 Unclassified 2038
32 Ga0070708_100071423 3300005445 Bacteria 3125
33 Ga0070708_100072812 3300005445 Bacteria 3096
34 Ga0070708_100184552 3300005445 Bacteria 1950
35 Ga0070708_100674462 3300005445 Bacteria 973
36 Ga0070708_100987215 3300005445 Bacteria 790
37 Ga0070663_102098699 3300005455 Unclassified 509
38 Ga0070662_100013461 3300005457 Bacteria 5445
39 Ga0068867_100019732 3300005459 Bacteria 4802
40 Ga0068867_100105312 3300005459 Bacteria 2160
41 Ga0068867_100250177 3300005459 Unclassified 1441
42 Ga0070685_11536350 3300005466 Bacteria 514
43 Ga0070706_100011380 3300005467 Bacteria 8267
44 Ga0070706_100074233 3300005467 Bacteria 3148
45 Ga0070706_100206304 3300005467 Bacteria 1835
46 Ga0070706_100378060 3300005467 Bacteria 1319
47 Ga0070706_101328879 3300005467 Bacteria 659
48 Ga0070707_100060322 3300005468 Bacteria 3638
49 Ga0070707_100102253 3300005468 Bacteria 2776
50 Ga0070698_100000641 3300005471 Bacteria 37565
51 Ga0070698_100003649 3300005471 Bacteria 16900
52 Ga0070698_100024785 3300005471 Bacteria 6254
53 Ga0070698_100031432 3300005471 Bacteria 5504
54 Ga0070698_100163566 3300005471 Bacteria 2168
55 Ga0070698_100184745 3300005471 Unclassified 2023
56 Ga0070698_100233477 3300005471 Unclassified 1773
57 Ga0070698_101127773 3300005471 Unclassified 733
58 Ga0070699_100015915 3300005518 Bacteria 6457
59 Ga0070699_100045468 3300005518 Bacteria 3799
60 Ga0070699_100205836 3300005518 Unclassified 1750
61 Ga0070699_100335855 3300005518 Bacteria 1359
62 Ga0070699_100481421 3300005518 Bacteria 1126
63 Ga0070699_101730043 3300005518 Unclassified 573
64 Ga0070679_100384494 3300005530 Bacteria 1350
65 Ga0070684_100134333 3300005535 Bacteria 2233
66 Ga0070697_100000803 3300005536 Bacteria 23568
67 Ga0070697_100035257 3300005536 Bacteria 4035
68 Ga0070697_100213959 3300005536 Bacteria 1642
69 Ga0070697_100266915 3300005536 Unclassified 1466
70 Ga0070697_100288624 3300005536 Unclassified 1409
71 Ga0070697_100546407 3300005536 Bacteria 1016
72 Ga0068853_101199717 3300005539 Unclassified 733
73 Ga0070672_100024184 3300005543 Bacteria 4485
74 Ga0070695_100034697 3300005545 Bacteria 3164
75 Ga0070695_100429014 3300005545 Bacteria 1008
76 Ga0070696_100042313 3300005546 Bacteria 3150
77 Ga0070693_100126787 3300005547 Bacteria 1590
78 Ga0070704_100101965 3300005549 Archaea 2164
79 Ga0070704_100757298 3300005549 Archaea 865
80 Ga0070704_100783174 3300005549 Unclassified 851
81 Ga0068855_100053763 3300005563 Bacteria 4737
82 Ga0070664_101265481 3300005564 Bacteria 696
83 Ga0068857_100061858 3300005577 Bacteria 3327
84 Ga0068856_101732079 3300005614 Bacteria 637
85 Ga0070702_100282586 3300005615 Bacteria 1140
86 Ga0068859_100726813 3300005617 Bacteria 1083
87 Ga0068859_100872719 3300005617 Bacteria 985
88 Ga0068866_10114114 3300005718 Bacteria 1512
89 Ga0068861_100873155 3300005719 Unclassified 850
90 Ga0068870_10334437 3300005840 Unclassified 966
91 Ga0068863_100093798 3300005841 Unclassified 2849
92 Ga0068860_100059878 3300005843 Bacteria 3619
93 Ga0068860_100192551 3300005843 Unclassified 1974
94 Ga0068860_100264609 3300005843 Bacteria 1677
95 Ga0068860_101471581 3300005843 Bacteria 703
96 Ga0068862_100796081 3300005844 Unclassified 923
97 Ga0081455_10000688 3300005937 Bacteria 43874
98 Ga0081455_10196192 3300005937 Bacteria 1516
99 Ga0081540_1009892 3300005983 Bacteria 6510
100 Ga0081539_10007016 3300005985 Bacteria 10450
101 Ga0070717_11157208 3300006028 Unclassified 704
102 Ga0075365_10125385 3300006038 Unclassified 1774
103 Ga0075368_10113396 3300006042 Unclassified 1119
104 Ga0075363_100037228 3300006048 Bacteria 2555
105 Ga0075364_10278181 3300006051 Bacteria 1139
106 Ga0070715_10613090 3300006163 Unclassified 639
107 Ga0070712_100232421 3300006175 Bacteria 1465
108 Ga0075362_10226100 3300006177 Unclassified 915
109 Ga0075362_10777741 3300006177 Unclassified 503
110 Ga0075367_10038138 3300006178 Bacteria 2796
111 Ga0075367_10067914 3300006178 Bacteria 2138
112 Ga0075367_10435408 3300006178 Bacteria 831
113 Ga0075369_10204609 3300006186 Bacteria 911
114 Ga0075366_10150524 3300006195 Unclassified 1409
115 Ga0075428_100000686 3300006844 Bacteria 34847
116 Ga0075428_100036891 3300006844 Bacteria 5383
117 Ga0075428_100122712 3300006844 Bacteria 2828
118 Ga0075428_101675199 3300006844 Bacteria 664
119 Ga0075430_100000086 3300006846 Bacteria 52815
120 Ga0075430_100511685 3300006846 Unclassified 991
121 Ga0075431_100074045 3300006847 Bacteria 3514
122 Ga0075431_100196046 3300006847 Bacteria 2068
123 Ga0075431_100440556 3300006847 Unclassified 1300
124 Ga0075433_10065338 3300006852 Bacteria 3191
125 Ga0075433_10181503 3300006852 Bacteria 1873
126 Ga0075434_100083532 3300006871 Bacteria 3191
127 Ga0075434_100690832 3300006871 Unclassified 1038
128 Ga0075429_100066298 3300006880 Bacteria 3143
129 Ga0068865_100474798 3300006881 Bacteria 1038
130 Ga0068865_101157508 3300006881 Bacteria 683
131 Ga0075436_100056086 3300006914 Bacteria 2722
132 Ga0075436_100068544 3300006914 Unclassified 2451
133 Ga0075436_100069914 3300006914 Bacteria 2426
134 Ga0097620_100726821 3300006931 Bacteria 1083
135 Ga0097620_100872685 3300006931 Bacteria 985
136 Ga0075435_100098033 3300007076 Bacteria 2426
137 Ga0075435_100145647 3300007076 Unclassified 1989
138 Ga0075435_100584398 3300007076 Bacteria 968
139 Ga0099794_10007296 3300007265 Bacteria 4532
140 Ga0099794_10424548 3300007265 Bacteria 696
141 Ga0111539_10000340 3300009094 Bacteria 57536
142 Ga0111539_11278963 3300009094 Bacteria 851
143 Ga0111539_13002609 3300009094 Unclassified 545
144 Ga0114129_10003662 3300009147 Bacteria 21610
145 Ga0114129_10018464 3300009147 Bacteria 9934
146 Ga0114129_10040519 3300009147 Bacteria 6566
147 Ga0114129_10071607 3300009147 Bacteria 4834
148 Ga0114129_11027935 3300009147 Bacteria 1036
149 Ga0114129_12752459 3300009147 Unclassified 585
150 Ga0105243_10002091 3300009148 Bacteria 16915
151 Ga0105243_10086237 3300009148 Bacteria 2575
152 Ga0105243_11640592 3300009148 Bacteria 670
153 Ga0105241_10055417 3300009174 Bacteria 3037
154 Ga0105241_10308254 3300009174 Bacteria 1361
155 Ga0105242_10043240 3300009176 Bacteria 3644
156 Ga0105242_12043058 3300009176 Unclassified 616
157 Ga0105249_10103251 3300009553 Unclassified 2684
158 Ga0105249_10542967 3300009553 Unclassified 1212
159 Ga0105249_10985903 3300009553 Bacteria 911
160 Ga0105035_130811 3300009988 Bacteria 522
161 Ga0105239_11874043 3300010375 Bacteria 695
162 Ga0105239_13190571 3300010375 Bacteria 534
163 Ga0157371_10908192 3300013102 Bacteria 668
164 Ga0157370_10415821 3300013104 Bacteria 1237
165 Ga0157369_11630054 3300013105 Unclassified 656
166 Ga0157378_10084637 3300013297 Bacteria 2872
167 Ga0157378_10176443 3300013297 Bacteria 2007
168 Ga0157378_10511685 3300013297 Bacteria 1201
169 Ga0163162_10050966 3300013306 Bacteria 4152
170 Ga0157375_10158972 3300013308 Bacteria 2401
171 Ga0157380_10244477 3300014326 Unclassified 1620
172 Ga0157376_11777596 3300014969 Bacteria 652
173 Ga0163161_10098990 3300017792 Unclassified 2168
174 Ga0163161_11888176 3300017792 Unclassified 532
175 Ga0213876_10039435 3300021384 Bacteria 2495
176 Ga0207699_10312473 3300025906 Bacteria 1100
177 Ga0207643_10178898 3300025908 Bacteria 1282
178 Ga0207684_10006544 3300025910 Bacteria 10611
179 Ga0207684_10012264 3300025910 Bacteria 7462
180 Ga0207684_10088273 3300025910 Bacteria 2642
181 Ga0207684_10134875 3300025910 Bacteria 2119
182 Ga0207684_11069546 3300025910 Bacteria 672
183 Ga0207654_10019727 3300025911 Bacteria 3564
184 Ga0207654_10317555 3300025911 Bacteria 1064
185 Ga0207693_10020016 3300025915 Bacteria 5324
186 Ga0207663_10095892 3300025916 Bacteria 1980
187 Ga0207663_10117822 3300025916 Bacteria 1813
188 Ga0207646_10040663 3300025922 Bacteria 4180
189 Ga0207646_10060495 3300025922 Bacteria 3382
190 Ga0207646_10152195 3300025922 Bacteria 2086
191 Ga0207646_10153363 3300025922 Unclassified 2078
192 Ga0207646_10233664 3300025922 Bacteria 1661
193 Ga0207681_10051029 3300025923 Bacteria 2801
194 Ga0207681_10406295 3300025923 Bacteria 1101
195 Ga0207681_11208970 3300025923 Unclassified 635
196 Ga0207659_10618641 3300025926 Bacteria 924
197 Ga0207700_10207972 3300025928 Bacteria 1653
198 Ga0207700_10420279 3300025928 Bacteria 1174
199 Ga0207664_10894990 3300025929 Bacteria 797
200 Ga0207706_10018755 3300025933 Bacteria 6223
201 Ga0207686_10014979 3300025934 Bacteria 4328
202 Ga0207709_10001690 3300025935 Bacteria 14840
203 Ga0207709_10053701 3300025935 Bacteria 2481
204 Ga0207665_10228293 3300025939 Unclassified 1367
205 Ga0207711_11480428 3300025941 Bacteria 622
206 Ga0207689_11191463 3300025942 Unclassified 641
207 Ga0207661_10910245 3300025944 Bacteria 810
208 Ga0207667_10122462 3300025949 Bacteria 2680
209 Ga0207712_11450265 3300025961 Bacteria 614
210 Ga0207668_11033643 3300025972 Unclassified 735
211 Ga0207658_11018626 3300025986 Unclassified 756
212 Ga0207639_10850351 3300026041 Bacteria 852
213 Ga0207639_11355715 3300026041 Bacteria 668
214 Ga0207708_10510213 3300026075 Bacteria 1009
215 Ga0207702_11429048 3300026078 Bacteria 685
216 Ga0207641_10081077 3300026088 Bacteria 2817
217 Ga0207648_10083673 3300026089 Unclassified 2783
218 Ga0207648_10360953 3300026089 Bacteria 1311
219 Ga0207676_10405107 3300026095 Bacteria 1276
220 Ga0207674_10009961 3300026116 Bacteria 10815
221 Ga0207675_100091110 3300026118 Unclassified 2867
222 Ga0207675_102156766 3300026118 Bacteria 573
223 Ga0207698_10067712 3300026142 Bacteria 2816
224 Ga0209588_1004204 3300027671 Bacteria 4046
225 Ga0209813_10078646 3300027866 Unclassified 1086
226 Ga0207428_11056775 3300027907 Bacteria 569
227 Ga0268265_12373814 3300028380 Unclassified 537
228 Ga0268264_10134548 3300028381 Unclassified 2196
229 Ga0268264_10245823 3300028381 Archaea 1660
230 Ga0268264_10403730 3300028381 Bacteria 1314
231 Ga0265334_10044600 3300028573 Bacteria 1721
232 Ga0307408_100062920 3300031548 Bacteria 2713
233 Ga0307416_100065243 3300032002 Bacteria 2991
234 Ga0307411_10968212 3300032005 Bacteria 760
235 Ga0373934_0030963 3300035086 Bacteria 2094
236 Ga0373940_0071630 3300035088 Bacteria 1010
237 Ga0373923_0018326 3300035111 Bacteria 2693
238 Ga0373932_0145619 3300035112 Bacteria 809
239 Ga0373936_0044150 3300035113 Bacteria 1793
240 Ga0373936_0461807 3300035113 Unclassified 588
241 Ga0373953_0144711 3300035117 Bacteria 1017
242 Ga0373954_0004578 3300035118 Bacteria 5958
243 Ga0373954_0109909 3300035118 Bacteria 1333
244 Ga0373943_0249292 3300035170 Bacteria 997
245 Ga0373943_0498235 3300035170 Bacteria 712
246 Ga0373946_0169937 3300035171 Unclassified 1028
247 Ga0373946_0676589 3300035171 Unclassified 538
248 Ga0373955_0012155 3300035172 Bacteria 4132
249 Ga0373924_0173661 3300035410 Bacteria 947
250 Ga0373935_1057432 3300035692 Bacteria 603
251 Ga0373927_0283103 3300035695 Unclassified 1091
252 Ga0373927_0392266 3300035695 Unclassified 916
253 Ga0373933_0004313 3300035724 Bacteria 7807
254 Ga0373933_0543551 3300035724 Unclassified 762
255 Ga0373947_0321790 3300035725 Unclassified 1034
256 Ga0373947_1061862 3300035725 Bacteria 552
257 Ga0373947_1255266 3300035725 Unclassified 504
258 Ga0373937_0001284 3300036401 Bacteria 21014
259 Ga0373937_0051861 3300036401 Bacteria 3760
260 Ga0373925_0034377 3300037068 Bacteria 3735
261 Ga0373925_0189038 3300037068 Bacteria 1633
262 Ga0373925_0321355 3300037068 Bacteria 1252
263 Ga0373925_1182994 3300037068 Bacteria 628
264 Ga0395899_0012914 3300037312 Bacteria 6392
265 Ga0395899_0018107 3300037312 Bacteria 5360
266 Ga0395900_0010377 3300037418 Bacteria 9525
267 Ga0395900_0028732 3300037418 Bacteria 5700
268 Ga0395898_0007528 3300037466 Bacteria 11573
269 Ga0395898_0642658 3300037466 Bacteria 1003
270 Ga0395905_0648456 3300037471 Bacteria 958
271 Ga0395901_0011936 3300038443 Bacteria 8810
272 Ga0395901_0018910 3300038443 Bacteria 7043
273 Ga0395901_0025095 3300038443 Bacteria 6119
274 Ga0395901_0174884 3300038443 Bacteria 2252
275 Ga0436365_0633453 3300039437 Bacteria 25670
276 Ga0450919_025907 3300042121 Unclassified 666
277 Ga0439460_0116726 3300042461 Unclassified 870
278 Ga0453683_0050707 3300044673 Bacteria 2600
279 Ga0451576_0291492 3300045051 Bacteria 1706
280 Ga0495651_0615254 3300046462 Bacteria 684
281 Ga0495653_0099604 3300046463 Bacteria 2108
282 Ga0495639_0277634 3300046475 Unclassified 832
283 Ga0495664_0001373 3300046477 Bacteria 12863
284 Ga0495594_0218770 3300046499 Unclassified 1086
285 Ga0495608_0010357 3300046511 Bacteria 6507
286 Ga0495608_0041286 3300046511 Bacteria 3088
287 Ga0495628_0002364 3300046516 Bacteria 17027
288 Ga0495652_0030385 3300046529 Bacteria 4740
289 Ga0495652_1000502 3300046529 Unclassified 547
290 Ga0495640_0054176 3300046533 Bacteria 2749
291 Ga0495587_0224324 3300046536 Bacteria 1059
292 Ga0495598_0084244 3300046537 Bacteria 1025
293 Ga0495645_0000743 3300046543 Bacteria 22265
294 Ga0495633_0132623 3300046558 Bacteria 1153
295 Ga0495667_0025932 3300046559 Bacteria 3948
296 Ga0495667_0045503 3300046559 Bacteria 2905
297 Ga0495659_0184460 3300046664 Unclassified 851
298 Ga0495657_0164868 3300046675 Bacteria 1368
299 Ga0495599_0187813 3300046678 Bacteria 1272
300 Ga0495646_0233552 3300046680 Bacteria 990
301 Ga0495646_0452047 3300046680 Unclassified 663
302 Ga0495669_0273266 3300046684 Bacteria 812
303 Ga0495624_0773345 3300046690 Unclassified 568
304 Ga0495670_0642465 3300046691 Unclassified 578
305 Ga0495600_0139840 3300046809 Bacteria 1571
306 Ga0495600_0931541 3300046809 Unclassified 511
307 Ga0495581_0238214 3300047315 Bacteria 1064
308 Ga0495604_0001064 3300047317 Bacteria 22777
309 Ga0495636_0389100 3300047318 Unclassified 663
310 Ga0495674_0010943 3300047319 Bacteria 8570
311 Ga0495674_1002111 3300047319 Unclassified 640
312 Ga0495680_0060519 3300047322 Bacteria 2918
313 Ga0495680_0554727 3300047322 Unclassified 774
314 Ga0495675_0003905 3300047444 Bacteria 9027
315 Ga0495675_0092556 3300047444 Bacteria 1897
316 Ga0495684_0013916 3300047471 Bacteria 6189
317 Ga0495684_0378249 3300047471 Unclassified 999
318 Ga0495602_0000922 3300048088 Bacteria 28382
319 Ga0495602_0058773 3300048088 Bacteria 3364
320 Ga0496102_0961151 3300048905 Bacteria 775
321 Ga0496106_0248744 3300048909 Bacteria 1421
322 Ga0496113_0753506 3300048916 Bacteria 775
323 Ga0501031_0680349 3300049568 Bacteria 661
324 Ga0501034_0008484 3300049571 Bacteria 10852
325 Ga0501034_0009970 3300049571 Bacteria 9928
326 Ga0501034_0194872 3300049571 Bacteria 1987
327 Ga0501036_1254562 3300049572 Bacteria 603
328 Ga0501039_0208505 3300049575 Bacteria 1537
329 Ga0501040_0661040 3300049576 Unclassified 755
330 Ga0501041_0323441 3300049577 Unclassified 973
331 Ga0501046_0192225 3300049580 Unclassified 1522
332 Ga0501048_0035896 3300049582 Bacteria 3566
333 Ga0501048_0074820 3300049582 Bacteria 2390
334 Ga0501068_0018377 3300049584 Bacteria 4049
335 Ga0501071_0201885 3300049587 Bacteria 1494
336 Ga0501071_0385343 3300049587 Bacteria 1069
337 Ga0501071_1230530 3300049587 Unclassified 578
338 Ga0501072_0002734 3300049588 Bacteria 13234
339 Ga0501072_1576314 3300049588 Unclassified 506
340 Ga0501074_0096377 3300049590 Bacteria 2118
341 Ga0501075_0010538 3300049591 Bacteria 6498
342 Ga0501075_0142446 3300049591 Bacteria 1827
343 Ga0501075_0808541 3300049591 Unclassified 713
344 Ga0501076_0079966 3300049592 Bacteria 2623
345 Ga0501076_0109070 3300049592 Bacteria 2237
346 Ga0501076_0167840 3300049592 Bacteria 1789
347 Ga0501077_0046799 3300049593 Bacteria 2748
348 Ga0501077_0549298 3300049593 Unclassified 741
349 Ga0501079_0187929 3300049741 Unclassified 1612
350 Ga0501079_0339642 3300049741 Unclassified 1176
351 Ga0501079_1426022 3300049741 Unclassified 545
352 Ga0501080_0060632 3300049742 Bacteria 3522
353 Ga0501081_0025705 3300049743 Bacteria 3964
354 Ga0501081_0302511 3300049743 Unclassified 1173
355 Ga0501081_0307244 3300049743 Bacteria 1164
356 Ga0501035_0422923 3300049822 Unclassified 1106
357 Ga0501044_0280088 3300049823 Bacteria 1601
358 Ga0501045_0734882 3300049824 Bacteria 728
359 nmdc:mga00v17_223423_c1 3300050491 Unclassified 1219
360 nmdc:mga0yw44_558202_c1 3300050492 Bacteria 778
361 nmdc:mga0k408_195041_c1 3300050493 Unclassified 1209
362 nmdc:mga06z11_420171_c1 3300050494 Bacteria 806
363 nmdc:mga06z11_54706_c1 3300050494 Bacteria 2058
364 nmdc:mga04h51_119571_c1 3300050495 Unclassified 980
365 nmdc:mga07m45_375708_c1 3300050496 Bacteria 825
366 nmdc:mga05p37_1672694_c1 3300050507 Unclassified 622
367 nmdc:mga05p37_1885683_c1 3300050507 Unclassified 572
368 nmdc:mga05p37_473_c2 3300050507 Bacteria 29340
369 nmdc:mga05p37_64669_c1 3300050507 Bacteria 4501
370 nmdc:mga09592_1690758_c1 3300050508 Unclassified 510
371 nmdc:mga09592_96090_c1 3300050508 Bacteria 2534
372 nmdc:mga0qj67_14675_c1 3300050509 Bacteria 5924
373 nmdc:mga0qj67_347018_c1 3300050509 Unclassified 1200
374 nmdc:mga06r32_11384_c1 3300050510 Bacteria 8012
375 nmdc:mga06r32_74939_c1 3300050510 Bacteria 3282
376 nmdc:mga08y16_325656_c1 3300050511 Bacteria 1581
377 nmdc:mga08y16_5561_c1 3300050511 Bacteria 13196
378 nmdc:mga0n895_134861_c1 3300050512 Unclassified 2495
379 nmdc:mga0n895_33303_c1 3300050512 Bacteria 4952
380 nmdc:mga0n895_644615_c1 3300050512 Bacteria 1058
381 nmdc:mga0rr50_1207672_c1 3300050513 Unclassified 642
382 nmdc:mga0rr50_70037_c1 3300050513 Bacteria 2672
383 nmdc:mga08x19_1259413_c1 3300050514 Bacteria 524
384 nmdc:mga08x19_29525_c1 3300050514 Bacteria 3439
385 nmdc:mga08x19_6557_c1 3300050514 Bacteria 6896
386 nmdc:mga0a205_132124_c1 3300050515 Bacteria 2397
387 nmdc:mga0a205_1526806_c1 3300050515 Unclassified 516
388 nmdc:mga0a205_198452_c1 3300050515 Bacteria 1898
389 nmdc:mga0sz30_242247_c1 3300050516 Bacteria 803
390 Ga0495601_0000302 3300053077 Bacteria 26211
391 Ga0495601_0289212 3300053077 Unclassified 1068
392 Ga0495612_0001502 3300053078 Bacteria 9606
393 Ga0495595_0016411 3300053084 Bacteria 3168
394 Ga0495619_0008151 3300053085 Bacteria 6631
395 Ga0500641_0000183 3300053096 Bacteria 23609
396 Ga0500641_0182316 3300053096 Unclassified 901
397 Ga0500655_012111 3300053133 Bacteria 1566
398 Ga0500658_0114656 3300053134 Bacteria 1189
399 Ga0500568_0005794 3300053139 Bacteria 6311
400 Ga0500552_001516 3300053733 Bacteria 2225
401 Ga0501084_0189690 3300054114 Unclassified 1734
402 Ga0501084_0265871 3300054114 Bacteria 1448
403 Ga0501082_0230563 3300060353 Bacteria 1611
404 Ga0501082_1057804 3300060353 Unclassified 709
405 Ga0530510_0162321 3300061734 Bacteria 1653
406 Ga0530510_0184876 3300061734 Bacteria 1546
407 Ga0207685_10425200
408 Ga0065707_11048108
409 Ga0070683_101319036
410 Ga0068868_101931038
411 Ga0070691_10013368
412 Ga0070692_10037075
413 Ga0070668_100917452
414 Ga0070669_100024804
415 Ga0070669_101036970
416 Ga0070669_101053575
417 Ga0070675_100457770
418 Ga0070673_101335103
419 Ga0070688_101608468
420 Ga0070659_101311891
421 Ga0070703_10226625
422 Ga0070709_10599158
423 Ga0070714_101335451
424 Ga0070713_100011746
425 Ga0070710_10436928
426 Ga0070701_10207888
427 Ga0070711_100018695
428 Ga0070711_100147717
429 Ga0070705_100037925
430 Ga0070705_100197418
431 Ga0070705_100244906
432 Ga0070705_100499029
433 Ga0070700_100848134
434 Ga0070700_100935006
435 Ga0070694_100056849
436 Ga0070694_100089678
437 Ga0070694_100101215
438 Ga0070708_100071423
439 Ga0070708_100072812
440 Ga0070708_100184552
441 Ga0070708_100674462
442 Ga0070708_100987215
443 Ga0070663_102098699
444 Ga0070662_100013461
445 Ga0068867_100019732
446 Ga0068867_100105312
447 Ga0068867_100250177
448 Ga0070685_11536350
449 Ga0070706_100011380
450 Ga0070706_100074233
451 Ga0070706_100206304
452 Ga0070706_100378060
453 Ga0070706_101328879
454 Ga0070707_100060322
455 Ga0070707_100102253
456 Ga0070698_100000641
457 Ga0070698_100003649
458 Ga0070698_100024785
459 Ga0070698_100031432
460 Ga0070698_100163566
461 Ga0070698_100184745
462 Ga0070698_100233477
463 Ga0070698_101127773
464 Ga0070699_100015915
465 Ga0070699_100045468
466 Ga0070699_100205836
467 Ga0070699_100335855
468 Ga0070699_100481421
469 Ga0070699_101730043
470 Ga0070679_100384494
471 Ga0070684_100134333
472 Ga0070697_100000803
473 Ga0070697_100035257
474 Ga0070697_100213959
475 Ga0070697_100266915
476 Ga0070697_100288624
477 Ga0070697_100546407
478 Ga0068853_101199717
479 Ga0070672_100024184
480 Ga0070695_100034697
481 Ga0070695_100429014
482 Ga0070696_100042313
483 Ga0070693_100126787
484 Ga0070704_100101965
485 Ga0070704_100757298
486 Ga0070704_100783174
487 Ga0068855_100053763
488 Ga0070664_101265481
489 Ga0068857_100061858
490 Ga0068856_101732079
491 Ga0070702_100282586
492 Ga0068859_100726813
493 Ga0068859_100872719
494 Ga0068866_10114114
495 Ga0068861_100873155
496 Ga0068870_10334437
497 Ga0068863_100093798
498 Ga0068860_100059878
499 Ga0068860_100192551
500 Ga0068860_100264609
501 Ga0068860_101471581
502 Ga0068862_100796081
503 Ga0081455_10000688
504 Ga0081455_10196192
505 Ga0081540_1009892
506 Ga0081539_10007016
507 Ga0070717_11157208
508 Ga0075365_10125385
509 Ga0075368_10113396
510 Ga0075363_100037228
511 Ga0075364_10278181
512 Ga0070715_10613090
513 Ga0070712_100232421
514 Ga0075362_10226100
515 Ga0075362_10777741
516 Ga0075367_10038138
517 Ga0075367_10067914
518 Ga0075367_10435408
519 Ga0075369_10204609
520 Ga0075366_10150524
521 Ga0075428_100000686
522 Ga0075428_100036891
523 Ga0075428_100122712
524 Ga0075428_101675199
525 Ga0075430_100000086
526 Ga0075430_100511685
527 Ga0075431_100074045
528 Ga0075431_100196046
529 Ga0075431_100440556
530 Ga0075433_10065338
531 Ga0075433_10181503
532 Ga0075434_100083532
533 Ga0075434_100690832
534 Ga0075429_100066298
535 Ga0068865_100474798
536 Ga0068865_101157508
537 Ga0075436_100056086
538 Ga0075436_100068544
539 Ga0075436_100069914
540 Ga0097620_100726821
541 Ga0097620_100872685
542 Ga0075435_100098033
543 Ga0075435_100145647
544 Ga0075435_100584398
545 Ga0099794_10007296
546 Ga0099794_10424548
547 Ga0111539_10000340
548 Ga0111539_11278963
549 Ga0111539_13002609
550 Ga0114129_10003662
551 Ga0114129_10018464
552 Ga0114129_10040519
553 Ga0114129_10071607
554 Ga0114129_11027935
555 Ga0114129_12752459
556 Ga0105243_10002091
557 Ga0105243_10086237
558 Ga0105243_11640592
559 Ga0105241_10055417
560 Ga0105241_10308254
561 Ga0105242_10043240
562 Ga0105242_12043058
563 Ga0105249_10103251
564 Ga0105249_10542967
565 Ga0105249_10985903
566 Ga0105035_130811
567 Ga0105239_11874043
568 Ga0105239_13190571
569 Ga0157371_10908192
570 Ga0157370_10415821
571 Ga0157369_11630054
572 Ga0157378_10084637
573 Ga0157378_10176443
574 Ga0157378_10511685
575 Ga0163162_10050966
576 Ga0157375_10158972
577 Ga0157380_10244477
578 Ga0157376_11777596
579 Ga0163161_10098990
580 Ga0163161_11888176
581 Ga0213876_10039435
582 Ga0207699_10312473
583 Ga0207643_10178898
584 Ga0207684_10006544
585 Ga0207684_10012264
586 Ga0207684_10088273
587 Ga0207684_10134875
588 Ga0207684_11069546
589 Ga0207654_10019727
590 Ga0207654_10317555
591 Ga0207693_10020016
592 Ga0207663_10095892
593 Ga0207663_10117822
594 Ga0207646_10040663
595 Ga0207646_10060495
596 Ga0207646_10152195
597 Ga0207646_10153363
598 Ga0207646_10233664
599 Ga0207681_10051029
600 Ga0207681_10406295
601 Ga0207681_11208970
602 Ga0207659_10618641
603 Ga0207700_10207972
604 Ga0207700_10420279
605 Ga0207664_10894990
606 Ga0207706_10018755
607 Ga0207686_10014979
608 Ga0207709_10001690
609 Ga0207709_10053701
610 Ga0207665_10228293
611 Ga0207711_11480428
612 Ga0207689_11191463
613 Ga0207661_10910245
614 Ga0207667_10122462
615 Ga0207712_11450265
616 Ga0207668_11033643
617 Ga0207658_11018626
618 Ga0207639_10850351
619 Ga0207639_11355715
620 Ga0207708_10510213
621 Ga0207702_11429048
622 Ga0207641_10081077
623 Ga0207648_10083673
624 Ga0207648_10360953
625 Ga0207676_10405107
626 Ga0207674_10009961
627 Ga0207675_100091110
628 Ga0207675_102156766
629 Ga0207698_10067712
630 Ga0209588_1004204
631 Ga0209813_10078646
632 Ga0207428_11056775
633 Ga0268265_12373814
634 Ga0268264_10134548
635 Ga0268264_10245823
636 Ga0268264_10403730
637 Ga0265334_10044600
638 Ga0307408_100062920
639 Ga0307416_100065243
640 Ga0307411_10968212
641 Ga0373934_0030963
642 Ga0373940_0071630
643 Ga0373923_0018326
644 Ga0373932_0145619
645 Ga0373936_0044150
646 Ga0373936_0461807
647 Ga0373953_0144711
648 Ga0373954_0004578
649 Ga0373954_0109909
650 Ga0373943_0249292
651 Ga0373943_0498235
652 Ga0373946_0169937
653 Ga0373946_0676589
654 Ga0373955_0012155
655 Ga0373924_0173661
656 Ga0373935_1057432
657 Ga0373927_0283103
658 Ga0373927_0392266
659 Ga0373933_0004313
660 Ga0373933_0543551
661 Ga0373947_0321790
662 Ga0373947_1061862
663 Ga0373947_1255266
664 Ga0373937_0001284
665 Ga0373937_0051861
666 Ga0373925_0034377
667 Ga0373925_0189038
668 Ga0373925_0321355
669 Ga0373925_1182994
670 Ga0395899_0012914
671 Ga0395899_0018107
672 Ga0395900_0010377
673 Ga0395900_0028732
674 Ga0395898_0007528
675 Ga0395898_0642658
676 Ga0395905_0648456
677 Ga0395901_0011936
678 Ga0395901_0018910
679 Ga0395901_0025095
680 Ga0395901_0174884
681 Ga0436365_0633453
682 Ga0450919_025907
683 Ga0439460_0116726
684 Ga0453683_0050707
685 Ga0451576_0291492
686 Ga0495651_0615254
687 Ga0495653_0099604
688 Ga0495639_0277634
689 Ga0495664_0001373
690 Ga0495594_0218770
691 Ga0495608_0010357
692 Ga0495608_0041286
693 Ga0495628_0002364
694 Ga0495652_0030385
695 Ga0495652_1000502
696 Ga0495640_0054176
697 Ga0495587_0224324
698 Ga0495598_0084244
699 Ga0495645_0000743
700 Ga0495633_0132623
701 Ga0495667_0025932
702 Ga0495667_0045503
703 Ga0495659_0184460
704 Ga0495657_0164868
705 Ga0495599_0187813
706 Ga0495646_0233552
707 Ga0495646_0452047
708 Ga0495669_0273266
709 Ga0495624_0773345
710 Ga0495670_0642465
711 Ga0495600_0139840
712 Ga0495600_0931541
713 Ga0495581_0238214
714 Ga0495604_0001064
715 Ga0495636_0389100
716 Ga0495674_0010943
717 Ga0495674_1002111
718 Ga0495680_0060519
719 Ga0495680_0554727
720 Ga0495675_0003905
721 Ga0495675_0092556
722 Ga0495684_0013916
723 Ga0495684_0378249
724 Ga0495602_0000922
725 Ga0495602_0058773
726 Ga0496102_0961151
727 Ga0496106_0248744
728 Ga0496113_0753506
729 Ga0501031_0680349
730 Ga0501034_0008484
731 Ga0501034_0009970
732 Ga0501034_0194872
733 Ga0501036_1254562
734 Ga0501039_0208505
735 Ga0501040_0661040
736 Ga0501041_0323441
737 Ga0501046_0192225
738 Ga0501048_0035896
739 Ga0501048_0074820
740 Ga0501068_0018377
741 Ga0501071_0201885
742 Ga0501071_0385343
743 Ga0501071_1230530
744 Ga0501072_0002734
745 Ga0501072_1576314
746 Ga0501074_0096377
747 Ga0501075_0010538
748 Ga0501075_0142446
749 Ga0501075_0808541
750 Ga0501076_0079966
751 Ga0501076_0109070
752 Ga0501076_0167840
753 Ga0501077_0046799
754 Ga0501077_0549298
755 Ga0501079_0187929
756 Ga0501079_0339642
757 Ga0501079_1426022
758 Ga0501080_0060632
759 Ga0501081_0025705
760 Ga0501081_0302511
761 Ga0501081_0307244
762 Ga0501035_0422923
763 Ga0501044_0280088
764 Ga0501045_0734882
765 nmdc:mga00v17_223423_c1
766 nmdc:mga0yw44_558202_c1
767 nmdc:mga0k408_195041_c1
768 nmdc:mga06z11_420171_c1
769 nmdc:mga06z11_54706_c1
770 nmdc:mga04h51_119571_c1
771 nmdc:mga07m45_375708_c1
772 nmdc:mga05p37_1672694_c1
773 nmdc:mga05p37_1885683_c1
774 nmdc:mga05p37_473_c2
775 nmdc:mga05p37_64669_c1
776 nmdc:mga09592_1690758_c1
777 nmdc:mga09592_96090_c1
778 nmdc:mga0qj67_14675_c1
779 nmdc:mga0qj67_347018_c1
780 nmdc:mga06r32_11384_c1
781 nmdc:mga06r32_74939_c1
782 nmdc:mga08y16_325656_c1
783 nmdc:mga08y16_5561_c1
784 nmdc:mga0n895_134861_c1
785 nmdc:mga0n895_33303_c1
786 nmdc:mga0n895_644615_c1
787 nmdc:mga0rr50_1207672_c1
788 nmdc:mga0rr50_70037_c1
789 nmdc:mga08x19_1259413_c1
790 nmdc:mga08x19_29525_c1
791 nmdc:mga08x19_6557_c1
792 nmdc:mga0a205_132124_c1
793 nmdc:mga0a205_1526806_c1
794 nmdc:mga0a205_198452_c1
795 nmdc:mga0sz30_242247_c1
796 Ga0495601_0000302
797 Ga0495601_0289212
798 Ga0495612_0001502
799 Ga0495595_0016411
800 Ga0495619_0008151
801 Ga0500641_0000183
802 Ga0500641_0182316
803 Ga0500655_012111
804 Ga0500658_0114656
805 Ga0500568_0005794
806 Ga0500552_001516
807 Ga0501084_0189690
808 Ga0501084_0265871
809 Ga0501082_0230563
810 Ga0501082_1057804
811 Ga0530510_0162321
812 Ga0530510_0184876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

113

0.96

PF18029

Glyoxalase_6

Glyoxalase-like domain

9

114

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fph-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1h 0.9672 27 50
4l0j-assembly1.cif.gz_A structure of a translocation signal domain mediating conjugative transfer by type iv secretion systems 0.8802 27 52
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.8528 1 111
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8452 2 114
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.831 1 113
ID Description Score Start End Superfamily
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8451 1 111 3.10.180.10
af_P52096_9_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8214 8 111 3.10.180.10
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8209 1 59 3.10.180.10
2haxB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.82 27 52 2.40.50.140
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8183 1 111 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6A7MJ20-F1-model_v4 VOC domain-containing protein 0.9905 1 120
AF-A0A6A7MJ20-F1-model_v4 VOC domain-containing protein 0.9823 1 120
AF-A0A2V6WXK0-F1-model_v4 VOC domain-containing protein 0.9224 1 120
AF-A0A2V6WXK0-F1-model_v4 VOC domain-containing protein 0.915 1 120
AF-A0A1M3A916-F1-model_v4 deleted 0.9061 1 120

Map